WO2022010271A1 - 보체 경로 억제제 및 혈관신생 억제제를 포함하는 융합단백질 및 이의 용도 - Google Patents

보체 경로 억제제 및 혈관신생 억제제를 포함하는 융합단백질 및 이의 용도 Download PDF

Info

Publication number
WO2022010271A1
WO2022010271A1 PCT/KR2021/008681 KR2021008681W WO2022010271A1 WO 2022010271 A1 WO2022010271 A1 WO 2022010271A1 KR 2021008681 W KR2021008681 W KR 2021008681W WO 2022010271 A1 WO2022010271 A1 WO 2022010271A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
fusion protein
vegf
protein
crig
Prior art date
Application number
PCT/KR2021/008681
Other languages
English (en)
French (fr)
Inventor
정으뜸
유수민
김동건
장지훈
이병철
Original Assignee
주식회사 카나프테라퓨틱스
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 주식회사 카나프테라퓨틱스 filed Critical 주식회사 카나프테라퓨틱스
Priority to US18/004,613 priority Critical patent/US20230242633A1/en
Priority to CN202180053141.8A priority patent/CN116234822A/zh
Priority to AU2021304993A priority patent/AU2021304993B2/en
Priority to CA3189030A priority patent/CA3189030A1/en
Priority to EP21838564.9A priority patent/EP4180453A4/en
Priority to JP2023501223A priority patent/JP2023533038A/ja
Publication of WO2022010271A1 publication Critical patent/WO2022010271A1/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P27/00—Drugs for disorders of the senses
    • A61P27/02—Ophthalmic agents
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • C07K14/70532—B7 molecules, e.g. CD80, CD86
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70596—Molecules with a "CD"-designation not provided for elsewhere
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/71—Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/22—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto

Definitions

  • a fusion protein comprising a complement pathway inhibitory protein and an angiogenesis inhibitory protein, and an ophthalmic disease using the same, specifically a composition for treating macular degeneration.
  • Macular degeneration refers to a disease characterized by loss of central vision associated with abnormalities of Bruch's membrane, choroid, neural retina and/or retinal pigment epithelium. At the center of the retina is the macula, which is about 1/3 to 1/2 cm in diameter. Below the retina is the choroid, a collection of blood vessels embedded in fibrous tissue, and the pigment epithelium (PE) above the choroid layer. At this time, the choroidal blood vessels provide nutrition to the retina. The choroid and PE are found in the anterior chamber of the eye.
  • Age-related macular degeneration is a disease associated with progressive loss of vision in the central part of the visual field, changes in color discrimination, and abnormal cancer adaptation and sensitivity.
  • AMD is broadly divided into dry or wet AMD.
  • Dry AMD is associated with atrophic cell death in the central retina or macula required for fine vision used for activities such as reading, driving, or facial recognition.
  • About 10-20% of the dry AMD patients progress to a type 2 of AMD known as wet AMD.
  • drusen an abnormal extracellular deposit behind the retinal pigment epithelium.
  • Crystals are the characteristic deposits associated with AMD.
  • Such determinants are known to include complement activators, inhibitors, activation-specific complement fragments, and terminal pathway factors such as the cell membrane attack complex (MAC or C5b-9).
  • MAC or C5b-9 cell membrane attack complex
  • wet AMD is associated with choroidal neovascularization (CNV).
  • CNV choroidal neovascularization
  • the complement system is a critical component of innate immunity against microbial infection and contains a group of proteins that normally exist in an inactive state in serum.
  • the protein is activated through traditional pathways, lectin pathways and alternative pathways. Molecules on the surface of microorganisms can activate this pathway, resulting in the formation of a protease complex known as C3-converting enzyme.
  • Activation of the complement pathway involves biologically active fragments of complement proteins that mediate inflammatory responses in leukocyte chemotaxis, activation of macrophages, neutrophils, platelets, mast cells and endothelial cells, increased vascular permeability, cell lysis, and tissue damage, e.g. For example, it produces C3a, and C5a, such as Anaphylatoxins, and C5b-9 Cell Membrane Attack Complex (MAC).
  • C3a, and C5a such as Anaphylatoxins, and C5b-9 Cell Membrane Attack Complex (MAC).
  • MAC Cell Membrane Attack Complex
  • the present inventors completed the present invention by confirming that a fusion protein that blocks the complement-related pathway and the angiogenesis pathway can be utilized as a therapeutic agent for macular degeneration as a result of research to effectively treat and prevent eye diseases, particularly macular degeneration. .
  • One aspect of the present invention is a CRIg (Complement receptor of the immunoglobulin superfamily) extracellular domain or a fragment thereof; And it provides a fusion protein comprising a protein that specifically binds to VEGF (Vascular endothelial growth factor).
  • CRIg Complement receptor of the immunoglobulin superfamily
  • VEGF Vascular endothelial growth factor
  • Another aspect of the present invention provides a fusion protein dimer in which the two fusion proteins are bound.
  • Another aspect of the present invention provides a polynucleotide encoding the fusion protein.
  • Another aspect of the present invention provides a vector comprising the polynucleotide.
  • Another aspect of the present invention provides a transformed cell into which the vector is introduced.
  • Another aspect of the present invention provides a pharmaceutical composition for the treatment or prevention of eye diseases comprising the fusion protein or fusion protein dimer as an active ingredient.
  • Another aspect of the present invention is a CRIg extracellular domain or fragment thereof for treating an ophthalmic disease; And it provides the use of a fusion protein or a dimer thereof comprising a protein that specifically binds to VEGF.
  • Another aspect of the present invention is a CRIg extracellular domain or fragment thereof for preparing a medicament for the treatment or prevention of eye diseases; And it provides the use of a fusion protein or a dimer thereof comprising a protein that specifically binds to VEGF.
  • Another aspect of the present invention is an extracellular domain of CRIg or a fragment thereof; And it provides a method for treating and/or preventing an eye disease comprising administering to an individual a fusion protein or a dimer thereof comprising a protein that specifically binds to VEGF.
  • the fusion protein comprising a protein that specifically binds to VEGF can effectively inhibit complement-related mechanisms as well as angiogenesis. Accordingly, it is possible to effectively treat or prevent ocular diseases induced by the complement system and ocular diseases induced by angiogenesis. Therefore, the fusion protein can be effectively used to effectively treat macular degeneration, in particular, both dry macular degeneration and wet macular degeneration.
  • 1 is a view showing the SDS-PAGE results of C1.01, C1.02, C1.03, C1.04, C1.05 and C1.06.
  • FIG. 2 is a diagram showing the SDS-PAGE results of C1.03m, C1.04m, and Aflibercept.
  • FIG. 3 is a diagram showing the SDS-PAGE results of C1.01m, C1.02m, C1.06m and C1.07m.
  • FIG. 4 is a diagram showing SDS-PAGE results of rabbit C3, rabbit C3b, rat C3 and rat C3b.
  • FIG. 5 is a diagram showing a schematic diagram of a fusion protein.
  • CRIg-Fc C1.01, left
  • CRIg-Fc-VEGF binder C1.02, middle
  • VEGF binder-Fc-CRIg C1.04, right
  • 6A and 6B are graphs showing the binding affinity of C1.01 and C1.02 to human C3b and human VEGF165 by concentration through Biacore analysis.
  • 7A and 7B are graphs showing the binding affinity of C1.01m and C1.02m to mouse C3b and human VEGF165 by concentration through Biacore analysis.
  • 8A is a graph showing the binding affinity of C1.01, C1.02, C1.03 and C1.04 to human C3b through ELISA.
  • 8B is a graph showing the binding affinity of afilibercept, C1.02, C1.04 and C1.05 to human VEGF165 through ELISA.
  • 8C is a graph showing the binding affinity for mouse C3b, C1.01, C1.02, and C1.03 binding affinity through ELISA.
  • 8D is a graph showing the binding affinity of C1.02 for human C3b, human C2 and human C4 through ELISA.
  • 9A is a graph showing the hydrodynamic radius of C1.01 through dynamic light scattering analysis.
  • 9B is a graph showing the hydrodynamic radius of C1.02 through dynamic light scattering analysis.
  • 11A is a graph showing the inhibitory effect of the alternative complement pathway of C1.01, C1.02 and C1.06 through hemolysis analysis (AH50).
  • 11B is a graph showing the alternative complement pathway inhibitory effect of C1.02, C1.04, C1.04m and C1.05 through hemolysis analysis (AH50).
  • 11C is a graph showing the alternative complement pathway inhibitory effect of C1.01m, C1.02m, C1.06m and C1.07m through hemolysis analysis (AH50).
  • 12A is a graph showing the classical complement pathway inhibitory effect of C1.01, C1.02 and C1.06 through hemolysis analysis (CH50).
  • 12B is a graph showing the classical complement pathway inhibitory effect of C1.02, C1.04, C1.04m and C1.05 through hemolysis analysis (CH50).
  • 12c is a graph showing the classical complement pathway inhibitory effect of C1.01m, C1.02m, C1.06m and C1.07m through hemolysis analysis (CH50).
  • FIG. 13 is a graph showing the VEGF signaling inhibitory effect of afilibercept, C1.01, C1.02, C1.05, and C1.06 using reporter cells.
  • FIG. 14 is a graph showing the VEGF signaling pathway inhibitory effect of C1.01, C1.02, and C1.05 through a wound healing assay.
  • 15A is a graph showing the binding ability of human and cynomolgus monkey C3b to C1.02 and C3b binding ability of human and cynomolgus monkey to C1.06 through ELISA.
  • 15B is a graph showing the binding ability of human, rat and rabbit C3b to C1.02 and C3b binding ability of human, rat and rabbit to C1.06 through ELISA.
  • Figure 15c shows the binding capacity of human, cynomolgus monkey, rat and rabbit VEGF to C1.02; And it is a graph showing the binding capacity of human, cynomolgus monkey, rat and rabbit VEGF to C1.01 through ELISA.
  • 16A is an image confirming choroidal neovascularization in each experimental group through fluorescein angiography after induction of the choroidal neovascularization mouse model, immediately after induction (Day 0) to 7 days after induction (Day 7).
  • 16B is a graph showing the weight of each experimental group after induction of the choroidal neovascularization mouse model, immediately after induction (Day 0), 3 days after induction (Day 3), and 7 days after induction (Day 7).
  • Figure 16c is a graph showing the quantification of the degree of choroidal neovascularization for each experimental group immediately after induction (Day 0) to 7 days after induction (Day 7) after induction of the choroidal neovascularization mouse model.
  • 17 is a graph showing the quantification of the choroidal neovascularization intensity for each experimental group at 7 days and 14 days after induction of the choroidal neovascularization rabbit model.
  • Figure 18a shows the quantification of the presence or absence of choroidal neovascularization in each experimental group immediately after induction and 10 days after induction in the choroidal neovascularization rat model.
  • Figure 18b shows the quantification of the extent of vascular leak in each experimental group immediately after induction and 10 days after induction in the choroidal neovascularization rat model.
  • FIG. 19 is an image showing the granular layer (ONL) of each experimental group of the dry macular degeneration model ( FIGS. 19a to 19c ), the number of granular cells ( FIG. 19d ), the area of the granular layer ( FIG. 19e ), and the C3 expression level in the retina ( It is a figure which shows FIG. 19f).
  • 20A is a graph showing the concentration in the vitreous humor after administration of 2,500 ⁇ g of C1.02 via intraocular injection in rabbits.
  • 20B is a graph showing the concentration in the aqueous humor after administration of 2,500 ⁇ g of C1.02 via intraocular injection in rabbits.
  • One aspect of the present invention is a CRIg (Complement receptor of the immunoglobulin superfamily) extracellular domain or a fragment thereof; And it provides a fusion protein comprising a protein that specifically binds to VEGF (Vascular endothelial growth factor).
  • CRIg Complement receptor of the immunoglobulin superfamily
  • VEGF Vascular endothelial growth factor
  • CRIg refers to the immunoglobulin complement receptor encoded by the VSIG4 gene, also called Protein Z39Ig.
  • the CRIg is a receptor belonging to the type 4 complement receptor among the four types of complement receptors, and is expressed on the surface of macrophages such as Kupffer cells that phagocytose in the liver.
  • the CRIg is an Integral Membrane Protein bound to an extracellular region including an immunoglobulin domain.
  • CRIg binds to the complement fragments C3b and iC3b, and functions to recognize and eliminate bacteria entering the human body or infectious bacteria in the blood by phagocytic cells.
  • the CRIg includes a CRIg isoform or a spliced form.
  • the isoform includes CRIg isoform 1, 2 or 3.
  • the spliced forms include CRIg(L) or CRIg(S).
  • the CRIg(L) may include V and C2-type terminal Ig domains, and CRIg(S) may include only the V-type domain.
  • the CRIg(S) may include the sequence of SEQ ID NO: 20.
  • the CRIg extracellular domain may be a portion excluding the transmembrane domain and cytoplasmic domain portion of the receptor.
  • the CRIg may include a fragment of the CRIg extracellular domain.
  • the fragment of the extracellular domain of CRIg means a cleaved form having the same or similar activity to the extracellular domain of CRIg.
  • the fragment refers to a fragment of CRIg having an activity of promoting complement action or phagocytosis by binding to C3b or iC3b.
  • the CRIg may include the amino acid sequence of SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 74 or SEQ ID NO: 151.
  • human CRIg may have the amino acid sequence of SEQ ID NO: 19, SEQ ID NO: 20, or SEQ ID NO: 151
  • mouse CRIg may have the amino acid sequence of SEQ ID NO: 21.
  • the mouse CRIg extracellular domain may have the amino acid sequence of SEQ ID NO: 75
  • the human CRIg extracellular domain may include the amino acid sequence of SEQ ID NO: 22 or SEQ ID NO: 74.
  • VEGF Vascular endothelial growth factor
  • VEGF Vascular endothelial growth factor
  • VEGF is a vascular endothelial growth factor, which is produced by cells that stimulate blood vessel formation.
  • VEGF is an important signal transduction protein involved in angiogenesis by dividing and proliferating vascular endothelial cells and increasing vascular permeability.
  • the VEGF is known to stimulate abnormal vascular proliferation in the retina in wet AMD.
  • VEGF vascular endothelial growth factor
  • VEGF-based proteins are collectively referred to as "VEGF”.
  • the VEGF-based protein may have an activity equivalent to or similar to that of VEGF.
  • activity may refer to, for example, specific binding to a VEGF receptor, and this specific binding may be measured by a method known to those skilled in the art.
  • the VEGF-based protein may be one or more selected from the group consisting of VEGF-A, VEGF-B, VEGF-C, VEGF-D, VEGF-E, Placental growth factor (PlGF) and recombinant VEGF.
  • the VEGF may be VEGF-A, B or PlGF.
  • the term "PlGF (Placental growth factor)” refers to a transmembrane protein encoded by the 2p21-p16 chromosome.
  • the PlGF acts as a ligand selective for VEGFR-1, and may promote angiogenesis.
  • the PlGF has at least 40% identity with the amino acid composition of VEGF.
  • the PlGF may be PlGF-1 or PlGF-2.
  • the term "recombinant VEGF” refers to VEGF recombined through alternative exon splicing.
  • the recombinant VEGF may be VEGF111, VEGF121, VEGF145, VEGF148, VEFG165, VEGF183, VEGF189 or VEGF206 depending on the number of amino acids.
  • the recombinant VEGF may be VEGF165.
  • protein that specifically binds to VEGF refers to an extracellular domain of an antibody or VEGF receptor that specifically binds to VEGF.
  • VEGF receptor refers to a receptor that binds to VEGF.
  • the VEGF receptor may be any one selected from the group consisting of VEGF receptor 1 (VEGFR-1), VEGF receptor 2 (VEGFR-2), and VEGF receptor 3 (VEGFR-3).
  • VEGF receptors contain an immunoglobulin-(Ig)-like domain, an extracellular domain and an intracellularly isolated kinase domain.
  • the VEGF receptor is activated by binding to a VEGF ligand, so that dimerization or phosphorylation may occur.
  • the VEGF receptor may be VEGF receptor 1 or 2.
  • extracellular domain of a VEGF receptor refers to a domain of a VEGF receptor that binds to the VEGF. Specifically, except for the transmembrane region and the cytoplasmic region of the VEGF receptor, it refers to a portion of the extracellular domain including the ligand of VEGF.
  • the extracellular domain of the VEGF receptor may be a fragment of the VEGF receptor that binds to VEGF.
  • the fragment of the VEGF receptor may include a VEGF receptor domain D1, D2, D3, or a combination thereof, which is a region to which VEGF binds.
  • the fragment of the VEGF receptor may include D2 and D3.
  • the extracellular domain of the VEGF receptor comprises D2 and D3 domains of VEGF receptor 1 or 2.
  • the extracellular domain of the VEGF receptor may bind to VEGF-A, VEGF-B or PlGF to inhibit angiogenesis.
  • an embodiment of the extracellular domain of the VEGF receptor may include the amino acid sequence of SEQ ID NO: 14.
  • the extracellular domain of the VEGF receptor may be in a form in which a portion of the VEGF receptor extracellular domain comprising SEQ ID NO: 14 is cut or altered.
  • antibody that specifically binds to VEGF refers to an antibody or fragment thereof that causes an antigen-antibody reaction by specific binding to VEGF, also referred to as an anti-VEGF antibody.
  • the antibody is a generic term for molecules capable of antigen-antibody binding specifically to VEGF.
  • the antibody may be used in any form as long as it contains an antigen-binding domain capable of specifically binding to VEGF.
  • the antibody or fragment thereof is Fab (Fragment antigen binding), F(ab) 2 , scFv (Single-chain variable fragment), di-scFv, sdAb (Single domain antibody), chimeric antibody, humanized-antibody, human antibody or It may be a variant thereof.
  • the anti-VEGF antibody may be a nanobody.
  • the antibody may include CDR1 of SEQ ID NO: 49, CDR2 of SEQ ID NO: 50, and CDR3 of SEQ ID NO: 51.
  • the antibody may be BI-836880.
  • the anti-VEGF antibody is afilibercept, bevacizumab, ranibizumab, ramucirumab, brolucizumab, paricimab, KSI-301, vanu Vanucizumab, BI-836880, HuMab G6-31, B20-4.1, BAT-5906, Navicixizumab, Dilpacimab, hPV-19 and AT-001 selected from the group consisting of It may include any one variable region.
  • the anti-VEGF antibody may include a variable region of apilibercept, bevacizumab, ranibizumab, brolucizumab, KSI-301, vanucizumab, BI-836880 or BAT-5906.
  • the afilibercept refers to a recombinant humanized fusion protein that inhibits VEGF-A and PlGF in blood vessels.
  • the afilibercept may be directly injected into the eye.
  • the bevacizumab is an antibody that is an angiogenesis inhibitor that inhibits the growth of blood vessels by inhibiting VEGF-A in blood vessels.
  • the bevacizumab can be injected directly into the eye.
  • the ranibizumab is a Fab having an effect on the treatment of wet macular degeneration by inhibiting angiogenesis.
  • the ramucirumab is a substance mediating angiogenesis or an antibody that inhibits VEGF receptor 2.
  • the brolucizumab is an scFv that binds to VEGF-A to inhibit angiogenesis and treats wet macular degeneration.
  • the parisimab is a bispecific antibody that inhibits VEGF-A and angiopoietin-2.
  • the KSI-301 is an antibody having a therapeutic effect on wet macular degeneration.
  • the vanucizumab is a bispecific humanized monochloride antibody that inhibits VEGF-A and angiopoietin-2.
  • the BI-836880 is a humanized bispecific nanobody that inhibits VEGF and angiopoietin-2.
  • the G6-31 is a Fab fragment that inhibits human VEGF.
  • the B20-4.1 is an scFv fragment that inhibits human VEGF.
  • the BAT-5906 is an antibody having a therapeutic effect on wet macular degeneration.
  • the navicizumab is an anti-DLL4/VEGF bispecific antibody.
  • the dilpasimab is an anti-DLL4/VEGF bispecific antibody, also referred to as ABT-165.
  • the hPV-19 is an antibody against VEGF with anti-angiogenic and anti-tumor activity.
  • the AT-001 is an antibody that inhibits angiogenesis by inhibiting human VEGF receptor 3.
  • the anti-VEGF antibody may include a variable region of BI-836880.
  • the antibody may include a heavy chain variable region comprising CDR1 of SEQ ID NO: 49, CDR2 of SEQ ID NO: 50 and CDR3 of SEQ ID NO: 51.
  • the anti-VEGF antibody may include a variable region of bevacizumab.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 77, HCDR2 of SEQ ID NO: 78, HCDR3 of SEQ ID NO: 79 and LCDR1 of SEQ ID NO: 80, LCDR2 of SEQ ID NO: 81, LCDR3 of SEQ ID NO: 82 It may include a light chain variable region.
  • the anti-VEGF antibody may include a variable region of ranibizumab.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 83, HCDR2 of SEQ ID NO: 84, HCDR3 of SEQ ID NO: 85 and LCDR1 of SEQ ID NO: 86, LCDR2 of SEQ ID NO: 87, LCDR3 of SEQ ID NO: 88 It may include a light chain variable region.
  • the anti-VEGF antibody may include a variable region of ramucirumab.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 89, HCDR2 of SEQ ID NO: 90, HCDR3 of SEQ ID NO: 91 and LCDR1 of SEQ ID NO: 92, LCDR2 of SEQ ID NO: 93, LCDR3 of SEQ ID NO: 94 It may include a light chain variable region.
  • the anti-VEGF antibody may include a variable region of paricizumab.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 101, HCDR2 of SEQ ID NO: 102, HCDR3 of SEQ ID NO: 103 and LCDR1 of SEQ ID NO: 104, LCDR2 of SEQ ID NO: 105, LCDR3 of SEQ ID NO: 106 It may include a light chain variable region.
  • the anti-VEGF antibody may include a KSI-301 variable region.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 107, HCDR2 of SEQ ID NO: 108, HCDR3 of SEQ ID NO: 109 and LCDR1 of SEQ ID NO: 110, LCDR2 of SEQ ID NO: 111, LCDR3 of SEQ ID NO: 112 It may include a light chain variable region.
  • the anti-VEGF antibody may include a variable region of vanucizumab.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 113, HCDR2 of SEQ ID NO: 114, HCDR3 of SEQ ID NO: 115 and LCDR1 of SEQ ID NO: 116, LCDR2 of SEQ ID NO: 117, LCDR3 of SEQ ID NO: 118 It may include a light chain variable region.
  • the anti-VEGF antibody may include a variable region of BAT-5906.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 119, HCDR2 of SEQ ID NO: 120, HCDR3 of SEQ ID NO: 121 and LCDR1 of SEQ ID NO: 122, LCDR2 of SEQ ID NO: 123, LCDR3 of SEQ ID NO: 124 It may include a light chain variable region.
  • the anti-VEGF antibody may include a variable region of navicizumab.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 125, HCDR2 of SEQ ID NO: 126, HCDR3 of SEQ ID NO: 127 and LCDR1 of SEQ ID NO: 128, LCDR2 of SEQ ID NO: 129, LCDR3 of SEQ ID NO: 130 It may include a light chain variable region.
  • the anti-VEGF antibody may include a variable region of dilpasimab.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 131, HCDR2 of SEQ ID NO: 132, HCDR3 of SEQ ID NO: 133 and LCDR1 of SEQ ID NO: 134, LCDR2 of SEQ ID NO: 135, LCDR3 of SEQ ID NO: 136 It may include a light chain variable region.
  • the anti-VEGF antibody may include a variable region of hPV-19.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 137, HCDR2 of SEQ ID NO: 138, HCDR3 of SEQ ID NO: 139 and LCDR1 of SEQ ID NO: 140, LCDR2 of SEQ ID NO: 141, LCDR3 of SEQ ID NO: 142 It may include a light chain variable region.
  • the anti-VEGF antibody may include a variable region of AT-001.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 143, HCDR2 of SEQ ID NO: 144, HCDR3 of SEQ ID NO: 145 and LCDR1 of SEQ ID NO: 146, LCDR2 of SEQ ID NO: 147, LCDR3 of SEQ ID NO: 148 It may include a light chain variable region.
  • the anti-VEGF antibody comprises a heavy chain of SEQ ID NO: 36 and a light chain of SEQ ID NO: 37; a heavy chain of SEQ ID NO: 38 and a light chain of SEQ ID NO: 39; a heavy chain of SEQ ID NO: 40 and a light chain of SEQ ID NO: 41; a heavy chain of SEQ ID NO: 43 and a light chain of SEQ ID NO: 44; a heavy chain of SEQ ID NO: 45 and a light chain of SEQ ID NO: 46; a heavy chain of SEQ ID NO: 47 and a light chain of SEQ ID NO: 48; a heavy chain of SEQ ID NO: 64 and a light chain of SEQ ID NO: 65; a heavy chain of SEQ ID NO: 66 and a light chain of SEQ ID NO: 67; a heavy chain of SEQ ID NO: 68 and a light chain of SEQ ID NO: 69; a heavy chain variable region of SEQ ID NO: 70 and a light chain variable region of SEQ ID NO: 70
  • the fragment of the anti-VEGF antibody may be a single chain variable fragment (scFv).
  • the scFv refers to a form in which the heavy chain variable region and the light chain variable region are linked by a peptide linker.
  • the scFv may include a variable region comprising CDR1 of SEQ ID NO: 95, CDR2 of SEQ ID NO: 96, CDR3 of SEQ ID NO: 97, CDR4 of SEQ ID NO: 98, CDR5 of SEQ ID NO: 99 and LCDR6 of SEQ ID NO: 100 have.
  • the scFv may have the amino acid sequence of SEQ ID NO: 42.
  • one embodiment of the scFv may be brolucizumab.
  • the anti-VEGF antibody may include a variable region of HuMab G6-31 or B20-4.1.
  • the antibody comprises a heavy chain variable region comprising HCDR1 of SEQ ID NO: 52, HCDR2 of SEQ ID NO: 53, HCDR3 of SEQ ID NO: 54 and LCDR1 of SEQ ID NO: 55, LCDR2 of SEQ ID NO: 56, LCDR3 of SEQ ID NO: 57 It may include a light chain variable region.
  • the antibody is a heavy chain variable region comprising HCDR1 of SEQ ID NO: 58, HCDR2 of SEQ ID NO: 59, HCDR3 of SEQ ID NO: 60 and a light chain comprising LCDR1 of SEQ ID NO: 61, LCDR2 of SEQ ID NO: 62, LCDR3 of SEQ ID NO: 63 It may include a variable region.
  • the antibody that specifically binds to VEGF may refer to an antibody known to those skilled in the art without limitation.
  • the antibody may be an anti-VEGF antibody or fragment thereof disclosed in US Patent No. 9,527,925 B2, US Patent No. 8,268,314 B2, or US Patent Publication No. US 2019-0167790 A1.
  • the protein that specifically binds to the extracellular domain of CRIg or a fragment thereof and VEGF may be bound through a linker.
  • the extracellular domain of CRIg or a fragment thereof and an immunoglobulin fragment may be linked through a linker.
  • the linker connects two proteins.
  • One embodiment of the linker may include 1 to 50 amino acids, albumin or a fragment thereof, or an Fc domain of an immunoglobulin.
  • the Fc domain of the immunoglobulin includes the heavy chain constant region 2 (CH2) and the heavy chain constant region 3 (CH3) of the immunoglobulin, and includes the variable regions and the light chain constant region 1 (CH1) of the heavy and light chains of the immunoglobulin protein that does not
  • the immunoglobulin may be IgG, IgA, IgE, IgD or IgM, preferably IgG1.
  • the Fc domain may refer to a region including the CH2 and CH3 domains, except for the hinge region.
  • fusion protein may be of the following structural formula (I) or (II):
  • the N' is the N-terminus of the fusion protein
  • X is an extracellular domain of CRIg or a fragment thereof
  • Y is a protein that specifically binds to VEGF
  • linker (1) and linker (2) are peptide linkers
  • n and m are each independently O or 1.
  • the protein that specifically binds to VEGF, the extracellular domain of the CRIg or a fragment thereof, and the Fc domain are as described above.
  • the Fc domain may include the CH2 and CH3 regions of an immunoglobulin Fc heavy chain.
  • the Fc domain of the immunoglobulin may be a wild-type Fc domain as well as an Fc domain variant.
  • the term "Fc domain variant" as used herein is different from the glycosylation pattern of the wild-type Fc domain, increased sugar chains compared to the wild-type Fc domain, reduced sugar chains compared to the wild-type Fc domain, or the sugar chains are removed ( It may be in a deglycosylated form. It also includes an Aglycosylated Fc domain.
  • the Fc domain or variant may have a number of sialic acid, fucosylation, and glycosylation adjusted through culture conditions or host genetic manipulation.
  • the sugar chain of the Fc domain of an immunoglobulin can be modified by a conventional method such as a chemical method, an enzymatic method, and a genetic engineering method using microorganisms.
  • the Fc domain variant may be a mixed form of immunoglobulin IgG, IgA, IgE, IgD or IgM Fc region.
  • the Fc domain variant may be a form in which some amino acids of the Fc domain are substituted with other amino acids.
  • Fc domain variant refers to an Fc domain in which the sugar chain of the wild-type Fc domain is altered, a sequence between Fc domains is mixed, or some amino acids of the wild-type Fc domain are deleted, altered, substituted and/or added. do. Deletion, alteration, substitution and/or addition of some amino acids of the wild-type Fc domain may be prepared by methods known to those skilled in the art. In one embodiment, the Fc domain variant may be one in which some amino acid sequences of the wild-type Fc domain are substituted and/or added.
  • amino acid introduced by the above substitution and/or addition is lysine (K), alanine (A), arginine (R), asparagine (N), aspartic acid (D), cysteine (C), glutamine (Q). ), glutamic acid (E), glycine (G), histidine (H), isoleucine (I), leucine (L), methionine (M), phenylalanine (F), proline (P), serine (S), threonine (T) ), tryptophan (W), tyrosine (Y), and may be any one selected from the group consisting of valine (V).
  • V valine
  • the Fc domain mutation may be to modulate the activity or function of the antibody. In one embodiment, the Fc domain mutation may be to modulate an effector function or antibody cytotoxic activities of an antibody.
  • the Fc domain variant may include a DANG mutation or a NG mutation.
  • the Fc domain variant may be an IgG1 Fc domain in which the 265th sequence is substituted with D to A, the 297th sequence is substituted with N to G, or a combination thereof.
  • the Fc domain may have any one amino acid sequence selected from the group consisting of SEQ ID NO: 6, SEQ ID NO: 11, and SEQ ID NO: 76.
  • the Fc domain may be encoded by the polynucleotide sequence of SEQ ID NO: 28 or SEQ ID NO: 33.
  • the peptide linker (1) may consist of 5 to 80 consecutive amino acids, 20 to 60 consecutive amino acids, or 25 to 50 consecutive amino acids, or 30 to 40 amino acids. In one embodiment, the peptide linker (1) may consist of 30 amino acids. In addition, the peptide linker (1) may include at least one cysteine. Specifically, it may contain one, two or three cysteines. In addition, the peptide linker (1) may be derived from the hinge of an immunoglobulin. In one embodiment, the peptide linker (1) may be a peptide linker consisting of the amino acid sequence of SEQ ID NO: 15 or 17.
  • the peptide linker (2) may consist of 1 to 50 consecutive amino acids, or 3 to 30 consecutive amino acids, or 5 to 15 amino acids.
  • the peptide linker (2) may be (G4S)n (in this case, n is an integer of 1 to 10). In this case, in (G4S)n, n may be 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10.
  • the peptide linker (2) may be a peptide linker consisting of the amino acid sequence of SEQ ID NO: 16 or 18.
  • the fusion protein may be of structural formula (I).
  • the fusion protein may include any one amino acid sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 8, and SEQ ID NO: 10.
  • the fusion protein is 85%, 86%, 87%, 88% of any one amino acid sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 8 and SEQ ID NO: 10; 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity.
  • identity for example, percent homology, may be determined through homology comparison software such as BlastN software of the National Center of Biotechnology Information (NCBI).
  • Another aspect of the present invention provides a dimer to which two fusion proteins comprising the extracellular domain of CRIg or a fragment thereof and a protein specifically binding to VEGF are bound.
  • the bond between the fusion proteins constituting the dimer may be formed by a disulfide bond by a cysteine present in the linker, but is not limited thereto.
  • the fusion proteins constituting the dimer may be the same, but may be different fusion proteins.
  • the dimer may be a homodimer.
  • Another aspect of the present invention provides a polynucleotide encoding a fusion protein comprising the extracellular domain of CRIg or a fragment thereof and a protein that specifically binds to VEGF.
  • the polypeptide is at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 86% SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 8, or SEQ ID NO: 10 , at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96% , an amino acid sequence having at least about 97%, at least about 98%, at least about 99%, or at least about 100% identity.
  • the polynucleotide is at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or at least about 100% identity.
  • the polynucleotide may additionally include a nucleic acid encoding a signal sequence or a leader sequence.
  • signal sequence refers to a signal peptide that directs secretion of a target protein.
  • the signal peptide is cleaved after translation in the host cell.
  • the signal sequence is an amino acid sequence that initiates the movement of the protein through the ER (Endoplasmic reticulum) membrane.
  • the signal sequence is well-known in the art, and typically includes 16 to 30 amino acid residues, but may include more or fewer amino acid residues than that.
  • a typical signal peptide consists of three regions: a basic N-terminal region, a central hydrophobic region, and a more polar C-terminal region.
  • the central hydrophobic region contains 4 to 12 hydrophobic residues that anchor the signal sequence through the membrane lipid bilayer during migration of the immature polypeptide.
  • the signal sequence is cleaved in the lumen of the ER by cellular enzymes commonly known as signal peptidases.
  • the signal sequence may be a secretion signal sequence of tPa (Tissue Plasminogen Activation), HSV gDs (Signal sequence of Herpes simplex virus glycoprotein D), or growth hormone.
  • tPa tissue Plasminogen Activation
  • HSV gDs Synignal sequence of Herpes simplex virus glycoprotein D
  • growth hormone a secretion signal sequence used in higher eukaryotic cells, including mammals, may be used.
  • the signal sequence may be used by using a wild-type signal sequence or by substituting a codon having a high expression frequency in a host cell.
  • Another aspect of the present invention provides a vector comprising the polynucleotide.
  • the vector can be introduced into a host cell, recombination and insertion into the host cell genome. or said vector is understood as a nucleic acid means comprising a polynucleotide sequence capable of spontaneous replication as an episome.
  • Such vectors include linear nucleic acids, plasmids, phagemids, cosmids, RNA vectors, viral vectors and analogs thereof.
  • examples of viral vectors include, but are not limited to, retroviruses, adenoviruses, and adeno-associated viruses.
  • the vector may be plasmid DNA, phage DNA, etc., commercially developed plasmids (pUC18, pBAD, pIDTSAMRT-AMP, etc.), E. coli-derived plasmids (pYG601BR322, pBR325, pUC118, pUC119, etc.), Bacillus subtilis plasmids (pUB110, pTP5, etc.), yeast-derived plasmids (YEp13, YEp24, YCp50, etc.), phage DNA (Charon4A, Charon21A, EMBL3, EMBL4, ⁇ gt10, ⁇ gt11, ⁇ ZAP, etc.), animal virus vectors (retroviruses) ), adenovirus, vaccinia virus, etc.), insect virus vectors (baculovirus, etc.). Since the vector exhibits different protein expression levels and modifications depending on the host cell, it is preferable to select and use a host cell most suitable
  • the term "gene expression” or "expression” of a protein of interest is understood to mean transcription of a DNA sequence, translation of an mRNA transcript, and secretion of a fusion protein product or fragment thereof.
  • a useful expression vector may be RcCMV (Invitrogen, Carlsbad) or a variant thereof.
  • the expression vector includes a human CMV (Cytomegalovirus) promoter to promote continuous transcription of a target gene in mammalian cells, and a bovine growth hormone polyadenylation signal sequence to increase the stable-state level of RNA after transcription. can do.
  • Another aspect of the present invention provides a transformed cell into which the vector is introduced.
  • the host cell of the transformed cell may include, but is not limited to, a cell of prokaryotic, eukaryotic, mammalian, plant, insect, fungal or cellular origin.
  • a cell of prokaryotic, eukaryotic, mammalian, plant, insect, fungal or cellular origin As an example of the prokaryotic cell, E. coli may be used. In addition, yeast may be used as an example of eukaryotic cells.
  • CHO cells, F2N cells, CSO cells, BHK cells, Bowes melanoma cells, HeLa cells, 911 cells, AT1080 cells, A549 cells, HEK 293 cells or HEK293T cells may be used as the mammalian cells. , but is not limited thereto, and any cell that can be used as a mammalian host cell known to those skilled in the art is available.
  • the CaCl 2 precipitation method when introducing the expression vector into a host cell, the CaCl 2 precipitation method, the CaCl 2 precipitation method using a reducing material called DMSO (dimethyl sulfoxide), which increases the efficiency by using the Hanahan method, the electroporation method, the calcium phosphate precipitation method , protoplast fusion method, agitation method using silicon carbide fiber, agrobacterium mediated transformation method, transformation method using PEG, dextran sulfate, lipofectamine and drying/inhibition mediated transformation method, etc.
  • DMSO dimethyl sulfoxide
  • the glycosylation-related gene possessed by the host cell is manipulated through a method known to those skilled in the art, and the sugar chain pattern of the fusion protein (e.g., sialic acid, fucosylation, glycation) can be adjusted.
  • the sugar chain pattern of the fusion protein e.g., sialic acid, fucosylation, glycation
  • the extracellular domain of CRIg or a fragment thereof comprising the step of culturing the transformed cells; And it provides a method for producing a fusion protein or a dimer thereof comprising a protein that specifically binds to VEGF.
  • the production method comprises the steps of i) culturing the transformed cells to obtain a culture; and ii) recovering the fusion protein or a dimer thereof from the culture.
  • the method of culturing the transformed cells can be performed using a method well known in the art. Specifically, the culture may be continuously cultured in a batch process or in a fed batch or repeated fed batch process (Fed batch or Repeated fed batch process).
  • Another aspect of the present invention provides a pharmaceutical composition for the treatment or prevention of eye diseases comprising the fusion protein or a fusion protein dimer to which two fusion proteins are bound as an active ingredient.
  • the fusion protein and the fusion protein dimer are as described above.
  • eye disease may refer to diseases in which the eye is the site of disease.
  • the ocular disease may refer to an ocular disease triggered or aggravated by complement activity or angiogenesis or an ocular disease including excessive angiogenesis as a major condition.
  • the eye diseases include age-related macular degeneration (AMD), map atrophy (GA), choroidal neovascularization (CNV), uveitis, diabetic and other ischemia-related retinopathy, diabetic macular edema, pathological myopia, von Hippel- It may be any one selected from the group consisting of Lindau disease, histoplasmosis of the eye, central retinal vein occlusion (CRVO), corneal neovascularization, and retinal neovascularization.
  • AMD age-related macular degeneration
  • GA map atrophy
  • CNV choroidal neovascularization
  • uveitis diabetic and other ischemia-related retinopathy
  • diabetic macular edema diabetic macular edema
  • pathological myopia von Hippel- It may be any one selected from the group consisting of Lindau disease, histoplasmosis of the eye, central retinal vein occlusion (CRVO), corneal neovascularization,
  • Proteins specifically binding to the extracellular domain of CRIg or fragments thereof and VEGF are as described above.
  • the preferred dosage of the pharmaceutical composition varies depending on the condition and weight of the patient, the degree of disease, the drug form, the route and duration of administration, but may be appropriately selected by those skilled in the art.
  • the active ingredient may exhibit ocular disease therapeutic activity, or, in particular, any amount ( effective amount), a typical effective amount will be determined within the range of 0.001% to 20.0% by weight based on the total weight of the composition.
  • the term "effective amount" refers to an amount of an active ingredient capable of inducing an improvement or treatment effect of an eye disease, particularly an improvement or therapeutic effect of macular degeneration. Such an effective amount can be determined empirically within the ordinary ability of one of ordinary skill in the art.
  • treatment may be used to include both therapeutic treatment and prophylactic treatment. In this case, prevention may be used in the sense of alleviating or reducing a pathological condition or disease of an individual.
  • treatment includes any form of administration or application for treating a disease in a mammal, including a human. The term also includes inhibiting or slowing the disease or its progression; restoring or repairing damaged or missing function, thereby partially or completely alleviating the disease; or stimulate inefficient processes; It includes the meaning of alleviating serious diseases.
  • “enhanced efficacy” eg, improvement in efficacy
  • improved efficacy can be attributed to improved pharmacokinetic parameters and improved efficacy, as determined by comparing parameters such as clearance rate and treatment or improvement of ophthalmic diseases in a test animal or human subject.
  • the term "therapeutically effective amount” or “pharmaceutically effective amount” refers to an amount of a compound or composition effective to prevent or treat a target disease, and treat the disease at a reasonable benefit/risk ratio applicable to medical treatment. It means an amount that is sufficient and does not cause side effects.
  • the level of the effective amount may be determined by the patient's health condition, disease type, severity, drug activity, drug sensitivity, administration method, administration time, administration route and excretion rate, treatment period, factors including the combination or concurrently used drugs; It may be determined according to factors well known in the medical field.
  • a therapeutically effective amount refers to an amount of a drug effective to treat an ocular disease.
  • the pharmaceutical composition may further include a pharmaceutically acceptable carrier.
  • the pharmaceutically acceptable carrier may be any non-toxic material suitable for delivery to a patient. Distilled water, alcohol, fats, waxes and inert solids may be included as carriers. Pharmaceutically acceptable adjuvants (buffers, dispersants) may also be included in the pharmaceutical composition.
  • the pharmaceutical composition may be prepared as a parenteral formulation according to the route of administration by a conventional method known in the art, including a pharmaceutically acceptable carrier in addition to the active ingredient.
  • pharmaceutically acceptable means that it does not inhibit the activity of the active ingredient and does not have toxicity beyond what the application (prescription) target can adapt.
  • the pharmaceutical composition When the pharmaceutical composition is prepared for parenteral use, it may be formulated in the form of injections, transdermal administrations, nasal inhalants and suppositories together with suitable carriers according to methods known in the art.
  • suitable carriers preferably Ringer's solution, PBS (Phosphate Buffered Saline) containing triethanolamine or sterile for injection Water, an isotonic solution such as 5% dextrose, etc. may be used.
  • PBS Phosphate Buffered Saline
  • an isotonic solution such as 5% dextrose, etc.
  • a preferred dosage of the pharmaceutical composition is in the range of 0.01 ug/kg to 10 g/kg, or 0.01 mg/kg to 1 g/kg per day, depending on the patient's condition, weight, sex, age, patient's severity, and administration route. can be Administration may be performed once or divided into several times a day. Such dosages should not be construed as limiting the scope of the present invention in any respect.
  • Subjects to which the pharmaceutical composition can be applied are mammals and humans, particularly preferably humans.
  • the pharmaceutical composition of the present application may further include any compound or natural extract known to have an effect on treating eye diseases, particularly macular degeneration.
  • the extracellular domain of CRIg or a fragment thereof for treating an ophthalmic disease provides the use of a fusion protein or a dimer thereof comprising a protein that specifically binds to VEGF.
  • the extracellular domain of CRIg or a fragment thereof for preparing a medicament for the treatment or prevention of eye diseases provides the use of a fusion protein or a dimer thereof comprising a protein that specifically binds to VEGF.
  • the extracellular domain of CRIg or a fragment thereof provides a method for treating and/or preventing an eye disease comprising administering to an individual a fusion protein or a dimer thereof comprising a protein that specifically binds to VEGF.
  • the fusion protein, the dimer and the eye disease are as described above.
  • the subject may be an individual suffering from an eye disease.
  • the subject may be a mammal, preferably a human.
  • the administration route, dosage, and frequency of administration of the fusion protein or fusion protein dimer may be administered to a subject in various ways and amounts depending on the patient's condition and side effects, and the optimal administration method, dosage and frequency of administration are A person skilled in the art can select within an appropriate range.
  • the fusion protein or fusion protein dimer may be administered in combination with other drugs or physiologically active substances with known therapeutic effects for the disease to be treated, or formulated in the form of a combination preparation with other drugs.
  • the fusion protein may inhibit the complement pathway, phagocytosis and/or angiogenesis. Therefore, it can be effectively used for eye diseases such as wet or dry macular degeneration.
  • eye diseases such as wet or dry macular degeneration.
  • the extracellular domain of CRIg or a fragment thereof and it was confirmed that the case of combining a protein that specifically binds to VEGF has a higher effect and a synergistic effect than when including one. Therefore, the fusion protein can effectively treat dry and wet macular degeneration by effectively inhibiting the complement pathway and angiogenesis.
  • C1.01 (SEQ ID NO: 1) consists of human IgG1 Fc from which the effector function has been removed through the extracellular domain region (20-283), linker, and DANG mutations (D265A, N297G) of human CRIg protein.
  • C1.02 (SEQ ID NO: 2) consists of an extracellular domain region (20-283) of human CRIg protein, a linker and human IgG1 Fc DANG, a linker, and a VEGF binding site of Aflibercept.
  • C1.03 (SEQ ID NO: 3) consists of human IgG1 Fc DANG, a linker and the extracellular domain region (20-283) of human CRIg protein.
  • C1.04 (SEQ ID NO: 4) is composed of the VEGF binding site of apilibercept and the linker, human IgG1 Fc DANG, the linker and the extracellular domain region (20-283) of the human CRIg protein.
  • C1.05 (SEQ ID NO: 5) is composed of the VEGF binding site of afilibercept, a linker and human IgG 1 Fc DANG.
  • C1.06 (SEQ ID NO: 6) consists of human IgG 1 Fc DANG.
  • C1.01m (SEQ ID NO: 7) is composed of mouse IgG2a Fc in which the effector function is removed through the extracellular domain region (20 to 187), linker and DANG mutations (D265A, N297G) of the mouse CRIg protein.
  • C1.02m (SEQ ID NO: 8) consists of the extracellular domain region (20 to 187) of the mouse CRIg protein, a linker, a mouse IgG2a Fc DANG, a linker, and a VEGF binding site of Aflibercept.
  • C1.03m (SEQ ID NO: 9) consists of a mouse IgG2a Fc DANG, a linker and an extracellular domain region (20-187) of the mouse CRIg protein.
  • C1.04m (SEQ ID NO: 10) is composed of the VEGF binding site of apilibercept and the linker, mouse IgG2a Fc DANG, the linker and the extracellular domain region (20 to 187) of the mouse CRIg protein.
  • C1.06m (SEQ ID NO: 11) consists of mouse IgG2a Fc DANG.
  • C1.07m (SEQ ID NO: 12) is mouse IgG2a It consists of Fc DANG, a linker and the VEGF binding site of afilibercept.
  • Tables 2 and 3 below describe the reagents and equipment used.
  • the synthesized DNA fragment was amplified through PCR, and the PCR product was purified with a gel. After cutting the pTT5 vector with restriction enzymes EcoRI and BamHI, the gel was purified. Each PCR product and the linear vector were ligated using the In-Fusion Kit. The resulting vector was transformed into ECOS101 DH5 ⁇ competent cells and cultured on 2xYT agar plates containing 100 ⁇ g/ml ampicillin. All manipulations were performed according to standard transformation protocols. Positive recombinants were confirmed by colony PCR, and sequence-verify sequencing was performed on the recombinant plasmid. A single colony was selected and the seed culture was inoculated into 5 mL 2 x YT medium containing 100 ⁇ g/ml ampicillin. Incubated with shaking at 37°C for 8 hours.
  • the seed cells were diluted in 200 mL of selective 2 x YT medium at a ratio of 1:1,000. Incubated with shaking at 37°C for 16 hours. Bacterial cells were harvested by centrifugation at 4,700 rpm at 4°C for 10 minutes. Resuspend the bacterial pellet in 12 mL of RES-EF solution. Then, 12 mL of LYS-EF solution was added, and the sealed tube was vigorously inverted to thoroughly mix, and then incubated for 5 minutes at room temperature. 12 mL of NEU-EF solution was added to the lysate and inverted vigorously to mix thoroughly.
  • a homogeneous suspension of the precipitate was prepared by inverting the lysate tube 3 times to prevent clogging of the filter. Then, the NucleoBond® Xtra column filter and the NucleoBond® Xtra column were washed with 10 mL of filter washing solution FIL-EF. Remove the NucleoBond® Xtra column filter by pulling out or inverting the column. Wash the NucleoBond® Xtra column with 90 mL of wash solution ENDO.
  • the NucleoBond® Xtra column was washed with 45 mL of wash solution WASH-EF. Plasmid DNA was eluted with 15 mL of elution solution ELU. The eluate was collected in a 50 mL centrifuge tube. 10.5 mL of room temperature isopropanol was added to precipitate the eluted plasmid DNA. After vortexing, the mixture was left standing for 2 minutes.
  • 293F seed strain containing complete medium was maintained in an incubator shaker at 130 rpm, 37°C and 8% CO 2 .
  • Cells were cultured at a density of 0.3 to 0.4x10 6 cells/ml, and the medium was changed every 2 to 3 days.
  • 24 hours before transfection freshly passaged 293F cells were prepared at 2.6x10 6 cells/ml.
  • the prepared cells were cultured in an incubator shaker at 130 rpm, 37° C. and 8% CO 2 .
  • On the day of transfection cells were adjusted to a density of 5.0x10 6 cells/ml using fresh medium. A total volume of 1 L was performed in a 3 L shaker flask.
  • HC and 0.6 mg LC plasmids were diluted with 50 ml OPTI MEM I and filtered through a 0.22 ⁇ m filter. Then, 2 mg PEI was diluted with 50 mL OPTI MEM I to prepare transfection reagent.
  • Diluted PEI was added to the DNA mixture and mixed immediately. Then, incubated at room temperature for 15 minutes.
  • a DNA-PEI mixture was added to 293F cells prepared at 2.6x10 6 cells/ml. Thereafter, the cells were cultured continuously for 24 hours in an incubator shaker at 130 rpm, 37° C. and 8% CO 2 . 24 hours after transfection, 10% peptone was added to 1/20 of the culture solution to a final concentration of 0.5%. Thereafter, the cells were continuously cultured in an incubator shaker at 130 rpm, 37° C. and 8% CO 2 . Cell density/viability was measured and recorded daily in the 2-5 day period post-transfection. Cells were harvested for purification 7 days after transfection or when cell viability was less than 70%.
  • Tables 5 to 7 below show the reagents used for protein purification, the composition of each solution, and equipment.
  • Proteins were purified using a Mabselect sure column. Specifically, the supernatant was harvested by centrifugation at 2,000xg and 4°C for 20 minutes. Then, the supernatant was filtered through a Sartopore 2 filter. The clarified supernatant was loaded onto a 5 ml MabSelect Sure column equilibrated with solution A. After that, the column was washed with solution A until the A280 absorbance reached the baseline. The column was washed with 10 CV solution B. The column was washed with 10 CV solution A. The bound protein was eluted with 6 CV solution C, 1/6 volume of solution D was added to neutralize the eluted material, and SDS-PAGE and SEC-HPLC analysis were performed.
  • the protein was purified through a HIC column.
  • the protein was then dialyzed against solution E at 4° C. overnight.
  • the supernatant was loaded onto a HIC column equilibrated with solution E.
  • the column was washed with solution E until the A280 absorbance reached a baseline value.
  • the bound protein was eluted by gradient elution (10 CV solution F 0%-40%).
  • the bound protein was eluted with 2 CV 100% solution F, and SDS-PAGE analysis was performed.
  • the proteins were collected in one place, and then the protein was dialyzed against the final solution at 4°C overnight. Then, SDS-PAGE and SEC-HPLC analysis were performed.
  • a DNA fragment corresponding to the protein sequence was synthesized in Genewiz (No. 80-383034849).
  • the corresponding DNA fragment was amplified by PCR and introduced using the linearized pcDNA3.3 expression vector. After verifying the structure through sequencing, a sufficient amount of DNA was obtained to perform cell transfection through a large-scale plasmid manufacturing process.
  • Plasmid DNA and ExpiFectamine TM 293 reagent were first diluted in Opti-MEM, mixed and added to the cell culture medium.
  • Cell culture was performed on a platform shaker at a stirring speed of 150 rpm. The temperature was maintained at 37° C. and the CO 2 concentration was 8%. After 18 to 20 hours after transfection, enhancer 1 and enhancer 2 were added to the cell culture medium.
  • ThermoFisher After 6 days of cell culture, the cells were centrifuged at 4,000 rpm at 25° C. for 10 minutes. The supernatant was collected for purification and gel electrophoresis. The supernatant was loaded onto an SDS-PAGE gel according to the instructions for NuPAGETM 4-12% Bis-Tris Protein Gels (ThermoFisher). A PageRuler TM Unstained Protein Ladder (ThermoFisher) was used together with the protein sample to measure the molecular weight of the protein. The remaining supernatant of each protein was used for subsequent purification.
  • Protein purification was performed as follows. Specifically, the Protein A column (Protein A column) was prepackaged with MabSelect Sure resin. Before loading the cell culture, the column was equilibrated with 0.1 M Tris, pH 7.0. After loading the cell culture medium, the column was washed with 0.1 M Tris, pH 7.0, and then eluted with 0.1 M glycine, pH 3.5. The eluted material was neutralized by adding 0.1 M Tris, pH 9.0. Then, the sample was dialyzed in PBS solution (Sangon Biotech, B548117-0500).
  • the SEC column Prior to sample loading, the SEC column (GE lifesciences, Superdex 200 increase 10/300) was equilibrated with PBS. After loading, samples were eluted with PBS and collected by chromatography. SDS-PAGE was performed to analyze each peak. Each sample was dialyzed against a formulation solution (10 mM Sodium phosphate, 0.3 to 0.4 M NaCl, pH 6.8).
  • the CHT column was prepackaged with CHT resin (Bio-rad, MPC TM Ceramic Hydroxyfluoroapatite), and equilibrated with solution A (10 mM sodium phosphate, 30 mM NaCl, pH 6.8) before loading the sample. After loading, the column was eluted with 30% solution B (10 mM Sodium phosphate, 1 M NaCl, pH 6.8), followed by a linear gradient of 30% to 90% solution B and a final 100% solution B. The eluate was characterized by SDS-PAGE, and the sample was dialyzed against a formulation solution (10 mM Sodium phosphate, 0.3 to 0.4 M NaCl, pH 6.8). The final protein was filtered through a 0.2 ⁇ m filter, and aseptically dispensed in an amount of 0.5 mL into 1.5 mL tubes.
  • CHT resin Bio-rad, MPC TM Ceramic Hydroxyfluoroapatite
  • the concentration of the protein was measured at 280 nm using a nano drop.
  • the purity of the protein was confirmed by SDS-PAGE and HPLC-SEC.
  • SDS-PAGE samples were prepared by mixing 15 ⁇ L of purified protein and 5 ⁇ L of 4x loading buffer, and boiling for 5 minutes. 15 ⁇ L of the mixed sample was loaded on NuPAGE Bis-Tris Mini Gels 4 to 12% gel. In order to proceed with SEC-HPLC analysis, 80 ⁇ L of purified protein was loaded on a TSKgel G3000SWxl column of HPLC system 1260 Infinity II, pH 7.0, 50 mM sodium phosphate, 150 mM sodium chloride was used as a running buffer.
  • Tables 9 to 11 below show the composition and equipment of reagents and solutions used for C3 purification of rabbits and rats.
  • DEAE column solution A 10 mM Potassium phosphate (KH 2 PO 4 ), 5 mM ethylenediaminetetraacetic acid disodium salt (EDTA), 1 mM benzamidine, pH 7.8 solution B 10 mM Potassium phosphate (KH 2 PO 4 ), 5 mM EDTA, 1 mM benzamidine, 1 M sodium chloride (NaCl), pH 7.8 MonoS column solution A 50 mM Sodium phosphate (NaH 2 PO 4 ) solution B 50 mM Sodium phosphate (NaH 2 PO 4 ), 1 M sodium chloride (NaCl), pH 5.5 S200 column solution Phosphate-buffered saline (PBS), pH 7.4
  • the volume, A280, and conductivity of the dialysate were checked. If the solution was turbid or precipitated, the precipitate was removed by centrifugation at 4,000xg, 4°C for 15 minutes. The dialysate was filtered through a 0.2 ⁇ m filter and stored on ice until purification.
  • Protein purification was performed in the order of anion exchange chromatography, cation exchange chromatography, and size exclusion chromatography.
  • the DEAE column (GE healthcare, HiPrep TM DEAE Fast Flow 16/10) was equilibrated with solution A (10 mM KH 2 PO 4 , 5 mM EDTA, 1 mM benzamidine, pH 7.8).
  • solution A 10 mM KH 2 PO 4 , 5 mM EDTA, 1 mM benzamidine, pH 7.8
  • the column was washed with solution A and eluted with a 0-50% linear gradient solution B (10 mM KH 2 PO 4 , 5 mM EDTA, 1 mM benzamidine, 1 M NaCl, pH 7.8).
  • the compartments of the eluate were analyzed through SDS-PAGE, and A280 was identified by collecting the compartments including C3.
  • the obtained eluate was dialyzed in 2L Mono S solution A (50 mM Sodium phosphate) at 4°C for 2 hours.
  • the Mono S column (GE healthcare, Mono S ® 5/50 GL) was equilibrated with solution A (50 mM sodium phosphate) before loading the dialysate. After DEAE eluent loading, the column was washed with solution A and eluted with 0-35% linear gradient solution B (50 mM Sodium phosphate, 1 M NaCl, pH 5.5). Partitions of the eluate were analyzed through SDS-PAGE, and A280 was identified by collecting the peak partitions located in the center.
  • the SEC column Prior to sample loading, the SEC column (GE lifesciences, Superdex 200 increase 10/300) was equilibrated with PBS. After loading, samples were eluted with PBS and collected by chromatography. SDS-PAGE was performed to analyze each peak. A280 was confirmed by collecting the peak C3 compartments located in the center.
  • C3 was prepared by diluting 0.5 mg/mL of PBS. C3 was converted to C3b by adding 0.4 ⁇ M factor B, 0.05 ⁇ M factor D and 5 mM MgCl 2 , and incubating at 25° C. for 30 minutes. C3b was further purified through a Superdex 200 (60 mL) gel filtration column. Next, SDS-PAGE and SEC-HPLC analysis of rabbit C3, rabbit C3b, rat C3 and rat C3b were performed.
  • Table 12 shows the materials and reagents used.
  • 1 L 1x HBS-EP+ buffer was prepared by mixing 100 mL 10x HBS-EP+ buffer with 900 mL Milli-Q water. After mixing 50 mM NHS and 200 mM EDC in a 1:1 ratio for 420 seconds, the CM5 chip was activated at a flow rate of 10 uL/min. To reach a fixation level of about 10,000 RU, 25 ug/mL of anti-human immunoglobulin G(Fc) antibody (pH 5.0 acetate) was injected at a rate of 10 uL/ml for 400 seconds. The remaining activated ester groups were blocked by injecting 1 M ethanolamine (pH 8.5) at a rate of 10 uL/min for 420 seconds. To stabilize the baseline, the sensor chip was washed with 1xHBS-EP+ at a rate of 10 uL/min for 16 hours.
  • a startup cycle consisting of a sample step and a regeneration step was performed three times for baseline stabilization.
  • Sample step: 1x HBS-EP+ buffer was injected into the flow cell at a flow rate of 30 uL/min for 120 seconds, followed by a cleavage phase for 120 seconds and a stabilization phase for 30 seconds.
  • Regeneration step: 10 mM glycine pH 1.5 was injected into the flow cell at a rate of 30 uL/min for 30 seconds, followed by a stabilization step of 30 seconds.
  • C3b stock solution was diluted to 50 nM using 1x HBS-EP+ buffer.
  • Human VEGF165 was diluted to 5 nM using 1x HBS-EP+ buffer.
  • the 50 nM and 5 nM solutions were then diluted to 0.78125 nM and 0.078125 nM.
  • the diluted antigens were injected into the flow cell at a rate of 30 uL/min.
  • Two 0 nM antigens (1x HBS-EP+ buffer) were used to remove the reference signal. Bind for 180 seconds and separated for 400 seconds. After the separation time, a stabilization step for 60 seconds was performed.
  • 10 mM pH 1.5 glycine (Glycine) was injected into the flow cells at a rate of 30 uL/min for 30 seconds, followed by a stabilization step for 60 seconds.
  • binding kinetics were calculated using Biacore Insight Evaluation Software (Version 2.0.15.12933) and 1:1 binding model for curved fitting.
  • Table 13 below shows the binding affinities of the test substances.
  • human C3b protein was immobilized on a plate and bound to C1.01, C1.02, C1.03, C1.04, and hIgG1 as a control.
  • an anti-human immunoglobulin G antibody and an anti mustard radish peroxidase (HRP) antibody were sequentially coupled.
  • mouse C3b protein was immobilized on a plate, and C1.01m to C1.03m containing mouse CRIg were bound to mouse C3b.
  • FIG. 8A it was confirmed that C1.01, C1.02, C1.03 and C1.04 containing CRIg bind to human C3b in a concentration dependent manner.
  • FIG. 8c it was confirmed that C1.01m to C1.03m containing mouse CRIg also bind to mouse C3b in a concentration-dependent manner.
  • the binding of the fusion protein and human VEGF165 protein to human VEGF165 was determined through enzyme immunoassay, afilibercept, C1.02, C1.04 and C1.05. of the binding affinity was confirmed through ELISA.
  • human VEGF165 protein was immobilized on a plate, and C1.02, C1.04, C1.05, and Aflibercept and hIgG 1 were bound as controls.
  • an anti-human immunoglobulin G antibody and an anti mustard radish peroxidase (HRP) antibody were sequentially coupled.
  • the fusion protein of one embodiment binds to C3b of the alternative pathway and inhibits the alternative pathway, but does not bind to human C2 or C4 protein of the classical pathway and thus does not inhibit the classical pathway.
  • one specific method through an enzyme immunoassay method Binding of the example fusion protein C1.01 and human Cb3, C2 and C4 proteins was confirmed.
  • human Cb3, C2 or C4 protein was immobilized on the plate and C1.02 was bound.
  • the anti-human immunoglobulin G antibody and the anti mustard radish peroxidase (HRP) antibody were sequentially coupled.
  • the hydrodynamic radius of the fusion protein according to the inclusion of the VEGF binder was analyzed by dynamic light scattering method.
  • C1.01 and C1.02 were centrifuged at 12,000xg for 10 minutes, and the supernatant was added to a 96-well plate, followed by measurement at 25° C. using Zetasizer APS (Marlvern), a DLS analysis equipment.
  • Table 14 below is a table showing the hydrodynamic radius of C1.01 and C1.02.
  • FIGS. 9A and 9B It was confirmed that the fluid radius of C1.02 including the VEGF binder was measured longer than that of C1.01 without it.
  • C1.02 viscosity In order to measure C1.02 viscosity by concentration, the viscosity of C1.02 of 33, 65 and 130 mg/ml was measured using micro-viscometer (m-VROC, RheoSence) and vROC-mB05 (RheoSence) chip. . In addition, the viscosity of 134 mg/ml of human serum albumin as a control was also measured.
  • Table 16 below is a table showing the reagents used.
  • hemolysis analysis of C1.01, C1.02, C1.04, C1.01m, C1.02m and C1.04m was performed.
  • rabbit red blood cells were washed with TBS using a centrifuge at 400 x g for 10 min, and after repeating this process twice, the rabbit red blood cells were again centrifuged with GVB EGTA buffer at 400 x g for 10 min using a centrifuge. washed once. Next, the concentration of rabbit red blood cells was adjusted to 1 ⁇ 10 9 cells/mL using GVB EGTA buffer.
  • C1.01, C1.02, C1.04, C1.01m, C1.02m and C1.04m were concentration-dependently hemolytic by the alternative complement pathway. was confirmed to inhibit.
  • Table 17 below is a table showing the reagents used.
  • C1.01, C1.02, C1.04, C1.05, C1.06, C1.01m, C1.02m, C1.04m Hemolysis assays (CH50) of , C1.06m, and C1.07m were performed.
  • sheep red blood cells were centrifuged in TBS at 400xg for 10 minutes, and this process was repeated twice, and then incubated with 1 mL 20% sheep red blood cells and hemolysin at 4°C for 30 minutes.
  • the sheep red blood cells were washed with TBS using a centrifuge at 400xg for 10 minutes, and this process was repeated twice, and then the sheep red blood cells were washed with GVB++ buffer using a centrifuge at 400xg for 10 minutes.
  • the sensitized sheep red blood cells were adjusted to a concentration of 1x10 9 /mL using GVB++ buffer.
  • VEGF signaling inhibitory effect was confirmed using a reporter cell. Specifically, afilibercept, C1.02, and C1.05 were activated using VEGF reporter cells (GA3001, Promega, USA) that generate luminescent light by receptor-mediated signaling when VEGF binds. Whether the binding to VEGF and VEGF receptors was inhibited was confirmed to the extent of luminescence.
  • VEGF reporter cells G3001, Promega, USA
  • the wound healing ability inhibitory effect of the fusion protein dimer was confirmed.
  • VEGF signaling pathway inhibitory effect of C1.01, C1.02, and C1.05 was confirmed through a cell-based wound healing assay.
  • ARPE-19 Adult Retinal Pigment Epithelial cell line-19
  • ARPE-19 cells were cultured in Dulbecco's Modified Eagle's Medium (DMEM)/F12 medium using 10% Fetal Bovine Serum (FBS).
  • DMEM Dulbecco's Modified Eagle's Medium
  • FBS Fetal Bovine Serum
  • ARPE-19 cells (80,000 cells/well) were cultured overnight in a 24-well plate. The next day, after evenly wounding each well, VEGF (6 ng/ml) and C1.01, C1.02, and C1.05 (35 nM) were added to the culture medium, and 24 hours later, the wound healing inhibitory ability of each fusion protein was analyzed.
  • the fusion protein dimer of one embodiment in the eye was confirmed by direct injection.
  • mice In order to induce the choroidal neovascularization phenotype in mice, it was confirmed whether there were structural abnormalities in mice through pre-induction spectral region optical coherence tomography (Envisu R2200 SD-OCT System; Bioptigen, Inc., USA).
  • choroidal neovascularizations were induced by penetrating Bruch's membrane in the right eye using a diode laser (OcuLight TX - Green 532nm Laser; Iridex Corporate, USA) (Day 0). After induction of choroidal neovascularization, it was confirmed whether the model was normally induced using spectral domain optical coherence tomography and fluorescence fundus angiography (HRA2 FA system; Heidelberg Engineering GmbH, Germany).
  • C1.02m 350 ⁇ M; 48.3 ⁇ g/ ⁇ l, 2 ⁇ l
  • apilibercept Esylea; 350 ⁇ M; 40.0 ⁇ g/ ⁇ l, 2 ⁇ l
  • vehicle control 2 ⁇ l
  • Intravitreal injection was injected intraocularly (Intravitreal injection). ) through the injection.
  • In vivo imaging was performed immediately after induction of choroidal neovascularization (Day 0) and 7 days after induction (Day 7) using spectral domain optical coherence tomography and fluorescence fundus angiography. For each choroidal neovascularization, 1 point was given if there was a vascular leak and 0 if not, and the lesion probability was calculated after scoring. For example, a 100% notation means that vascular leakage is observed in three choroidal neovascularizations.
  • the C1.02m group had a similar protective effect to the apilibercept group, and it was confirmed that there was a significant protective effect compared to the vehicle group.
  • the fusion protein of one embodiment is directly injected into the eyeball Thus, the effect was confirmed.
  • a wet macular degeneration rabbit model was prepared by inducing choroidal neovascularization in rabbits in a manner similar to the method described above in Experimental Example 10, except that 6 choroidal angiogenesis was induced. Immediately after induction of choroidal neovascularization, C1.01 (350 ⁇ M; 38.45 ⁇ g/ ⁇ l, 50 ⁇ l), Aflibercept (350 ⁇ M; 40 ⁇ g/ ⁇ l, 50 ⁇ l), or vehicle control (50 ⁇ l) was administered to the eye. Injected via my injection.
  • In vivo imaging was performed immediately after induction of choroidal neovascularization (Day 0), 7 days after induction (Day 7), and 14 days after induction (Day 14) using a fluorescence fundus angiogram. Fluorescence intensity was measured in choroidal neovascularization to measure vascular leak.
  • the C1.01 group had a similar protective effect to the apilibercept group, and it was confirmed that there was a significant protective effect compared to the vehicle group.
  • the effect was confirmed by direct injection of the fusion protein of one embodiment into the eye after inducing choroidal neovascularization in a rat animal model.
  • a wet macular degeneration rat model was prepared by inducing choroidal neovascularization in rats in a manner similar to the method described above in Experimental Example 10, except that 4 choroidal angiogenesis was induced.
  • C1.02 350 ⁇ M; 54.93 ⁇ g/ ⁇ l, 5 ⁇ l
  • apilibercept 350 ⁇ M; 40 ⁇ g/ ⁇ l, 5 ⁇ l
  • vehicle control 5 ⁇ l
  • in vivo imaging was performed using a fluorescence fundus angiogram and a spectral-domain optical coherence tomography machine. The presence or absence of choroidal neovascularization and the extent of vascular leak immediately after induction and 10 days after induction were quantified through imaging.
  • the C1.02 group significantly reduced the number of choroidal neovascularization and the vascular leakage area, and had a similar protective effect as the afilibercept group, and significant protection compared to the vehicle group. It was confirmed that it was effective.
  • the fusion protein of one embodiment is directly injected into the eye to confirm the effect did
  • an animal model of dry macular degeneration was induced by administering 20 mg/kg sodium iodate (NaIO 3 ) to 8-week-old C57BL/6 mice via tail vein injection.
  • C1.02m (260 ⁇ M; 36.1 ⁇ g/ ⁇ l, 1.5 ⁇ l) or vehicle control (1.5 ⁇ l) was administered on Day 0 and Day 7 via intraocular injection.
  • test animals Two weeks after induction of the model, the test animals were euthanized, and their eyes were enucleated and fixed in Davidson's solution at 4°C for 24 hours. Next, the fixed samples were stored in 30% sucrose solution at 4°C for 3 days. After freezing the samples in OCT compound (Cat #4583, Sakura), they were cut to a thickness of 20 ⁇ m.
  • the excised tissues were stained with C3 (Cat #MA1-40046, Thermofisher) protein using immunofluorescence and outer nuclear layer (ONL) by DAPI (Cat #H-1200, Vector Laboratories) staining. Stained samples were analyzed using a confocal microscope (LSM700; Zeiss, Germany). Specifically, the granular layer (ONL), the number of cells in the granular layer, the area of the granular layer, and the C3 expression level in the retina of each experimental group of the dry macular degeneration model were checked.
  • FIGS. 19a to 19f it was confirmed that the C1.02m group significantly suppressed retinal degeneration compared to the vehicle group when the number and area of the extragranular layer were measured.
  • the expression of C3 was significantly increased in the vehicle group compared to the non-AMD group, and it was confirmed that the expression of C3 was significantly decreased in the C1.02m group.
  • 15 New Zealand white rabbits were divided into 5 groups (G01 to G05) with three per group. After grouping, 2,500 ⁇ g C1.02 (50 ⁇ l/eye) was administered via intraocular injection.
  • 0.5 ml of blood was first collected intravenously from rabbits at each hour. Plasma was separated from the collected blood samples and stored frozen at -60°C. In addition, vitreous humor (0.2 ml) and aqueous humor (0.2 ml) were collected for each hour and stored frozen at -60°C.
  • Table 18 below shows the collected rabbit samples by rabbit group, individual, and harvest time.
  • Concentrations of C1.02 were determined in plasma, vitreous humor and aqueous humor using an enzyme immunoassay (ELISA). Pharmacokinetic parameters were obtained by performing non-compartmental pharmacokinetic analysis with the measured values. Table 19 below shows the pharmacokinetic parameters obtained by non-compartmental pharmacokinetic analysis.
  • Matrix Aqueous humor Vitreous humor PK parameters Mean Mean C max (ng/mL) 103705 3204272 T max ( h) 1.00 1.00 T 1/2 ( h) 114 226 T last( h) 168 336 AUC 0-last (ng.h/mL) 10206790 545028800
  • Table 20 below is a graph showing the concentration in the vitreous humor after administration of 2,500 ⁇ g of C1.02 via intraocular injection in rabbits; RB# means animal number, BQL means below the quantifiable limit, and ND means not determined.
  • Table 21 below is a graph showing the concentration in the aqueous humor after administration of 2,500 ⁇ g of C1.02 via intraocular injection in rabbits; RB# means animal number, BQL means below the quantifiable limit, and ND means not determined.
  • Table 22 below is a graph showing plasma concentrations after administration of 2,500 ⁇ g of C1.02 via intraocular injection in rabbits; RB# means animal number, BQL means below the quantifiable limit, and ND means not determined.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Zoology (AREA)
  • Cell Biology (AREA)
  • Toxicology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Ophthalmology & Optometry (AREA)
  • Epidemiology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)

Abstract

CRIg의 세포외도메인 또는 이의 단편 및 VEGF에 특이적으로 결합하는 단백질을 포함하는 융합단백질 이량체를 제공한다. 상기 단백질은 보체 관련 경로를 억제할 뿐 아니라 신생혈관생성을 효율적으로 조절할 수 있다. 따라서, 상기 융합단백질 이량체는 보체 관련 질환, 구체적으로 황반 변성과 같은 안질환의 치료 및 예방에 효과적으로 활용할 수 있어 산업적 활용 가능성이 높다.

Description

보체 경로 억제제 및 혈관신생 억제제를 포함하는 융합단백질 및 이의 용도
보체 경로 억제 단백질 및 혈관신생 억제 단백질을 포함하는 융합단백질 및 이를 이용한 안질환, 구체적으로 황반 변성 치료용 조성물에 관한 것이다.
황반 변성은 브루크막, 맥락막, 신경 망막 및/또는 망막 색소 상피의 이상과 관련된 중앙 시력의 상실을 특징으로 하는 질병을 의미한다. 망막의 중심에 직경이 약 1/3 내지 1/2 cm인 황반이 존재한다. 망막 아래에, 섬유 조직 내에 묻힌 혈관의 집합체인 맥락막, 및 맥락막층 위에 색소 상피(PE)가 존재한다. 이때, 맥락막 혈관은 망막에 영양을 제공한다. 맥락막 및 PE는 눈의 전방에서 발견된다.
황반 변성 중 하나인 노인성 황반 변성(AMD)은 시야의 중앙부에서 시각의 진행성 상실, 색 식별력의 변화, 및 비정상적인 암 순응 및 민감도와 연관된 질환이다. AMD는 크게 건성 또는 습성 AMD로 구분된다. 건성 AMD는 읽기, 운전 또는 안면 인식과 같은 활동에 사용되는 미세 시력을 위해 요구되는 중앙 망막 또는 황반의 위축성 세포 사멸과 연관된다. 상기 건성 AMD 환자의 약 10-20%는 습성 AMD로서 알려진 AMD의 제2형으로 진행한다.
두 형태의 발병에서 가장 유의한 위험 인자는 연령 및 망막 색소 상피 뒤에서 비정상적인 세포외 침착물인 결정체(drusen)의 침착이다. 결정체는 AMD와 관련된 특징적인 침착물이다. 상기 결정체는 보체 활성화제, 억제제, 활성화-특이적 보체 단편, 및 말단 경로 인자, 예를 들어 세포막 공격 복합체(MAC 또는 C5b-9)를 포함한다고 알려져 있다. 뿐만 아니라, 습성 AMD는 맥락막 혈관신생(CNV)과 연관되어 있다. 새로운 맥락막 혈관 형성의 발병기전은 거의 알려지지 않았지만, 염증, 허혈, 및 혈관신생 인자의 국소 생산과 같은 요소가 중요한 것으로 생각된다.
한편, 보체계는 미생물 감염에 대한 선천 면역의 중대한 성분이고, 정상적으로 혈청 내에 비활성 상태로 존재하는 단백질의 집단을 포함한다. 상기 단백질은 전통적인 경로, 렉틴 경로 및 대체 경로를 통해 활성화된다. 미생물 표면의 분자는 상기 경로를 활성화시켜 C3-전환효소로 알려진 프로테아제 복합체의 형성을 일으킬 수 있다.
보체 경로의 활성화는 백혈구 화학주성, 대식세포, 호중구, 혈소판, 비만세포 및 내피세포의 활성화, 증가된 혈관 투과성, 세포 용해, 및 조직 손상에서 염증 반응을 매개하는 보체 단백질의 생물학적 활성 단편, 예를 들어 C3a, 및 C5a과 같은 과민독소(Anaphylatoxin) 및 C5b-9 세포막 공격 복합체(MAC)를 생성한다. 또한, 안질환 중 일부는 보체가 관련되어 있다는 점이 보고된 바 있다(일본특허출원 제2007-536964호). 그러나, 현재까지도 안질환, 특히 황반 변성을 효과적으로 치료하기 위한 약물에 대한 니즈가 증가되고 있어, 황반 변성 치료제에 대한 연구는 계속되고 있는 실정이다.
이에 본 발명자들은 안질환, 특히 황반 변성을 효과적으로 치료 및 예방하기 위하여 연구한 결과, 보체 관련 경로 및 신생혈관 경로를 차단하는 융합 단백질이 황반 변성 치료제로 활용될 수 있음을 확인함으로써 본 발명을 완성하였다.
본 발명의 일 측면은 CRIg(Complement receptor of the immunoglobulin superfamily)의 세포외도메인 또는 이의 단편; 및 VEGF(Vascular endothelial growth factor)에 특이적으로 결합하는 단백질을 포함하는 융합단백질을 제공한다.
본 발명의 다른 측면은 상기 융합단백질 2개가 결합된 융합단백질 이량체를 제공한다.
본 발명의 또 다른 측면은 상기 융합단백질을 코딩하는 폴리뉴클레오티드를 제공한다.
본 발명의 또 다른 측면은 상기 폴리뉴클레오티드를 포함하는 벡터를 제공한다.
본 발명의 또 다른 측면은 상기 벡터가 도입된 형질전환 세포를 제공한다.
본 발명의 또 다른 측면은 상기 융합단백질 또는 융합단백질 이량체를 유효성분으로 포함하는 안질환 치료 또는 예방용 약학 조성물을 제공한다.
본 발명의 또 다른 측면은 안질환을 치료하기 위한 CRIg의 세포외도메인 또는 이의 단편; 및 VEGF에 특이적으로 결합하는 단백질을 포함하는 융합단백질 또는 이의 이량체의 용도를 제공한다.
본 발명의 또 다른 측면은 안질환 치료 또는 예방용 약제를 제조하기 위한 CRIg의 세포외도메인 또는 이의 단편; 및 VEGF에 특이적으로 결합하는 단백질을 포함하는 융합단백질 또는 이의 이량체의 용도를 제공한다.
본 발명의 또 다른 측면은 CRIg의 세포외도메인 또는 이의 단편; 및 VEGF에 특이적으로 결합하는 단백질을 포함하는 융합단백질 또는 이의 이량체를 개체에 투여하는 단계를 포함하는 안질환을 치료 및/또는 예방하는 방법을 제공한다.
보체 관련 경로 억제 단백질인, CRIg의 세포외도메인 또는 이의 단편; 및 VEGF에 특이적으로 결합하는 단백질을 포함하는 융합단백질은 보체 관련 기작을 효율적으로 억제할 뿐 아니라, 신생혈관생성도 효과적으로 억제할 수 있다. 따라서, 보체계에 의해 유발되는 안질환 및 신생혈관생성에 의해 유발되는 안질환을 효과적으로 치료 또는 예방할 수 있다. 따라서, 상기 융합단백질은 효율적으로 황반 변성, 특히, 건성 황반 변성 및 습성 황반 변성을 모두 효과적 치료하는데 유용하게 사용될 수 있다.
도 1은 C1.01, C1.02, C1.03, C1.04, C1.05 및 C1.06의 SDS-PAGE 결과를 나타낸 도이다.
도 2는 C1.03m, C1.04m, 및 아필리버셉트(Aflibercept)의 SDS-PAGE 결과를 나타낸 도이다.
도 3은 C1.01m, C1.02m, C1.06m 및 C1.07m의 SDS-PAGE 결과를 나타낸 도이다.
도 4는 토끼 C3, 토끼 C3b, 랫트 C3 및 랫트 C3b의 SDS-PAGE 결과를 나타낸 도이다.
도 5는 융합단백질의 모식도를 나타낸 도이다. 순차적으로 CRIg-Fc(C1.01, 왼쪽), CRIg-Fc-VEGF binder(C1.02, 가운데) 및 VEGF binder-Fc-CRIg(C1.04, 오른쪽)를 의미한다.
도 6a 및 도 6b는 인간 C3b 및 인간 VEGF165에 대한 C1.01 및 C1.02의 결합 친화도를 비아코어 분석을 통해 농도별로 나타낸 그래프이다.
도 7a 및 도 7b는 마우스 C3b 및 인간 VEGF165에 대한 C1.01m 및 C1.02m의 결합 친화도를 비아코어 분석을 통해 농도별로 나타낸 그래프이다.
도 8a는 인간 C3b에 대한 C1.01, C1.02, C1.03 및 C1.04의 결합 친화도를 ELISA를 통해 나타낸 그래프이다.
도 8b는 인간 VEGF165에 대한 아필리버셉트, C1.02, C1.04 및 C1.05의 결합 친화도를 ELISA를 통해 나타낸 그래프이다.
도 8c는 마우스 C3b에 대한 결합 친화도를 C1.01, C1.02 및 C1.03 결합 친화도를 ELISA를 통해 나타낸 그래프이다.
도 8d는 인간 C3b, 인간 C2 및 인간 C4에 대한 C1.02의 결합 친화도를 ELISA를 통해 나타낸 그래프이다.
도 9a는 C1.01의 유체학적 반경을 동적 광 산란 분석을 통해 나타낸 그래프이다.
도 9b는 C1.02의 유체학적 반경을 동적 광 산란 분석을 통해 나타낸 그래프이다.
도 10은 C1.02의 농도에 따른 점도를 나타낸 그래프이다.
도 11a는 C1.01, C1.02 및 C1.06의 대체 보체 경로 억제 효과를 용혈 분석(AH50)을 통하여 나타낸 그래프이다.
도 11b는 C1.02, C1.04, C1.04m 및 C1.05의 대체 보체 경로 억제 효과를 용혈 분석(AH50)을 통하여 나타낸 그래프이다.
도 11c는 C1.01m, C1.02m, C1.06m 및 C1.07m의 대체 보체 경로 억제 효과를 용혈 분석(AH50)을 통하여 나타낸 그래프이다.
도 12a는 C1.01, C1.02 및 C1.06의 고전 보체 경로 억제 효과를 용혈 분석(CH50)을 통하여 나타낸 그래프이다.
도 12b는 C1.02, C1.04, C1.04m 및 C1.05의 고전 보체 경로 억제 효과를 용혈 분석(CH50)을 통하여 나타낸 그래프이다.
도 12c는 C1.01m, C1.02m, C1.06m 및 C1.07m의 고전 보체 경로 억제 효과를 용혈 분석(CH50)을 통하여 나타낸 그래프이다.
도 13는 아필리버셉트, C1.01, C1.02, C1.05, 및 C1.06의 VEGF 신호전달 저해 효과를 리포터 세포를 사용하여 나타낸 그래프이다.
도 14는 C1.01, C1.02, 및 C1.05의 VEGF 신호전달경로 저해 효과를 상처 치유 분석법을 통해 나타낸 그래프이다.
도 15a는 C1.02에 대한 인간 및 게잡이원숭이의 C3b의 결합능, 및 C1.06에 대한 인간 및 게잡이원숭이의 C3b의 결합능을 ELISA를 통해 나타낸 그래프이다.
도 15b는 C1.02에 대한 인간, 랫트 및 토끼의 C3b의 결합능, 및 C1.06에 대한 인간, 랫트 및 토끼의 C3b의 결합능을 ELISA를 통해 나타낸 그래프이다.
도 15c는 C1.02에 대한 인간, 게잡이원숭이, 랫트 및 토끼 VEGF의 결합능; 및 C1.01에 대한 인간, 게잡이원숭이, 랫트 및 토끼 VEGF의 결합능을 ELISA를 통해 나타낸 그래프이다.
도 16a는 맥락막 혈관신생 마우스 모델 유도 후, 유도 직후(Day 0) 내지 유도 7일 후(Day 7)의 각 실험군의 맥락막 혈관신생을 형광안저혈관조영술을 통해 확인한 이미지이다.
도 16b는 맥락막 혈관신생 마우스 모델 유도 후, 유도 직후(Day 0), 유도 3일 후(Day 3) 및 유도 7일 후(Day 7)의 각 실험군의 몸무게를 나타낸 그래프이다.
도 16c는 맥락막 혈관신생 마우스 모델 유도 후, 유도 직후(Day 0) 내지 유도 7일 후(Day 7)의 각 실험군당 맥락막 혈관신생의 정도를 정량화하여 나타낸 그래프이다.
도 17은 맥락막 혈관신생 토끼 모델 유도 후 7일 및 14일 후의 맥락막혈관신생 강도를 각 실험군별로 정량화하여 나타낸 그래프이다.
도 18a는 맥락막 혈관신생 랫트 모델에서 유도 직후와 유도 10일 후 각 실험군의 맥락막 혈관신생의 유무를 정량화하여 나타낸 것이다.
도 18b는 맥락막 혈관신생 랫트 모델에서 유도 직후와 유도 10일 후 각 실험군의 혈관 누출(vascular leak) 넓이를 정량화하여 나타낸 것이다.
도 19는 건성 황반 변성 모델의 각 실험군의 외과립층(ONL)을 나타낸 이미지(도 19a 내지 19c), 외과립층 세포 수(도 19d), 외과립층 넓이(도 19e) 및 망막에서의 C3 발현량(도 19f)을 나타낸 도이다.
도 20a는 토끼에서 안구내 주사를 통한 2,500 ㎍의 C1.02 투여 후의 유리체액 내에서의 농도를 나타낸 그래프이다.
도 20b는 토끼에서 안구내 주사를 통한 2,500 ㎍의 C1.02 투여 후의 안방수 내에서의 농도를 나타낸 그래프이다.
CRIg 세포외도메인을 포함하는 융합단백질
본 발명의 일 측면은 CRIg(Complement receptor of the immunoglobulin superfamily)의 세포외도메인 또는 이의 단편; 및 VEGF(Vascular endothelial growth factor)에 특이적으로 결합하는 단백질을 포함하는 융합단백질을 제공한다.
본 명세서에서 사용한 용어, "CRIg"는 VSIG4 유전자에서 코딩되는 면역글로불린 보체 수용체를 의미하며, Protein Z39Ig라고도 명명된다. 상기 CRIg는 보체 수용체의 4종류 중 제4형 보체 수용체에 속하는 수용체로서, 간장 내에서 식균작용을 하는 쿠퍼(Kupffer) 세포와 같은 대식세포의 표면상에 발현된다. 상기 CRIg는 면역글로불린 도메인을 포함하는 세포외 부위와 결합되어 있는 막단백질(Integral Membrane Protein)이다. CRIg은 보체 단편인 C3b와 iC3b와 결합하며, 인체내로 들어온 박테리아나 혈액내의 감염균을 식균세포가 인지하고 제거하도록 기능한다.
상기 CRIg는 CRIg 동형체(isoform) 또는 스플라이싱된 형태(spliced form)를 포함한다. 상기 동형체는, CRIg isoform 1, 2 또는 3을 포함한다. 상기 스플라이싱된 형태는 CRIg(L) 또는 CRIg(S)를 포함한다. 상기 CRIg(L)은 V 및 C2-타입 말단 Ig 도메인을 포함하고, CRIg(S)는 V-타입 도메인만을 포함하는 것일 수 있다. 구체적으로, 상기 CRIg(S)는 서열번호 20의 서열을 포함할 수 있다.
상기 CRIg 세포외도메인은 수용체의 막관통도메인 및 세포질도메인 부분을 제외한 부분일 수 있다.
상기 CRIg는 CRIg 세포외도메인의 단편을 포함할 수 있다. 상기 CRIg의 세포외도메인의 단편이란, CRIg의 세포외도메인과 동등 또는 유사의 활성을 가지는 절단형을 의미한다. 구체적으로, 상기 단편은 C3b 또는 iC3b와 결합하여 보체 작용 또는 식균 작용을 촉진하는 활성을 가지는 CRIg의 단편을 의미한다.
일 구체예에 있어서, 상기 CRIg는 서열번호 19, 서열번호 20, 서열번호 21, 서열번호 22, 서열번호 74 또는 서열번호 151의 아미노산 서열을 포함할 수 있다. 구체적으로, 사람 CRIg은 서열번호 19, 서열번호 20, 또는 서열번호 151의 아미노산 서열을 가질 수 있으며, 마우스 CRIg은 서열번호 21의 아미노산 서열을 가질 수 있다. 또한, 마우스 CRIg 세포외도메인은 서열번호 75의 아미노산 서열을 가질 수 있고, 사람 CRIg 세포외도메인은 서열번호 22 또는 서열번호 74의 아미노산 서열을 포함할 수 있다.
본 명세서에서 사용한 용어, "VEGF(Vascular endothelial growth factor)"는 혈관 내피 성장 인자로서, 혈관 형성을 자극하는 세포에 의해 생성된다. VEGF는 혈관내피세포를 분열 증식시키고, 혈관의 투과성을 증가시켜 혈관 신생에 관여하는 중요한 신호 전달 단백질이다. 상기 VEGF는 습성 AMD에서 망막의 비정상적 혈관 증식을 자극함이 알려져 있다.
또한, 본 명세서에서는 VEGF 또는 VEGF계 단백질을 총칭하여 "VEGF"의 용어로 표현하기도 한다. VEGF계 단백질은 VEGF와 동등하거나 유사한 활성을 가질 수 있다. 여기에서, "활성"은 예를 들어 VEGF 수용체에 특이적으로 결합하는 것을 의미할 수 있으며, 이 특이적 결합은 당업자에게 알려진 방법을 통해 측정할 수 있다.
일 구체예에 있어서, 상기 VEGF계 단백질은 VEGF-A, VEGF-B, VEGF-C, VEGF-D, VEGF-E, PlGF(Placental growth factor) 및 재조합 VEGF로 이루어지는 군으로부터 선택된 하나 이상의 것일 수 있다. 바람직하게는, 상기 VEGF는 VEGF-A, B 또는 PlGF일 수 있다.
본 명세서에서 사용한 용어 "PlGF(Placental growth factor)"는 2p21-p16 염색체에 의해 코딩되는 막관통 단백질을 의미한다. 상기 PlGF는 VEGFR-1에 선택적인 리간드로 작용하며, 혈관형성을 촉진시키는 것일 수 있다. 상기 PlGF는 VEGF의 아미노산 구성과 40% 이상의 동일성을 가진다. 일 구체예에 있어서, 상기 PlGF는 PlGF-1 또는 PlGF-2일 수 있다.
본 명세서에서 사용한 용어 "재조합 VEGF"는 대체 엑손 스플라이싱(alternative exon splicing)을 통해 재조합된 VEGF를 의미한다. 상기 재조합 VEGF는 아미노산의 개수에 따라 VEGF111, VEGF121, VEGF145, VEGF148, VEFG165, VEGF183, VEGF189 또는 VEGF206일 수 있다. 일 구체예에 있어서, 상기 재조합 VEGF는 VEGF165일 수 있다.
본 명세서에서 사용한 용어, "VEGF에 특이적으로 결합하는 단백질"은 VEGF에 특이적으로 결합하는 항체 또는 VEGF의 수용체의 세포외도메인을 의미한다.
본 명세서에서 사용한 용어, "VEGF의 수용체"는 VEGF에 결합하는 수용체를 의미한다. 이때, 상기 VEGF 수용체는 VEGF 수용체 1(VEGFR-1), VEGF 수용체 2(VEGFR-2), 및 VEGF 수용체 3(VEGFR-3)으로 구성된 군에서 선택되는 어느 하나일 수 있다. VEGF 수용체들은 면역글로불린-Ig-유사(immunoglobulin-(Ig)-like) 도메인, 세포외도메인 및 세포내에 분리된 키나아제 도메인을 포함한다. 상기 VEGF 수용체는 VEGF 리간드와 결합화여 활성화함으로서, 이합체화(dimerization) 또는 인산화가 일어나는 것일 수 있다. 일 실시예에 있어서, 상기 VEGF 수용체는 VEGF 수용체 1 또는 2일 수 있다.
본 명세서에서 사용한 용어, "VEGF 수용체의 세포외도메인"은 상기 VEGF에 결합하는 VEGF 수용체의 도메인을 의미한다. 구체적으로, VEGF 수용체의 막통과영역 및 세포질영역을 제외하고, VEGF의 리간드를 포함하는 세포외도메인 부분을 의미한다.
또한, 상기 VEGF 수용체의 세포외도메인은 VEGF와 결합하는 VEGF의 수용체의 단편일 수 있다. 일 구체예에 있어서, 상기 VEGF 수용체의 단편은 VEGF가 결합하는 영역인 VEGF 수용체의 도메인 D1, D2, D3 또는 이의 조합을 포함할 수 있다. 바람직하게는, 상기 VEGF 수용체의 단편은 D2 및 D3을 포함할 수 있다.
일 구체예에 있어서, 상기 VEGF 수용체의 세포외도메인은 VEGF 수용체 1 또는 2의 D2 및 D3 도메인을 포함한다. 또한, 상기 VEGF 수용체의 세포외도메인은 VEGF-A, VEGF-B 또는 PlGF와 결합하여 혈관신생을 억제하는 것일 수 있다. 이때, 상기 VEGF의 수용체의 세포외도메인의 일 구체예는 서열번호 14의 아미노산 서열을 포함할 수 있다. 또한, 상기 VEGF 수용체의 세포외도메인은 상기 서열번호 14를 포함하는 VEGF 수용체 세포외도메인의 일부가 절단되거나 변경된 형태일 수 있다.
본 명세서에서 사용한 용어, "VEGF에 특이적으로 결합하는 항체"는 VEGF와 특이적 결합을 하여 항원-항체 반응을 일으키는 항체 또는 이의 단편을 의미하며, 항-VEGF 항체라고도 명명된다.
상기 항체는 VEGF와 특이적으로 항원-항체 결합을 할 수 있는 분자를 총칭한다. 또한, 상기 항체는 VEGF에 특이적으로 결합할 수 있는 항원결합도메인을 포함하는 한 어떠한 형태로도 이용될 수 있다. 상기 항체 또는 이의 단편은 Fab(Fragment antigen binding), F(ab)2, scFv(Single-chain variable fragment), di-scFv, sdAb(Single domain antibody), 키메릭 항체, 인간화-항체, 인간 항체 또는 이의 변이체 일 수 있다.
상기 항-VEGF 항체는 나노바디 일 수 있다. 이때, 상기 항체는 서열번호 49의 CDR1, 서열번호 50의 CDR2 및 서열번호 51의 CDR3을 포함할 수 있다. 구체적으로, 상기 항체는 BI-836880 일 수 있다.
상기 항-VEGF 항체는 아필리버셉트, 베바시주맙(Bevacizumab), 라니비주맙(Ranibizumab), 라무시루맙(Ramucirumab), 브로루시주맙(Brolucizumab), 파리시맙(Faricimab), KSI-301, 바누시주맙(Vanucizumab), BI-836880, HuMab G6-31, B20-4.1, BAT-5906, 나비치시주맙(Navicixizumab), 딜파시맙(Dilpacimab), hPV-19 및 AT-001로 구성된 군으로부터 선택되는 어느 하나의 가변 부위를 포함할 수 있다. 바람직하게는, 상기 항-VEGF 항체는 아필리버셉트, 베바시주맙, 라니비주맙, 브로루시주맙, KSI-301, 바누시주맙, BI-836880 또는 BAT-5906의 가변 영역을 포함할 수 있다.
이때, 상기 아필리버셉트는 혈관 내의 VEGF-A 및 PlGF를 저해하는 재조합형 인간화 융합단백질을 의미한다. 이때, 상기 아필리버셉트는 안구 내에 직접 주입할 수 있다. 상기 베바시주맙은 혈관 내의 VEGF-A를 저해하여 혈관의 성장을 저해하는 혈관 신생 억제제인 항체이다. 황반 변성 치료의 경우, 상기 베바시주맙은 안구 내에 직접 주입할 수 있다. 상기 라니비주맙은 혈관 신생을 억제하여 습성 황반 변성 치료 효과가 있는 Fab이다. 상기 라무시루맙은 혈관신생을 매개하는 물질 또는 VEGF 수용체 2를 저해하는 항체이다. 상기 브로루시주맙은 VEGF-A에 결합하여 혈관신생을 저해하고, 습식 황반 변성을 치료하는 scFv이다. 상기 파리시맙은 VEGF-A 및 안지오포이에틴-2를 저해하는 이중 특이적 항체이다.
상기 KSI-301은 습식 황반 변성 치료효과가 있는 항체이다. 상기 바누시주맙은 VEGF-A 및 안지오포이에틴-2를 저해하는 이중 특이적 인간화 모노클로랄 항체이다. 상기 BI-836880은 VEGF 및 안지오포이에틴-2를 저해하는 인간화 이중특이적 나노바디(Nanobody)이다. 상기 G6-31은 인간 VEGF를 저해하는 Fab 단편이다. 상기 B20-4.1은 인간 VEGF를 저해하는 scFv 단편이다.
상기 BAT-5906은 습식 황반 변성 치료효과가 있는 항체이다. 상기 나비치시주맙은 항-DLL4/VEGF 이중특이적 항체이다. 상기 딜파시맙은 항-DLL4/VEGF 이중 특이적 항체로, ABT-165라고도 지칭된다. 상기 hPV-19는 항-혈관형성 및 항-종양 활성을 갖는 VEGF에 대한 항체이다. 상기 AT-001은 인간 VEGF 수용체 3를 저해하여 혈관 신생을 억제하는 항체이다.
일 구체예에 있어서, 상기 항-VEGF 항체는 BI-836880의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 49의 CDR1, 서열번호 50의 CDR2 및 서열번호 51의 CDR3를 포함하는 중쇄가변영역을 포함하는 것일 수 있다.
일 구체예에 있어서, 상기 항-VEGF 항체는 베바시주맙의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 77의 HCDR1, 서열번호 78의 HCDR2, 서열번호 79의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 80의 LCDR1, 서열번호 81의 LCDR2, 서열번호 82의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-VEGF 항체는 라니비주맙의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 83의 HCDR1, 서열번호 84의 HCDR2, 서열번호 85의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 86의 LCDR1, 서열번호 87의 LCDR2, 서열번호 88의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-VEGF 항체는 라무시루맙의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 89의 HCDR1, 서열번호 90의 HCDR2, 서열번호 91의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 92의 LCDR1, 서열번호 93의 LCDR2, 서열번호 94의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-VEGF 항체는 파리시주맙의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 101의 HCDR1, 서열번호 102의 HCDR2, 서열번호 103의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 104의 LCDR1, 서열번호 105의 LCDR2, 서열번호 106의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-VEGF 항체는 KSI-301의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 107의 HCDR1, 서열번호 108의 HCDR2, 서열번호 109의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 110의 LCDR1, 서열번호 111의 LCDR2, 서열번호 112의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-VEGF 항체는 바누시주맙의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 113의 HCDR1, 서열번호 114의 HCDR2, 서열번호 115의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 116의 LCDR1, 서열번호 117의 LCDR2, 서열번호 118의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-VEGF 항체는 BAT-5906의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 119의 HCDR1, 서열번호 120의 HCDR2, 서열번호 121의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 122의 LCDR1, 서열번호 123의 LCDR2, 서열번호 124의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-VEGF 항체는 나비치시주맙의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 125의 HCDR1, 서열번호 126의 HCDR2, 서열번호 127의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 128의 LCDR1, 서열번호 129의 LCDR2, 서열번호 130의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-VEGF 항체는 딜파시맙의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 131의 HCDR1, 서열번호 132의 HCDR2, 서열번호 133의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 134의 LCDR1, 서열번호 135의 LCDR2, 서열번호 136의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-VEGF 항체는 hPV-19의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 137의 HCDR1, 서열번호 138의 HCDR2, 서열번호 139의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 140의 LCDR1, 서열번호 141의 LCDR2, 서열번호 142의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-VEGF 항체는 AT-001의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 143의 HCDR1, 서열번호 144의 HCDR2, 서열번호 145의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 146의 LCDR1, 서열번호 147의 LCDR2, 서열번호 148의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다.
일 구체예에 있어서, 상기 항-VEGF 항체는 서열번호 36의 중쇄 및 서열번호 37의 경쇄; 서열번호 38의 중쇄 및 서열번호 39의 경쇄; 서열번호 40의 중쇄 및 서열번호 41의 경쇄; 서열번호 43의 중쇄 및 서열번호 44의 경쇄; 서열번호 45의 중쇄 및 서열번호 46의 경쇄; 서열번호 47의 중쇄 및 서열번호 48의 경쇄; 서열번호 64의 중쇄 및 서열번호 65의 경쇄; 서열번호 66의 중쇄 및 서열번호 67의 경쇄; 서열번호 68의 중쇄 및 서열번호 69의 경쇄; 서열번호 70의 중쇄 가변영역 및 서열번호 71의 경쇄 가변영역; 또는 서열번호 72의 중쇄 가변영역 및 서열번호 73의 경쇄 가변영역을 포함하는 것일 수 있다.
상기 항-VEGF 항체의 단편은 scFv(single chain variable fragment)일 수 있다. 이때, 상기 scFv는 중쇄 가변영역과 경쇄 가변영역이 펩타이드 링커로 연결된 형태를 의미한다. 구체적으로, 상기 scFv는 서열번호 95의 CDR1, 서열번호 96의 CDR2, 서열번호 97의 CDR3, 서열번호 98의 CDR4, 서열번호 99의 CDR5 및 서열번호 100의 LCDR6을 포함하는 가변영역을 포함할 수 있다. 또한, 상기 scFv는 서열번호 42의 아미노산 서열을 가질 수 있다. 이때, 상기 scFv의 일 구체예는 브로루시주맙일 수 있다.
상기 항-VEGF 항체는 HuMab G6-31 또는 B20-4.1의 가변영역을 포함할 수 있다. 구체적으로, 상기 항체는 서열번호 52의 HCDR1, 서열번호 53의 HCDR2, 서열번호 54의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 55의 LCDR1, 서열번호 56의 LCDR2, 서열번호 57의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다. 또한, 상기 항체는 서열번호 58의 HCDR1, 서열번호 59의 HCDR2, 서열번호 60의 HCDR3을 포함하는 중쇄가변영역 및 서열번호 61의 LCDR1, 서열번호 62의 LCDR2, 서열번호 63의 LCDR3을 포함하는 경쇄가변영역을 포함할 수 있다.
상기 VEGF에 특이적으로 결합하는 항체는 당업자에게 알려진 항체를 제한 없이 의미할 수 있다. 다른 한가지 예로, 상기 항체는 미국등록특허 US 9,527,925 B2, 미국등록특허 US 8,268,314 B2 또는 미국공개특허 US 2019-0167790 A1에 개시된 항-VEGF 항체 또는 이의 단편을 사용할 수 있다.
상기 CRIg의 세포외도메인 또는 이의 단편과 VEGF에 특이적으로 결합하는 단백질은 링커를 통해 결합된 것일 수 있다.
또한, 상기 CRIg의 세포외도메인 또는 이의 단편과 면역글로불린 단편은 링커를 통해 결합된 것일 수 있다. 상기 링커는 두 개의 단백질을 연결시켜준다. 링커의 일 구체예로는 1개 내지 50개의 아미노산, 알부민 또는 이의 단편, 또는 면역글로불린의 Fc 도메인 등을 포함할 수 있다. 이때, 상기 면역글로불린의 Fc 도메인은 면역글로불린의 중쇄 불변 영역 2(CH2) 및 중쇄 불변 영역 3(CH3)을 포함하며, 면역글로불린의 중쇄 및 경쇄의 가변 영역 및 경쇄 불변 영역 1(CH1)은 포함하지 않는 단백질을 의미한다. 상기 면역글로불린은 IgG, IgA, IgE, IgD 또는 IgM 일 수 있으며, 바람직하게는 IgG1 일 수 있다. 본 명세서에서 Fc 도메인은 힌지 영역을 제외한, CH2 및 CH3 도메인을 포함한 영역을 지칭할 수 있다.
또한, 상기 융합단백질은 하기 구조식 (I) 또는 (II)로 이루어진 것일 수 있다:
N'-X-[링커(1)]n-Fc 도메인-[링커(2)]m-Y-C' (I)
N'-Y-[링커(1)]n-Fc 도메인-[링커(2)]m-X-C' (II)
이때, 상기 구조식 (I) 및 (II)에 있어서,
상기 N'은 융합단백질의 N-말단이고,
상기 C'는 융합단백질의 C-말단이며,
상기 X는 CRIg의 세포외도메인 또는 이의 단편이고,
상기 Y는 VEGF에 특이적으로 결합하는 단백질이며,
상기 링커(1) 및 링커(2)는 펩타이드 링커이고,
상기 n 및 m은 각각 독립적으로, O 또는 1이다.
상기 VEGF에 특이적으로 결합하는 단백질, 상기 CRIg의 세포외도메인 또는 이의 단편 및 Fc 도메인은 상술한 바와 같다. 상기 Fc 도메인은 면역글로불린 Fc 중쇄의 CH2 및 CH3 영역을 포함할 수 있다. 또한, 상기 면역글로불린의 Fc 도메인은 야생형 Fc 도메인뿐만 아니라, Fc 도메인 변이체일 수 있다. 또한, 본 명세서에서 사용하는 용어 "Fc 도메인 변이체"는 야생형 Fc 도메인의 당쇄 형태(Glycosylation pattern)와 다르거나, 야생형 Fc 도메인에 비해 증가된 당쇄, 야생형 Fc 도메인에 비해 감소한 당쇄, 또는 당쇄가 제거(Deglycosylate)된 형태일 수 있다. 또한 무당쇄(Aglycosylated) Fc 도메인도 포함된다. Fc 도메인 혹은 변이체는 배양조건 혹은 호스트의 유전자 조작을 통해 조정된 숫자의 시알산(Sialic acid), 퓨코실화(Fucosylation), 당화(Glycosylation)를 갖도록 한 것일 수 있다.
또한, 화학적 방법, 효소적 방법 및 미생물을 사용한 유전공학적 엔지니어링 방법 등과 같이 통상적인 방법으로 면역글로불린의 Fc 도메인의 당쇄를 변형시킬 수 있다. 또한, 상기 Fc 도메인 변이체는 면역글로불린 IgG, IgA, IgE, IgD 또는 IgM의 Fc 영역이 혼합된 형태일 수 있다. 또한, 상기 Fc 도메인 변이체는 상기 Fc 도메인의 일부 아미노산이 다른 아미노산으로 치환된 형태일 수 있다.
본 명세서에서 사용한 용어 "Fc 도메인 변이체"는 야생형 Fc 도메인의 당쇄가 변경되거나, Fc 도메인간의 서열이 혼합된 Fc 도메인이거나, 야생형 Fc 도메인의 일부 아미노산이 결실, 변경, 치환 및/또는 부가된 것을 의미한다. 상기 야생형 Fc 도메인의 일부 아미노산의 결실, 변경, 치환 및/또는 부가는 당업자에게 알려진 방법으로 제조될 수 있다. 일 구체예에 있어서, 상기 Fc 도메인 변이체는 야생형 Fc 도메인의 일부 아미노산 서열이 치환 및/또는 부가된 것일 수 있다.
상기 치환 및/또는 부가에 의해 도입되는 "아미노산"은 라이신(K), 알라닌(A), 알지닌(R), 아스파라진(N), 아스파르트산(D), 시스테인(C), 글루타민(Q), 글루탐산(E), 글라이신(G), 히스티딘(H), 이소류신(I), 류신(L), 메티오닌(M), 페닐알라닌(F), 프로린(P), 세린(S), 트레오닌(T), 트립토판(W), 타이로신(Y) 및 발린(V)으로 구성된 군에서 선택되는 어느 하나일 수 있다.
상기 Fc 도메인 변이는 항체의 활성 또는 기능을 조절하는 것일 수 있다. 일 구체예에 있어서, 상기 Fc 도메인 변이는 항체의 이펙터 기능(effector function) 또는 항체 세포 독성(antibody cytotoxic activities)을 조절하는 것일 수 있다.
일 구체예에 있어서, 상기 Fc 도메인 변이체는 DANG 변이 또는 NG 변이를 포함하는 것일 수 있다. 또한, 상기 Fc 도메인 변이체는 IgG1 Fc 도메인에서 265번째 서열이 D에서 A로 치환된 것, 297번째 서열이 N에서 G로 치환된 것 또는 이의 조합일 수 있다.
일 구체예에 있어서, 상기 Fc 도메인은 서열번호 6, 서열번호 11 및 서열번호 76으로 구성된 군에서 선택되는 어느 하나의 아미노산 서열을 갖는 것일 수 있다. 상기 Fc 도메인은 서열번호 28 또는 서열번호 33의 폴리뉴클레오티드 서열에 의해 코딩되는 것일 수 있다.
상기 펩타이드 링커(1)은 5 내지 80개의 연속된 아미노산, 20 내지 60개의 연속된 아미노산, 또는 25 내지 50개의 연속된 아미노산, 또는 30 내지 40개의 아미노산으로 이루어질 수 있다. 일 구체예로 펩타이드 링커(1)은 30개의 아미노산으로 이루어질 수 있다. 또한, 펩타이드 링커(1)은 적어도 하나의 시스테인을 포함할 수 있다. 구체적으로, 하나, 두 개 또는 세 개의 시스테인을 포함할 수 있다. 또한, 상기 펩타이드 링커(1)는 면역글로불린의 힌지에서 유래된 것일 수 있다. 한 구체예에서는, 상기 펩타이드 링커(1)이 서열번호 15 또는 17의 아미노산 서열로 이루어진 펩타이드 링커일 수 있다.
상기 펩타이드 링커(2)는 1 내지 50개의 연속된 아미노산, 또는 3 내지 30개의 연속된 아미노산, 또는 5 내지 15개의 아미노산으로 이루어질 수 있다. 일 구체예로 상기 펩타이드 링커(2)는 (G4S)n(이때, n은 1 내지 10의 정수) 일 수 있다. 이때, (G4S)n에서 n은 1, 2, 3, 4, 5, 6, 7, 8, 9 또는 10일 수 있다. 일 실시예로, 상기 펩타이드 링커(2)가 서열번호 16 또는 18의 아미노산 서열로 이루어진 펩타이드 링커일 수 있다.
바람직하게는, 상기 융합단백질은 구조식 (I)로 이루어진 것일 수 있다.
일 구체예에 있어서, 상기 융합단백질은 서열번호 2, 서열번호 4, 서열번호 8 및 서열번호 10으로 이루어지는 군에서 선택된 어느 하나의 아미노산 서열을 포함할 수 있다.
또 다른 구체예에 있어서, 상기 융합단백질은 서열번호 2, 서열번호 4, 서열번호 8 및 서열번호 10으로 이루어지는 군에서 선택된 어느 하나의 아미노산 서열에 대해 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% 또는 100%의 서열 동일성을 갖는 폴리펩타이드를 포함한다. 이때, 동일성은, 예를 들어, 퍼센트 상동성, NCBI(National Center of Biotechnology Information)의 BlastN software과 같은 상동성 비교 소프트웨어를 통해 결정될 수 있다.
융합단백질 이량체
본 발명의 또 다른 측면은, CRIg의 세포외도메인 또는 이의 단편 및 VEGF에 특이적으로 결합하는 단백질을 포함하는 융합단백질 두 개가 결합된 이량체를 제공한다.
이때, 이량체를 구성하는 융합단백질 간의 결합은 링커 내에 존재하는 시스테인에 의해 이황화 결합에 의해 이루어진 것일 수 있으나, 이에 한정되는 것은 아니다. 이량체를 구성하는 융합단백질은 동일한 것일 수도 있으나, 서로 상이한 융합단백질일 수 있다. 바람직하게는, 상기 이량체는 동형이량체(Homodimer)인 것일 수 있다.
융합단백질을 코딩하는 폴리뉴클레오티드
본 발명의 또 다른 측면은, CRIg의 세포외도메인 또는 이의 단편 및 VEGF에 특이적으로 결합하는 단백질을 포함하는 융합단백질을 코딩하는 폴리뉴클레오티드를 제공한다.
일 구체예에 있어서, 상기 폴리펩티드는 서열번호 2, 서열번호 4, 서열번호 8, 또는 서열번호 10과 적어도 약 70%, 적어도 약 75%, 적어도 약 80%, 적어도 약 85%, 적어도 약 86%, 적어도 약 87%, 적어도 약 88%, 적어도 약 89%, 적어도 약 90%, 적어도 약 91%, 적어도 약 92%, 적어도 약 93%, 적어도 약 94%, 적어도 약 95%, 적어도 약 96%, 적어도 약 97%, 적어도 약 98%, 적어도 약 99%, 또는 적어도 약 100%의 동일성을 가지는 아미노산 서열을 포함할 수 있다.
일 구체예에 있어서, 상기 폴리뉴클레오티드는 서열번호 24, 서열번호 26, 서열번호 30, 및 서열번호 32로 이루어지는 군에서 선택된 어느 하나의 염기서열에 대해 적어도 약 70%, 적어도 약 75%, 적어도 약 80%, 적어도 약 85%, 적어도 약 86%, 적어도 약 87%, 적어도 약 88%, 적어도 약 89%, 적어도 약 90%, 적어도 약 91%, 적어도 약 92%, 적어도 약 93%, 적어도 약 94%, 적어도 약 95%, 적어도 약 96%, 적어도 약 97%, 적어도 약 98%, 적어도 약 99%, 또는 적어도 약 100%의 동일성을 가지는 것일 수 있다.
상기 폴리뉴클레오티드는 신호서열(Signal sequence) 또는 리더 서열(Leader sequence)을 코딩하는 핵산을 추가적으로 포함할 수 있다. 본 명세서에서 사용한 용어 "신호서열"은 목적 단백질의 분비를 지시하는 신호펩타이드를 의미한다. 상기 신호펩타이드는 숙주 세포에서 번역된 후에 절단된다. 구체적으로, 상기 신호서열은 ER(Endoplasmic reticulum) 막을 관통하는 단백질의 이동을 개시하는 아미노산 서열이다.
상기 신호서열은 당업계에 그 특징이 잘 알려져 있으며, 통상 16 내지 30개의 아미노산 잔기를 포함하나, 그보다 더 많거나 적은 아미노산 잔기를 포함할 수 있다. 통상적인 신호 펩타이드는 기본 N-말단 영역, 중심의 소수성 영역, 및 보다 극성인(polar) C-말단 영역의 세 영역으로 구성된다. 중심 소수성 영역은 미성숙 폴리펩타이드가 이동하는 동안 막지질 이중층을 통하여 신호서열을 고정시키는 4 내지 12개의 소수성 잔기를 포함한다.
개시 이후에, 신호서열은 흔히 신호 펩티다아제(Signal peptidases)로 알려진 세포 효소에 의하여 ER의 루멘(Lumen) 내에서 절단된다. 이때, 상기 신호서열은 tPa(Tissue Plasminogen Activation), HSV gDs(Signal sequence of Herpes simplex virus glycoprotein D), 또는 성장 호르몬(Growth hormone)의 분비신호서열일 수 있다. 바람직하게, 포유동물 등을 포함하는 고등 진핵 세포에서 사용되는 분비 신호서열을 사용할 수 있다. 또한, 상기 신호서열은 야생형 신호서열을 사용하거나, 숙주세포에서 발현 빈도가 높은 코돈으로 치환하여 사용할 수 있다.
융합단백질을 코딩하는 폴리뉴클레오티드가 적재된 벡터
본 발명의 또 다른 측면은, 상기 폴리뉴클레오티드를 포함하는 벡터를 제공한다.
상기 벡터는 숙주 세포에 도입되어 숙주 세포 유전체 내로 재조합 및 삽입될 수 있다. 또는 상기 벡터는 에피좀으로서 자발적으로 복제될 수 있는 폴리뉴클레오티드 서열을 포함하는 핵산 수단으로 이해된다. 상기 벡터는 선형 핵산, 플라스미드, 파지미드, 코스미드, RNA 벡터, 바이러스 벡터 및 이의 유사체들을 포함한다. 바이러스 벡터의 예로는 레트로바이러스, 아데노바이러스, 및 아데노-관련 바이러스를 포함하나 이에 제한되지 않는다.
구체적으로, 상기 벡터는 플라스미드 DNA, 파아지 DNA 등이 될 수 있고, 상업적으로 개발된 플라스미드(pUC18, pBAD, pIDTSAMRT-AMP 등), 대장균 유래 플라스미드(pYG601BR322, pBR325, pUC118, pUC119 등), 바실러스 서브틸리스 유래 플라스미드(pUB110, pTP5 등), 효모-유래 플라스미드(YEp13, YEp24, YCp50 등), 파아지 DNA(Charon4A, Charon21A, EMBL3, EMBL4, λgt10, λgt11, λZAP 등), 동물 바이러스 벡터(레트로바이러스(Retrovirus), 아데노바이러스(Adenovirus), 백시니아 바이러스(Vaccinia virus) 등), 곤충 바이러스 벡터(배큘로바이러스(Baculovirus) 등)이 될 수 있다. 상기 벡터는 숙주 세포에 따라서 단백질의 발현량과 수식 등이 다르게 나타나므로, 목적에 가장 적합한 숙주세포를 선택하여 사용함이 바람직하다.
본 명세서에서 사용한 용어, 목적 단백질의 "유전자 발현" 또는 "발현"은, DNA 서열의 전사, mRNA 전사체의 번역 및 융합단백질 생산물 또는 이의 단편의 분비를 의미하는 것으로 이해된다. 유용한 발현 벡터는 RcCMV(Invitrogen, Carlsbad) 또는 이의 변이체일 수 있다. 상기 발현 벡터는 포유류 세포에서 목적 유전자의 연속적인 전사를 촉진하기 위한 인간 CMV(Cytomegalovirus) 프로모터, 및 전사 후 RNA의 안정상태 수준을 높이기 위한 우태 성장 인자(Bovine growth hormone) 폴리아데닐레이션 신호서열을 포함할 수 있다.
융합단백질을 발현하는 형질전환된 세포
본 발명의 또 다른 측면은, 상기 벡터가 도입된 형질전환 세포를 제공한다.
상기 형질전환 세포의 숙주세포로서, 원핵세포, 진핵세포, 포유동물, 식물, 곤충, 균류 또는 세포성 기원의 세포를 포함할 수 있지만 이에 한정되지 않는다. 상기 원핵세포의 일 예로는 대장균을 사용할 수 있다. 또한, 진핵세포의 일 예로는 효모를 사용할 수 있다. 또한, 상기 포유동물 세포로 CHO 세포, F2N 세포, CSO 세포, BHK 세포, 바우스(Bowes) 흑색종 세포, HeLa 세포, 911 세포, AT1080 세포, A549 세포, HEK 293 세포 또는 HEK293T 세포 등을 사용할 수 있으나, 이에 한정되지 않으며, 당업자에게 알려진 포유동물 숙주세포로 사용 가능한 세포는 모두 이용 가능하다.
또한, 숙주세포로 발현벡터를 도입하는 경우, CaCl2 침전법, CaCl2 침전법에 DMSO(Dimethyl sulfoxide)라는 환원물질을 사용함으로써 효율을 높인 Hanahan 방법, 전기천공법(Electroporation), 인산칼슘 침전법, 원형질 융합법, 실리콘 카바이드 섬유를 이용한 교반법, 아그로박테리아 매개된 형질전환법, PEG를 이용한 형질전환법, 덱스트란 설페이트, 리포펙타민 및 건조/억제 매개된 형질전환 방법 등이 사용될 수 있다.
전술한 바와 같이, 융합단백질의 치료제로서의 특성을 최적하거나 기타 다른 목적을 위해 호스트 세포가 갖고 있는 당화(Glycosylation) 관련 유전자를 당업자에게 알려져 있는 방법을 통해 조작하여 융합단백질의 당쇄 패턴(예를 들어, 시알산, 퓨코실화, 당화)을 조정할 수 있다.
융합단백질 생산 방법
본 발명의 또 다른 측면은, 상기 형질전환 세포를 배양하는 단계를 포함하는 CRIg의 세포외도메인 또는 이의 단편; 및 VEGF에 특이적으로 결합하는 단백질을 포함하는 융합단백질 또는 이의 이량체를 생산하는 방법을 제공한다.
상기 생산 방법은 i) 상기 형질전환 세포를 배양하여 배양물을 수득하는 단계; 및 ii) 상기 배양물로부터 융합단백질 또는 이의 이량체를 회수하는 단계를 포함할 수 있다.
상기 형질전환 세포를 배양하는 방법은 당업계에 널리 알려져 있는 방법을 이용하여 수행할 수 있다. 구체적으로, 상기 배양은 배치 공정 또는 주입 배치 또는 반복 주입 배치 공정(Fed batch 또는 Repeated fed batch process)에서 연속식으로 배양할 수 있다.
융합단백질 또는 이의 이량체의 용도
본 발명의 또 다른 측면은, 상기 융합단백질 또는 상기 융합단백질 2개가 결합된 융합단백질 이량체를 유효성분으로 포함하는 안질환 치료 또는 예방용 약학 조성물을 제공한다.
상기 융합단백질 및 융합단백질 이량체는 상술한 바와 같다.
본 명세서에서 사용한 용어, "안질환"은 눈을 발병 부위로 하는 질병을 총칭하는 것일 수 있다. 상기 안질환은 보체 활성 또는 혈관신생으로 인해 촉발 또는 악화되는 안질환 또는 과도한 혈관신생을 주요 병증으로 포함하는 안질환을 의미할 수 있다. 상기 안질환은 노화-관련 황반 변성(AMD), 지도모양 위축증(GA), 맥락막 혈관신생(CNV), 포도막염, 당뇨병성 및 다른 허혈-관련 망막증, 당뇨병성 황반 부종, 병리적 근시, 폰 힙펠-린다우병, 눈의 히스토플라스마증, 망막 중심 정맥 폐색(CRVO), 각막 혈관신생 및 망막 혈관신생으로 구성된 군에서 선택되는 어느 하나인 것일 수 있다.
상기 CRIg의 세포외도메인 또는 이의 단편 및 VEGF에 특이적으로 결합하는 단백질은 상술한 바와 같다.
상기 약학 조성물의 바람직한 투여량은 환자의 상태 및 체중, 질병의 정도, 약물형태, 투여경로 및 기간에 따라 다르지만, 당업자에 의해 적절하게 선택될 수 있다. 본 발명의 안질환 치료용 또는 예방용 약학 조성물에서 그 유효성분은 안질환 치료 활성을 나타내거나, 특히, 황반 변성에 치료 효과를 나타낼 수 있는 한, 용도, 제형, 배합 목적 등에 따라 임의의 양(유효량)으로 포함될 수 있는데, 통상적인 유효량은 조성물 전체 중량을 기준으로 할 때 0.001 중량% 내지 20.0 중량% 범위 내에서 결정될 것이다. 본 명세서에서 사용한 용어 "유효량"이란 안질환의 상태 개선 또는 치료(Treatment) 효과, 특히 황반 변성의 상태 개선 또는 치료 효과를 유도할 수 있는 유효성분의 양을 말한다. 이러한 유효량은 당업자의 통상의 능력 범위 내에서 실험적으로 결정될 수 있다.
본 명세서에서 사용한 용어, "치료"는 치료학적 처리 및 예방적 처리를 모두 포함하는 의미로 사용될 수 있다. 이때, 예방은 개체의 병리학적 상태 또는 질환을 완화시키거나 감소시키는 의미로 사용될 수 있다. 일 구체예에서, 용어 "치료"는 인간을 포함한 포유류에서 질환을 치료하기 위한 적용이나 어떠한 형태의 투약을 모두 포함한다. 또한, 상기 용어는 질환 또는 질환의 진행을 억제하거나 늦추는 것을 포함하며; 손상되거나, 결손된 기능을 회복시키거나, 수리하여, 질환을 부분적이거나 완전하게 완화시키거나; 또는 비효율적인 프로세스를 자극하거나; 심각한 질환을 완화하는 의미를 포함한다.
생체이용률과 같은 약동학적 파라미터(Pharmacokinetic parameters) 및 클리어런스율(Clearance rate)과 같은 기본적인 파라미터(Underlying parameters)도 효능에 영향을 줄 수 있다. 따라서, "향상된 효능"(예를 들어, 효능의 개선)은 향상된 약동학적 파라미터 및 향상된 효능에 기인할 수 있으며, 시험 동물 또는 인간 대상체에서 클리어런스율 및 안질환 치료 또는 개선과 같은 파라미터를 비교하여 측정될 수 있다.
본 명세서에서 사용한 용어 "치료학적으로 유효한 양" 또는 "약학적으로 유효한 양"이란 대상 질환을 예방 또는 치료하는데 유효한 화합물 또는 조성물의 양으로서, 의학적 치료에 적용 가능한 합리적인 수혜/위험 비율로 질환을 치료하기에 충분하며 부작용을 일으키지 않을 정도의 양을 의미한다. 상기 유효량의 수준은 환자의 건강상태, 질환의 종류, 중증도, 약물의 활성, 약물에 대한 민감도, 투여 방법, 투여 시간, 투여 경로 및 배출 비율, 치료 기간, 배합 또는 동시 사용되는 약물을 포함한 요소 및 기타 의학 분야에 잘 알려진 요소에 따라 결정될 수 있다. 일 구체예에 있어서, 치료학적으로 유효한 양은 안질환을 치료하는데 효과적인 약물의 양을 의미한다.
이때, 상기 약학 조성물은 약학적으로 허용 가능한 담체를 더 포함할 수 있다. 상기 약학적으로 허용 가능한 담체는 환자에게 전달하기에 적절한 비-독성 물질이면 어떠한 담체라도 가능하다. 증류수, 알코올, 지방, 왁스 및 비활성 고체가 담체로 포함될 수 있다. 약물학적으로 허용되는 애쥬번트(완충제, 분산제) 또한 약학 조성물에 포함될 수 있다.
구체적으로, 상기 약학 조성물은 유효성분 이외에 약제학적으로 허용되는 담체를 포함하여 당업계에 공지된 통상의 방법으로 투여 경로에 따라 비경구용 제형으로 제조될 수 있다. 여기서 "약제학적으로 허용되는" 의미는 유효성분의 활성을 억제하지 않으면서 적용(처방) 대상이 적응 가능한 이상의 독성을 지니지 않는다는 의미이다.
상기 약학 조성물이 비경구용 제형으로 제조될 경우, 적합한 담체와 함께 당업계에 공지된 방법에 따라 주사제, 경피 투여제, 비강 흡입제 및 좌제의 형태로 제제화될 수 있다. 주사제로 제제화할 경우 적합한 담체로서는 멸균수, 에탄올, 글리세롤이나 프로필렌 글리콜 등의 폴리올 또는 이들의 혼합물을 사용할 수 있으며, 바람직하게는 링거 용액, 트리에탄올 아민이 함유된 PBS(Phosphate Buffered Saline)나 주사용 멸균수, 5% 덱스트로스 같은 등장 용액 등을 사용할 수 있다. 약제학적 조성물의 제제화와 관련하여서는 당업계에 공지되어 있으며, 구체적으로 문헌[Remington's Pharmaceutical Sciences(19th ed., 1995)] 등을 참조할 수 있다. 상기 문헌은 본 명세서의 일부로서 간주된다.
상기 약학 조성물의 바람직한 투여량은 환자의 상태, 체중, 성별, 연령, 환자의 중증도, 투여 경로에 따라 1일 0.01 ug/kg 내지 10 g/kg 범위, 또는 0.01 mg/kg 내지 1 g/kg 범위일 수 있다. 투여는 1일 1회 또는 수회로 나누어 이루어질 수 있다. 이러한 투여량은 어떠한 측면으로든 본원 발명의 범위를 제한하는 것으로 해석되어서는 아니 된다.
상기 약학 조성물이 적용(처방)될 수 있는 대상은 포유동물 및 사람이며, 특히 사람인 경우가 바람직하다. 본원의 약학 조성물은 유효성분 이외에, 안질환, 특히 황반 변성 치료 효과를 갖는 것으로 공지된 임의의 화합물이나 천연 추출물을 추가로 포함할 수 있다.
본 발명의 또 다른 측면은, 안질환을 치료하기 위한 CRIg의 세포외도메인 또는 이의 단편; 및 VEGF에 특이적으로 결합하는 단백질을 포함하는 융합단백질 또는 이의 이량체의 용도를 제공한다.
본 발명의 또 다른 측면은, 안질환 치료 또는 예방용 약제를 제조하기 위한 CRIg의 세포외도메인 또는 이의 단편; 및 VEGF에 특이적으로 결합하는 단백질을 포함하는 융합단백질 또는 이의 이량체의 용도를 제공한다.
본 발명의 또 다른 측면은, CRIg의 세포외도메인 또는 이의 단편; 및 VEGF에 특이적으로 결합하는 단백질을 포함하는 융합단백질 또는 이의 이량체를 개체에 투여하는 단계를 포함하는 안질환을 치료 및/또는 예방하는 방법을 제공한다.
상기 융합단백질, 이량체 및 안질환은 상술한 바와 같다. 이때, 상기 개체는 안질환을 앓고 있는 개체일 수 있다. 또한 상기 개체는 포유동물일 수 있으며, 바람직하게는 인간일 수 있다.
상기 융합단백질 또는 융합단백질 이량체의 투여경로, 투여량 및 투여횟수는 환자의 상태 및 부작용의 유무에 따라 다양한 방법 및 양으로 대상에게 투여될 수 있고, 최적의 투여방법, 투여량 및 투여횟수는 통상의 기술자가 적절한 범위로 선택할 수 있다. 또한, 상기 융합 단백질 또는 융합단백질 이량체는 치료하고자 하는 질환에 대하여 치료효과가 공지된 다른 약물 또는 생리학적 활성물질과 병용하여 투여되거나, 다른 약물과의 조합 제제 형태로 제형화될 수 있다.
일 실시예에 있어서, 상기 융합단백질은 보체 경로, 식균 작용 및/또는 혈관신생을 저해할 수 있다. 따라서, 습성 또는 건성 황반 변성과 같은 안질환에 효과적으로 활용할 수 있다. 특히, CRIg의 세포외도메인 또는 이의 단편; 및 VEGF에 특이적으로 결합하는 단백질을 조합한 경우가, 하나를 포함한 경우보다 효과가 더 높고 시너지 효과 또한 존재하는 것이 확인되었다. 따라서, 상기 융합단백질은 보체경로 및 혈관신생을 효과적으로 저해하여 건성 및 습성 황반 변성을 효과적으로 치료할 수 있다.
이하, 본원 발명을 하기 실시예에 의하여 더욱 상세하게 설명한다. 단, 하기 실시예는 본원 발명을 예시하기 위한 것일 뿐, 본원 발명의 범위가 한정되는 것은 아니다.
제조예 1. CRIg를 포함하는 융합단백질의 제조
Code Format Description 해당서열
C1.01 Fc-fusion hu CRIg-hu IgG1 Fc DANG 서열번호 1
C1.02 Fc-fusion hu CRIg-hu IgG1 Fc-VEGF binder 서열번호 2
C1.03 Fc-fusion hu IgG1 Fc DANG-hu CRIg 서열번호 3
C1.04 Fc-fusion VEGF binder-hu IgG1 Fc DANG-hu CRIg 서열번호 4
C1.05 Fc-fusion VEGF binder-hu IgG1 Fc DANG 서열번호 5
C1.06 Fc-fusion hu IgG1 Fc DANG 서열번호 6
C1.01m Fc-fusion mu CRIg-mu IgG2a Fc DANG 서열번호 7
C1.02m Fc-fusion mu CRIg-mu IgG2a Fc DANG-VEGF binder 서열번호 8
C1.03m Fc-fusion mu IgG2a Fc DANG-mu CRIg 서열번호 9
C1.04m Fc-fusion VEGF binder-mu IgG2a Fc DANG-mu CRIg 서열번호 10
C1.06m Fc-fusion mu IgG2a Fc DANG 서열번호 11
C1.07m Fc-fusion mu IgG2a Fc DANG-VEGF binder 서열번호 12
아필리버셉트
(Aflibercept)		 Fc-fusion 아필리버셉트(Aflibercept) 서열번호 13
C1.01(서열번호 1)은 사람 CRIg 단백질의 세포외도메인 영역(20 내지 283), 링커 및 DANG 변이(D265A, N297G)를 통해 이펙터 기능(effector function)을 제거한 사람 IgG1 Fc로 구성된다.
C1.02(서열번호 2)는 사람 CRIg 단백질의 세포외도메인 영역(20 내지 283), 링커 및 사람 IgG1 Fc DANG, 링커, 아필리버셉트(Aflibercept)의 VEGF 결합부위로 구성된다.
C1.03(서열번호 3)은 사람 IgG1 Fc DANG, 링커 및 사람 CRIg 단백질의 세포외도메인 영역(20 내지 283)으로 구성된다.
C1.04(서열번호 4)는 아필리버셉트의 VEGF 결합부위와 링커, 사람 IgG1 Fc DANG, 링커 및 사람 CRIg 단백질의 세포외도메인 영역(20 내지 283)으로 구성된다.
C1.05(서열번호 5)는 아필리버셉트의 VEGF 결합부위, 링커 및 사람 IgG1 Fc DANG으로 구성된다.
C1.06(서열번호 6)은 사람 IgG1 Fc DANG으로 구성된다.
C1.01m(서열번호 7)은 마우스 CRIg 단백질의 세포외도메인 영역(20 내지 187), 링커 및 DANG 변이(D265A, N297G)를 통해 이펙터 기능을 제거한 마우스 IgG2a Fc로 구성된다.
C1.02m(서열번호 8)은 마우스 CRIg 단백질의 세포외도메인 영역(20 내지 187), 링커, 마우스 IgG2a Fc DANG, 링커, 및 아필리버셉트(Aflibercept)의 VEGF 결합 부위로 구성된다.
C1.03m(서열번호 9)은 마우스 IgG2a Fc DANG, 링커 및 마우스 CRIg 단백질의 세포외도메인 영역(20 내지 187)으로 구성된다.
C1.04m(서열번호 10)은 아필리버셉트의 VEGF 결합 부위와 링커, 마우스 IgG2a Fc DANG, 링커 및 마우스 CRIg 단백질의 세포외도메인 영역(20 내지 187)으로 구성된다.
C1.06m(서열번호 11)은 마우스 IgG2a Fc DANG으로 구성된다.
C1.07m(서열번호 12)은 마우스 IgG2a Fc DANG, 링커 및 아필리버셉트의 VEGF 결합 부위로 구성된다.
[서열번호 1] hu CRIg-hu IgG1 Fc DANG
RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLP GGGGS DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVAVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
[서열번호 2] hu CRIg-hu IgG1 Fc DANG -VEGF binder
RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLP GGGGS DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVAVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG GGGGSGGGGS SDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEK
[서열번호 3] hu IgG1 Fc DANG -hu CRIg
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVAVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG GGGGSGGGGS RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLPG
[서열번호 4] VEGF binder-hu IgG1 Fc DANG -hu CRIg
SDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEK GGGGS DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVAVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG GGGGSGGGGS RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLPG
[서열번호 5] VEGF binder-hu IgG1 Fc DANG
SDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEK GGGGS DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVAVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
[서열번호 6] hu IgG1 Fc DANG
SVFLFPPKPKDTLMISRTPEVTCVVVAVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
[서열번호 7] mu CRIg-mu IgG2a Fc DANG
HPTLKTPESVTGTWKGDVKIQCIYDPLRGYRQVLVKWLVRHGSDSVTIFLRDSTGDHIQQAKYRGRLKVSHKVPGDVSLQINTLQMDDRNHYTCEVTWQTPDGNQVIRDKIIELRVRKYNPPRINTEAPTTLHSSLEATTIMSSTSDLTTNGTGKLEETIAGSGRNLP GGGGS EPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVAVSEDDPDVQISWFVNNVEVHTAQTQTHREDYGSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK
[서열번호 8] mu CRIg-mu IgG2a Fc DANG -VEGF binder
HPTLKTPESVTGTWKGDVKIQCIYDPLRGYRQVLVKWLVRHGSDSVTIFLRDSTGDHIQQAKYRGRLKVSHKVPGDVSLQINTLQMDDRNHYTCEVTWQTPDGNQVIRDKIIELRVRKYNPPRINTEAPTTLHSSLEATTIMSSTSDLTTNGTGKLEETIAGSGRNLP GGGGS EPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVAVSEDDPDVQISWFVNNVEVHTAQTQTHREDYGSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPG GGGGSGGGGS SDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEK
[서열번호 9] mu IgG2a Fc DANG -mu CRIg
EPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVAVSEDDPDVQISWFVNNVEVHTAQTQTHREDYGSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPG GGGGSGGGGS HPTLKTPESVTGTWKGDVKIQCIYDPLRGYRQVLVKWLVRHGSDSVTIFLRDSTGDHIQQAKYRGRLKVSHKVPGDVSLQINTLQMDDRNHYTCEVTWQTPDGNQVIRDKIIELRVRKYNPPRINTEAPTTLHSSLEATTIMSSTSDLTTNGTGKLEETIAGSGRNLPG
[서열번호 10] VEGF binder-mu IgG2a Fc DANG -mu CRIg
SDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEK GGGGS EPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVAVSEDDPDVQISWFVNNVEVHTAQTQTHREDYGSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPG GGGGSGGGGS HPTLKTPESVTGTWKGDVKIQCIYDPLRGYRQVLVKWLVRHGSDSVTIFLRDSTGDHIQQAKYRGRLKVSHKVPGDVSLQINTLQMDDRNHYTCEVTWQTPDGNQVIRDKIIELRVRKYNPPRINTEAPTTLHSSLEATTIMSSTSDLTTNGTGKLEETIAGSGRNLPG
[서열번호 11] mu IgG2a Fc DANG
APNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVAVSEDDPDVQISWFVNNVEVHTAQTQTHREDYGSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK
[서열번호 12] mu IgG2a Fc DANG -VEGF binder
EPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVAVSEDDPDVQISWFVNNVEVHTAQTQTHREDYGSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPG GGGGSGGGGS SDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEK
[서열번호 13] 아필리버셉트(Aflibercept)
SDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
제조예 2. 인간 단백질(C1.01 내지 C1.06, 및 아필리버셉트), 마우스 단백질(C1.03m 내지 C1.04m)의 제조
제조예 2.1. 벡터 구성과 플라스미드 맥시-프렙
하기 표 2 및 표 3은 사용한 시약 및 장비를 기재하였다.
시약 제조사 Catalog#
pTT5 chempartner
In-Fusion HD cloning kit Clontech 639648
Accuprime pfx DNA polymerase Invitrogen 12344-04
Gel DNA fragment purication Kit TaKaRa D823A
FastDigest® BamHI Fermentas FD0055
FastDigest® EcoRI Fermentas FD0275
장비 및 도구 제조사 모델명
생물 안전 작업대 NUAIRE LabGard class II
원심분리기 Eppendorf 5424
젤 이미징 시스템 Tanon 2500R
PCR을 통해 합성한 DNA 단편을 증폭시키고, PCR 생성물을 젤로 정제하였다. 제한효소 EcoRI와 BamHI로 pTT5 벡터를 자르고 난 후 젤을 정제하였다. In-Fusion Kit를 이용해 각각의 PCR 생성물과 선형 벡터를 연결하였다. 생성된 벡터를 ECOS101 DH5α competent cell에 형질전환 시키고, 100 μg/ml 엠피실린을 함유하는 2xYT 한천 판에 배양하였다. 모든 조작 과정은 표준 형질 전환 프로토콜을 따라 수행하였다. 콜로니 PCR로 양성 재조합체를 확인하고, 재조합 플라스미드를 sequence-verify sequencing를 수행하였다. 단일 콜로니를 선택하여 100 μg/ml 엠피실린을 함유하는 5 mL 2 x YT 배지에 종균을 접종하였다. 37℃에서 8시간 동안 흔들며 배양하였다.
이후, 종균을 1:1,000의 비율로 200 mL의 선택적 2 x YT 배지에 희석하였다. 37℃에서 16시간 동안 흔들면서 배양하였다. 4℃ 4,700 rpm에서 10분동안 원심 분리하여 박테리아 세포를 수확하였다. 12 mL의 RES-EF 용액에 박테리아 펠릿을 재부유시켰다. 그 후, 12 mL의 LYS-EF 용액을 첨가하고, 밀봉한 튜브를 힘차게 뒤집어 완전히 혼합한 뒤, 실온에서 5분간 배양하였다. 12 mL의 NEU-EF 용액을 용해물에 첨가하고, 힘차게 뒤집어 빠르게 완전히 혼합하였다.
NucleoBond® Xtra 컬럼 필터에 용해물을 주입하기 전, 필터의 막힘을 방지하기 위해 용해물 튜브를 3번 정도 뒤집어 침전물의 균질한 현탁을 제조하였다. 그 후, 10 mL의 필터 세척 용액 FIL-EF로 NucleoBond® Xtra 컬럼 필터와 NucleoBond® Xtra 컬럼을 세척하였다. NucleoBond® Xtra 컬럼 필터를 빼내거나 컬럼을 거꾸로 뒤집어 제거하였다. 90 mL의 세척 용액 ENDO로 NucleoBond® Xtra 컬럼을 세척하였다.
45 mL의 세척 용액 WASH-EF로 NucleoBond® Xtra 컬럼을 세척하였다. 15 mL의 용출 용액 ELU로 플라스미드 DNA를 용출시켰다. 용출액은 50 mL 원심분리 튜브에 수집하였다. 10.5 mL의 상온 이소프로판올을 첨가하여 용출된 플라스미드 DNA를 침전시켰다. 볼텍스 후, 혼합물을 2분간 그대로 방치하였다.
그 후, 5 mL의 70% 에탄올을 펠릿에 첨가하였다. 파이펫 팁을 이용해 튜브에서 에탄올을 조심스럽게 완전히 제거하였다. 펠릿을 상온(20-25℃)에서 건조시켰다. 그 후, DNA 펠릿을 1,000 μl의 H2O로 용해시켰다.
제조예 2.2. 세포 형질 주입과 단백질 발현
하기 표 4에 사용한 재료 및 시약 기재하였다.
재료 및 시약 제조사(Product #)
293F cells Invitrogen(R790-07)
OPM 293 OPM(81075-001)
Pluronic® F-68, 10%(100X) Gibco(24040-032)
1 mg/ml PEI Polyscience(23966)
OPTI MEM I Gibco(31985088)
Peptone(20x) FLUKA(P0521-1KG)
셰이커 플라스크
ISF1-X 배양기 셰이커 Kuhner shaker
완전 배지를 넣은 293F seed strain을 130 rpm, 37℃ 8% CO2의 배양기 셰이커에서 유지하였다. 세포를 0.3 내지 0.4x106 cells/ml의 밀도로 배양하고, 매 2 내지 3일마다 배지를 교환하였다. 형질 주입 24시간 전, 새로 계대 배양한 293F 세포를 2.6x106 cells/ml로 준비하였다. 준비한 세포는 130 rpm, 37℃ 8% CO2의 배양기 셰이커에서 배양하였다. 형질 주입 당일, 새로운 배지를 사용하여 5.0x106 cells/ml의 밀도로 세포를 조정하였다. 3 L 셰이커 플라스크에서 1 L의 총 부피로 수행하였다. 0.4 mg HC 및 0.6 mg LC 플라스미드를 50 ml OPTI MEM I으로 희석하고, 0.22 μm 필터로 여과하였다. 그 후, 2 mg PEI를 50 mL OPTI MEM I으로 희석하여 형질 주입 시약을 준비하였다.
희석된 PEI를 DNA 혼합물에 첨가한 뒤, 즉시 혼합하였다. 이후 15분간 상온에서 배양하였다. 2.6x106 cells/ml로 준비한 293F 세포에 DNA-PEI 혼합물을 첨가하였다. 이후 세포는 130 rpm, 37℃ 8% CO2의 배양기 셰이커에서 24시간 동안 계속 배양하였다. 형질 주입 24시간 후, 최종 농도가 0.5%가 되도록 배양액의 1/20에 10% 펩톤을 첨가하였다. 이후 세포는 130 rpm, 37℃ 8% CO2의 배양기 셰이커에서 계속 배양하였다. 형질 주입 후 2 내지 5일 기간에 매일 세포 밀도/생존 능력을 측정하고 기록하였다. 형질 주입 7일 후 또는 세포 생존 능력이 70% 미만에서 정제를 위해 세포를 수확하였다.
제조예 2.3. 단백질 정제
하기 표 5 내지 표 7은 단백질 정제를 위해 사용한 시약, 각 용액의 구성 및 장비를 나타낸 것이다.
시약 제조사 Catalog#
Mabselect SuRe GE Healthcare 11003493
Tris SIGMA 77-86-1
NaCl ACROS ORGANIVS 7647-14-5
Sodium citrate Adamas-beta 76198B
Citric acid GENERAL-Reagent G83162B
Arginine VETEC V900343-500G
Succinic acid Sigma-Aldrich S9512-500G
Triton X-100 ABCONE X10010-1L
TRITON X-114 SIGMA-ALDRICH X114
Millex-GP Filter Unit 0.22 μm Sterile MILLIPORE SLGP033RS
NaOH Merck B146369740
용액 A 25 mM Tris, 150 mM NaCl, pH 8.0
용액 B 25 mM Tris, 150 mM NaCl,0.1% Triton X-100, 0.1% Triton X-114 pH 8.0
용액 C 100 mM Sodium Citrate, 150 mM NaCl, pH 3.0
용액 D 1 M Arginine, 400 mM Succinic acid, pH 9.0
용액 E 20 mM PB pH 6.5, 1 M(NH4)2SO4
용액 F 20 mM PB pH 6.5, 25% isopropyl alcohol
최종용액 20 mM HEPES, pH 7.5, 240 mM sucrose 또는 20mM his acetate pH 5.5, 240 mM sucrose
기기 제조사 모델명
AKTA Pure GE Healthcare 29-0182-24
원심분리기 Beckman J-26xp
젤 이미징 시스템 Tanon 2500R
Sartopore 2 filter Sartorius 5445307H9-OO-A
Mabselect sure 컬럼을 이용하여 단백질을 정제하였다. 구체적으로, 2,000xg, 4℃에서 20분간 원심 분리하여 상층액을 수확하였다. 그 후, Sartopore 2 필터로 상층액을 여과하였다. 용액 A로 평형화된 5 ml MabSelect Sure 컬럼으로 정화된 상층액을 로딩하였다. 그 후, A280 흡광도가 기준치에 도달할 때까지 용액 A로 컬럼을 세척하였다. 10 CV 용액 B로 컬럼을 세척하였다. 10 CV 용액 A로 컬럼을 세척하였다. 6 CV 용액 C로 결합된 단백질을 용출하고, 1/6 부피의 용액 D를 넣어 용출한 물질을 중화하고, SDS-PAGE와 SEC-HPLC 분석을 진행하였다.
그 후, HIC 컬럼을 통한 단백질을 정제하였다. 그 후, 밤새 4℃에서 용액 E에 대해 단백질을 투석하였다. 용액 E로 평형화된 HIC 컬럼에 상층액을 로딩하였다. 그 후, A280 흡광도가 기준치에 도달할 때까지 용액 E로 컬럼을 세척하였다. 기울기 용리(10 CV 용액 F 0%-40%)로 결합된 단백질을 용출하였다. 2 CV 100% 용액 F로 결합된 단백질을 용출하고, SDS-PAGE 분석을 진행하였다. 단백질을 정제한 후 해당 단백질들을 한 군데로 모아준 후, 밤새 4℃에서 최종 용액에 대해 단백질을 투석하였다. 그 후, SDS-PAGE 및 SEC-HPLC 분석을 수행하였다.
그 결과, 도 1 및 도 2에 나타낸 것과 같이, 정제된 C1.01, C1.02, C1.03, C1.04, C1.05, C1.06, C1.03m, C1.04m 및 아필리버셉트(Aflibercept)를 SDS-PAGE로 확인하였다.
제조예 3. 마우스 융합단백질(C1.01m, C1.02m, C1.06m 및 C1.07m)의 제조
제조예 3.1. 단백질의 제조
하기 표 8에 사용한 재료 및 시약을 나타내었다.
재료 및 시약 제조사 Cat. #
Expi293FTM Cells Gibco A14527
Expi293TM Expression System Kit Gibco A14635
MabSelect SuRe GE Lifesciences 17543803
Superdex 200 increase 10/300 GE Lifesciences 28990944
MPCTM Ceramic Hydroxyfluoroapatite Bio-rad 1570200
단백질 서열에 해당하는 DNA 단편을 Genewiz(No. 80-383034849)에서 합성하였다. 해당 DNA 단편을 PCR로 증폭시키고, 선형화된 pcDNA3.3 발현 벡터를 이용하여 투입하였다. 시퀀싱을 통해 구조를 검증한 뒤, 대규모의 플라스미드 제조과정으로 세포 형질 주입을 수행하기에 충분한 양의 DNA를 수득하였다.
먼저 2 L의 세포 배양 배지에서 95% 이상 생존한 2.94x106 cells/mL의 Expi293F 세포를 준비한다. 플라스미드 DNA와 ExpiFectamineTM 293 시약을 먼저 Opti-MEM에 희석한 다음 혼합하여 세포 배양 배지에 첨가하였다. 세포 배양은 150 rpm의 교반 속도로 platform shaker에서 진행하였다. 온도는 37℃ CO2 농도는 8%로 유지하였다. 형질 주입 후 18 내지 20시간이 지나면 인헨서 1과 인헨서 2를 세포 배양 배지에 첨가하였다.
세포 배양 6일 후, 세포를 4,000 rpm, 25℃에서 10분간 원심분리하였다. 정제 및 젤 전기 영동을 수행하기 위해 상층액을 수집하였다. 상층액은 NuPAGETM 4-12% Bis-Tris Protein Gels(ThermoFisher)에 관한 설명에 따라 SDS-PAGE 젤에 로딩하였다. 단백질의 분자량 측정을 위하여 단백질 시료와 함께 PageRulerTM Unstained Protein Ladder(ThermoFisher)이 사용되었다. 각 단백질의 남은 상층액은 이후 진행되는 정제 과정에 사용되었다.
단백질 정제는 다음과 같은 공정으로 수행하였다. 구체적으로, 단백질 A 컬럼(Protein A 컬럼)은 MabSelect Sure resin과 사전에 포장되었다. 세포 배양액을 로딩하기 이전에, 컬럼은 0.1 M Tris, pH 7.0으로 평형화 시켰다. 세포 배양액 로딩 후, 컬럼을 0.1 M Tris, pH 7.0으로 세척한 다음 0.1 M glycine, pH 3.5을 이용해 용출하였다. 용출한 물질에 0.1 M Tris, pH 9.0을 첨가하여 중화하였다. 이어서 시료를 PBS 용액(Sangon Biotech, B548117-0500)에서 투석하였다.
시료를 로딩하기 이전에, SEC 컬럼(GE lifesciences, Superdex 200 increase 10/300)은 PBS로 평형화시켰다. 로딩 후, PBS로 시료를 용출하고 크로마토그래피를 통해 수집하였다. 각 피크를 분석하기 위해 SDS-PAGE를 수행하였다. 각 시료는 제형 용액(10 mM Sodium phosphate, 0.3 내지 0.4 M NaCl, pH 6.8)에서 투석하였다.
CHT 컬럼은 CHT 레진(Bio-rad, MPCTM Ceramic Hydroxyfluoroapatite)과 사전에 포장되었고, 시료를 로딩하기 전 용액 A(10 mM Sodium phosphate, 30 mM NaCl, pH 6.8)으로 평형화시켰다. 로딩 후, 컬럼을 30% 용액 B(10 mM Sodium phosphate, 1 M NaCl, pH 6.8)로 용출시키고, 30% 내지 90%의 선형 구배 용액 B 및 최종 100% 용액 B로 용출하였다. 용출물은 SDS-PAGE로 특성화되었고, 시료는 제형 용액(10 mM Sodium phosphate, 0.3 내지 0.4 M NaCl, pH 6.8)에서 투석하였다. 최종 단백질은 0.2 μm 필터로 여과하고, 1.5 mL 튜브에 0.5 mL씩 무균 상태로 분주하였다.
그 결과, 도 3에 나타낸 것과 같이, 정제된 C1.01m, C1.02m, C1.06m 및 C1.07m를 SDS-PAGE로 확인하였다.
제조예 3.2. 단백질의 특성 분석
나노 드롭(Nano Drop)을 이용해 단백질의 농도를 280 nm에서 측정하였다. 단백질의 순도는 SDS-PAGE 및 HPLC-SEC로 확인하였다.
SDS-PAGE 시료는 15 μL의 정제된 단백질과 5 μL의 4x 로딩 버퍼를 혼합하고, 5 분간 끓여 제조하였다. 혼합된 시료의 15 μL를 NuPAGE Bis-Tris Mini Gels 4 내지 12% 겔에 로딩하였다. SEC-HPLC 분석을 진행하기 위해 80μL의 정제된 단백질을 HPLC system 1260 Infinity II의 TSKgel G3000SWxl 컬럼에 로딩하였고, pH 7.0, 50 mM 인산 나트륨, 150 mM 염화 나트륨을 실행 버퍼(running buffer)로 사용하였다.
제조예 4. 토끼, 랫트 C3, C3b의 정제
제조예 4.1. 토끼, 랫트 C3의 정제
하기 표 9 내지 표 11는 토끼, 랫트의 C3 정제를 위해 사용한 시약, 용액의 구성 및 장비를 나타낸 것이다.
재료 및 시약 제조사 Cat. #
NaCl ACROS ORGANIVS 7647-14-5
NaOH Merck B146369740
KH2PO4 GENERAL-Reagent 7778-77-0
NaH2PO4 GENERAL-Reagent 7558-80-7
EDTA GENERAL-Reagent 60-00-4
Benzamidine Adamas 618-39-3
PBS Gibco C10010500BT
MgCl2 GENERAL-Reagent 7786-30-3
Factor B Complement Technology A135
Factor D Complement Technology A136
DEAE 컬럼
용액 A 10 mM Potassium phosphate(KH2PO4), 5 mM ethylenediaminetetraacetic acid disodium salt(EDTA), 1 mM benzamidine, pH 7.8
용액 B 10 mM Potassium phosphate(KH2PO4), 5 mM EDTA, 1 mM benzamidine, 1 M sodium chloride(NaCl), pH 7.8
MonoS 컬럼
용액A 50 mM Sodium phosphate(NaH2PO4)
용액B 50 mM Sodium phosphate(NaH2PO4), 1 M sodium chloride(NaCl), pH 5.5
S200 컬럼
용액 Phosphate-buffered saline(PBS), pH 7.4
기기 제조사 모델명
AKTA Pure GE Healthcare 29-0182-24
원심분리기 Beckman J-26xp
젤 이미징 시스템 Tanon 2500R
Millex-GP Filter Unit 0.22 μm Sterile MILLIPORE SLGP033RS
DEAE 16/10 FF GE Healthcare 10294207
Mono S 5/50 GL GE Healthcare 10298955
Sephadex S200 GE Healthcare 17104-302
HPLC Waters E2695
단백질 정제에 앞서 혈장의 고분자량의 물질을 제거하기 위한 단계를 수행하였다. 혈장의 부피를 측정한 뒤, 분말 염 결정의 10%(무게/부피비) Na2SO4(무수의)를 교반하면서 단백질 용액에 천천히 첨가하였다. 이후 4℃에서 2시간 동안 교반하였다. Sorvall Ultracentrifuge를 이용하여 26,892xg, 4℃, 30분간 원심분리한 뒤, 상층액을 얻어 부피를 측정하였다. 얻은 상층액을 5 L DEAE 용액 A로 투석하고, 2시간 뒤 새로운 5 L의 용액으로 교환하였다. 최상의 결과를 얻기 위해, 4℃에서 밤새 투석하였다. 투석이 완료되었는지 확인하기 위해 투석액의 부피, A280, 전도도를 확인하였다. 용액이 탁하거나 침전된 경우, 4,000xg, 4℃에서 15분간 원심분리하여 침전물을 제거하였다. 투석액을 0.2 μm 필터를 통해 여과하고, 정제를 진행하기 전까지 얼음에 보관하였다.
단백질 정제는 음이온 교환 크로마토그래피와 양이온 교환 크로마토그래피, 크기 배재 크로마토그래피 순으로 수행하였다. 투석액을 로딩하기 전 DEAE 컬럼(GE healthcare, HiPrepTM DEAE Fast Flow 16/10)은 용액 A(10 mM KH2PO4, 5 mM EDTA, 1 mM benzamidine, pH 7.8)로 평형화시켰다. 로딩 후, 컬럼을 용액 A로 세척하고, 0 내지 50%의 선형 구배 용액 B(10 mM KH2PO4, 5 mM EDTA, 1 mM benzamidine, 1 M NaCl, pH 7.8)로 용출하였다. SDS-PAGE를 통해 용출물의 구획을 분석하고, C3를 포함한 구획을 모아 A280을 확인하였다. 획득한 용출물은 2L Mono S 용액 A(50 mM Sodium phosphate)에서 4℃ 2시간 동안 투석하였다.
Mono S 컬럼(GE healthcare, Mono S® 5/50 GL)은 투석액을 로딩하기 전 용액 A(50 mM Sodium phosphate)로 평형화시켰다. DEAE 용출액 로딩 후, 컬럼을 용액 A로 세척하고, 0 내지 35%의 선형 구배 용액 B(50 mM Sodium phosphate, 1 M NaCl, pH 5.5)로 용출하였다. SDS-PAGE를 통해 용출물의 구획을 분석하고, 중앙에 위치한 피크 구획을 모아 A280을 확인하였다.
시료를 로딩하기 이전에, SEC 컬럼(GE lifesciences, Superdex 200 increase 10/300)은 PBS로 평형화시켰다. 로딩 후, PBS로 시료를 용출하고 크로마토그래피를 통해 수집하였다. 각 피크를 분석하기 위해 SDS-PAGE를 수행하였다. 중앙에 위치한 peak C3 구획들을 모아 A280을 확인하였다.
제조예 4.2. 토끼, 랫트 C3b의 정제
C3를 0.5 mg/mL의 PBS로 희석하여 준비하였다. C3에 0.4 μM factor B, 0.05 μM factor D와 5 mM MgCl2를 첨가하고 25℃에서 30분간 배양하여 C3b로 변환시켰다. C3b는 Superdex 200(60 mL)젤 여과 컬럼을 통해 추가 정제되었다. 다음으로, 토끼 C3, 토끼 C3b, 랫트 C3 및 랫트 C3b의 SDS-PAGE와 SEC-HPLC 분석을 수행하였다.
그 결과, 도 4에 나타낸 것과 같이, 토끼 C3, 토끼 C3b, 랫트 C3 및 랫트 C3b를 정제하였음을 확인하였다.
실험예 1. 융합단백질의 결합력 확인
실험예 1.1. 비아코어 표면 플라스몬 공명(SPR) 분석 기법
융합단백질의 결합력을 확인하기 위하여, Biacore 8K(GE Healthcare, 29129951) 기기를 사용하여 제조한 융합단백질의 물성을 분석하였다.
하기 표 12는 사용한 재료 및 시약을 나타낸 것이다.
시약 제조사 Cat #
CM5 sensor chip GE Healthcare 29-1496-03
HBS-EP+ buffer(10 Υ) GE Healthcare BR-1006-69
Amine coupling kit GE Healthcare BR-1006-33
Human antibody Capture Kit GE Healthcare 29234600
10 mM Glycine 1.5 GE Healthcare BR-1003-54
C3b, C2 및 C4 Complement Technology A114, A112 및 A105
실험예 1.2. CM5 센서 칩에 항 인간 면역글로불린 G(Fc) 항체 고정
100 mL 10x HBS-EP+ 완충액과 900 mL Milli-Q 물을 섞어 1 L 1x HBS-EP+ 완충액을 준비하였다. 420초 동안 50 mM NHS와 200 mM EDC를 1:1 비율로 섞은 후 10 uL/min의 유속으로 CM5 칩을 활성화시켰다. 10,000 RU 정도의 고정 레벨을 도달하기 위해 10 uL/ml의 속도로 400초 동안 25 ug/mL의 항 인간 면역글로불린 G(Fc) 항체(pH 5.0 아세테이트)를 주입시켰다. 남겨진 활성화된 에스테르 그룹들은 10 uL/min의 속도로 420초 동안 1 M 에타놀아민(pH 8.5)을 주입시켜 블로킹시켰다. 기초선을 안정시키기 위해 센서칩을 1xHBS-EP+를 사용하여 10 uL/분의 속도로 16시간 동안 세척하였다.
실험예 1.3. 결합 역동학 측정
기초선 안정화를 위해 샘플 스텝과 재생 스텝으로 이루어진 스타트업 사이클을 3번 수행하였다. 샘플 스텝: 1x HBS-EP+ 완충액을 flow cell에 30 uL/min의 유속으로 120초 동안 주입한후 120초 동안의 분열 단계와 30초 동안의 안정 단계를 거쳤다. 재생 스텝: 30초 동안 30 uL/min의 속도로 10 mM 글리신 pH 1.5가 flow cell에 주입된 후, 30초의 안정화 단계를 가졌다.
그 후, 다음과 같은 방식대로 결합 역동학 측정을 수행하였다:
C3b stock solution은 1x HBS-EP+ 완충액을 사용하여 50 nM로 희석하였다. 인간 VEGF165는 1x HBS-EP+ 완충액을 사용하여 5 nM로 희석하였다. 그후 50 nM 및 5 nM 용액들은 0.78125 nM 및 0.078125 nM로 희석시켰다. 샘플 스텝에서 희석된 항원들은 flow cell에 30 uL/min의 속도로 주입하였다. 2개의 0 nM 항원(1x HBS-EP+ 완충액)을 사용하여 Reference signal에서 제거하였다. 180초 동안 결합시키고, 400초 동안 분리시켰다. 분리 시간 후 60초 동안의 안정화 단계를 수행하였다. 재생 스텝으로는 flow cells에 30 uL/min의 속도로 30초 동안 10 mM의 pH 1.5 글리신(Glycine)을 주입한 후 60초 동안의 안정화 단계를 가졌다.
실험예 1.4. 분석 및 결과
샘플 값에서 reference와 0 nM 값을 뺀 후 Biacore Insight Evaluation Software(Version 2.0.15.12933)와 1:1 결합 모델 곡선 맞춤(binding model for curved fitting)을 이용하여 결합 역동학을 계산하였다.
하기 표 13은 테스트 물질들의 결합 친화도를 나타낸 것이다.
Capture 1 Solution Analyte 1 Solution ka(1/Ms) kd(1/s) KD(M)
0.5 ug/ml C1.01 C3b 3.47E+06 1.21E-02 3.47E-09
2 ug/ml C1.02 C3b 3.66E+06 1.59E-02 4.34E-09
2 ug/ml C1.02 human VEGF165 3.94E+06 2.47E-04 6.28E-11
인간 C3b 및 인간 VEGF165에 대한 C1.01 및 C1.02의 결합 친화도 및 마우스 C3b 및 인간 VEGF165에 대한 C1.01m 및 C1.02m의 결합 친화도를 비아코어 분석(biacore analysis)을 통해 확인하였다.
그 결과, 표 13, 도 6 및 도 7에 나타낸 것과 같이, 인간 및 마우스의 C1.01 및 C1.02이 모두 C3b와 높은 결합력을 가지며, 인간 및 마우스 C1.02가 인간 VEGF165와 높은 결합력을 가지는 것을 확인하였다.
실험예 2. 효소면역분석법(ELISA)을 통한 융합단백질의 보체 단백질 및 VEGF와의 결합 친화도 확인
일 구체예의 융합단백질 이량체의 보체 경로 저해 여부를 확인하기 위하여, 효소면역분석법을 통해 C1.01, C1.02, C1.03, C1.04, C1.01m 내지 C1.03m의 C3b 단백질의 결합 여부를 확인하였다.
구체적으로, 인간 C3b 단백질을 플레이트에 고정하고 C1.01, C1.02, C1.03, C1.04, 및 대조군으로써 hIgG1을 결합시켰다. 다음으로, 항-인간 면역글로불린 G 항체 및 항 겨자무과산화효소(HRP) 항체를 순차적으로 결합시켰다. 더불어, 마우스 C3b 단백질을 플레이트에 고정하고 마우스 CRIg을 가지고 있는 C1.01m 내지 C1.03m을 마우스 C3b에 결합시켰다.
그 결과, 도 8a에 나타낸 것과 같이, CRIg을 포함하는 C1.01, C1.02, C1.03 및 C1.04가 농도 의존적인 방법(Concentration dependent manner)으로 인간 C3b에 결합함을 확인하였다. 또한, 도 8c에 나타낸 것과 같이, 마우스 CRIg을 포함하는 C1.01m 내지 C1.03m도 농도 의존적으로 마우스 C3b에 결합함을 확인하였다.
일 구체예의 융합단백질의 항-VEGF 작용 여부를 확인하기 위하여, 효소면역분석법을 통해 융합단백질 및 인간 VEGF165 단백질의 결합 여부를 인간 VEGF165에 대한 아필리버셉트, C1.02, C1.04 및 C1.05의 결합 친화도를 ELISA를 통해 확인하였다.
구체적으로, 인간 VEGF165 단백질을 플레이트에 고정하고 C1.02, C1.04, C1.05, 대조군으로써 아필리버셉트(Aflibercept) 및 hIgG1을 결합시켰다. 다음으로 항 인간 면역글로불린 G 항체와 항 겨자무과산화효소(HRP) 항체를 순차적으로 결합시켰다.
그 결과, 도 8b에 나타낸 것과 같이, 효소면역분석법 확인 결과 항-VEGF를 가지고 있는 아필리버셉트(Aflibercept), C1.02, C1.04, 및 C1.05가 농도 의존적으로 인간 VEGF165에 결합함을 확인하였다.
일 실시예의 융합단백질이 대체 경로의 C3b와 결합하여 대체 경로를 저해하면서도, 고전 경로의 인간 C2 또는 C4 단백질과는 결합하지 않아 고전 경로를 저해하지 않음을 확인하기 위하여, 효소면역분석법을 통해 일 구체예의 융합단백질 C1.01 및 인간 Cb3, C2 및 C4 단백질의 결합 여부를 확인하였다.
구체적으로, 인간 Cb3, C2 또는 C4 단백질을 플레이트에 고정하고 C1.02를 결합시켰다. 다음으로, 항 인간 면역글로불린 G 항체 및 항 겨자무과산화효소(HRP) 항체를 순차적으로 결합시켰다.
그 결과, 도 8d에 나타낸 것과 같이, C1.02는 C3b에 결합하면서도, C2 및 C4에 결합하지 않는 것을 확인하였다.
실험예 3. 동적 광 산란(DLS) 분석
VEGF 바인더의 포함 여부에 따른 융합단백질의 유체학적 반경(hydrodynamic radius)을 확인하기 위하여, C1.01 및 C1.02의 유체학적 반경을 동적 광 산란법으로 분석하였다.
구체적으로, C1.01 및 C1.02를 10분 동안 12,000xg로 원심분리하고, 상층액을 96-well plate에 추가한 후, DLS 분석 장비인 Zetasizer APS(Marlvern)으로 25℃에서 측정하였다.
하기 표 14은 C1.01 및 C1.02의 유체학적 반경을 나타낸 표이다.
C1.01 C1.02
Z-Average(r.nm) Test1 5.828 8.603
Test2 6.058 8.686
Test3 6.078 8.596
Mean 5.988 8.628
그 결과, 표 14, 도 9a 및 9b에 나타낸 것과 같이, VEGF 바인더를 포함하는 C1.02의 유체학적 반경이 포함하지 않는 C1.01에 비해 길게 측정되었음을 확인할 수 있었다.
실험예 4. C1.02의 점도 측정
C1.02 점도를 농도별로 측정하기 위하여, 마이크로 점도 측정 장비(m-VROC, RheoSence)와 vROC-mB05(RheoSence) chip을 사용하여 33, 65 및 130 mg/ml의 C1.02의 점도를 측정하였다. 더불어, 대조군으로서 사람 혈청 알부민 134 mg/ml의 점도도 측정하였다.
하기 표 15는 측정된 점도를 나타낸 것이다.
시료(농도)
C1.02
(0 mg/ml)		 C1.02
(33 mg/ml)		 C1.02
(65 mg/ml)		 C1.02
(130 mg/ml)		 사람 혈청 알부민
(134 mg/ml)
점도
(cP, mPa-s)		 1.235 1.851 3.327 13.912 2.194
그 결과, 표 15 및 도 10에 나타낸 것과 같이, C1.02의 농도가 증가함에 따라 점도가 증가함을 확인하였다.
실험예 5. 용혈 분석을 통한 대체 보체 경로 억제 효과 분석
하기 표 16은 사용한 시약을 나타낸 표이다.
Reagent Vendor
C1q-depleted serum Comptech
Rabbit RBC Yuduo biolody
Gelatin Veronal Buffer(5 mM Barbital) Boston bioproducts
Assay plate Corning
일 구체예의 융합 단백질이 대체 보체 경로를 억제함을 확인하기 위하여, C1.01, C1.02, C1.04, C1.01m, C1.02m 및 C1.04m의 용혈 분석(AH50)을 수행하였다.
구체적으로, 토끼 적혈구 3 mL을 TBS로 10분 동안 400xg에서 원심분리기를 사용하여 세척하고, 이 과정을 2번 반복한 후, 토끼 적혈구를 GVB EGTA 완충액으로 10분 동안 400xg에서 원심분리기를 사용하여 다시 한번 세척하였다. 다음으로, 토끼 적혈구의 농도를 GVB EGTA 완충액을 사용하여 1x109 cells/mL로 조정하였다.
민감화된 적혈구를 통해 AH50을 분석하기 위하여, 9% 인간 C1q-결핍 혈청을 96-well plate에 추가하였다(50 uL/well). 또한, 여러 농도의 C1.01, C1.02, C1.01m, 및 C1.02m을 처리하였다. 4℃에서 30분 동안 배양한 후 토끼 적혈구를 추가하였다(2x106/well, 50 uL/well). 37℃에서 1.5시간 동안 배양하고 10분 동안 600xg에서 원심분리하였다. 상층액 110 uL를 수집 후 OD415 값을 측정하였다.
C1.01, C1.02, C1.04, C1.01m, C1.02m 및 C1.04m의 대체 보체 경로 억제 효과를 AH50 용혈 분석을 통해 확인하였다.
그 결과, 표 16, 도 11a 내지 도 11c에 나타낸 것과 같이, C1.01, C1.02, C1.04, C1.01m, C1.02m 및 C1.04m이 농도 의존적으로 대체 보체 경로에 의한 용혈작용을 억제시키는 것을 확인하였다.
실험예 6. 용혈 분석을 통한 고전적 보체 경로 억제 효과 분석
하기 표 17은 사용한 시약을 나타낸 표이다.
Reagent 제조사
Factor B-Dpl serum Comptech
Sheep RBC Yuduo biolody
Hemolysin Yuduo biolody
Gelatin Veronal Buffer(GVB; 5 mM Barbital) Boston bioproducts
Assay plate Corning
일 구체예의 융합단백질 이량체가 고전 보체 경로를 억제하지 않음을 확인하기 위하여, C1.01, C1.02, C1.04, C1.05, C1.06, C1.01m, C1.02m, C1.04m, C1.06m, 및 C1.07m의 용혈 분석(CH50)을 수행하였다.
구체적으로, 양의 적혈구를 TBS에 10분 동안 400xg로 원심분리하고, 이 과정을 2번 반복한 뒤, 30분 동안 4℃에서 1 mL 20% 양 적혈구와 용혈소를 배양하였다. 다음으로, 10분 동안 400xg에서 원심분리기를 사용하여 양 적혈구를 TBS로 세척하였고, 이 과정을 2번 반복한 뒤, 10분 동안 400xg에서 원심분리기를 사용하여 양 적혈구를 GVB++ 완충액으로 세척하였다. 다음으로, GVB++ 완충액을 사용하여 민감해진 양 적혈구를 1x109/mL의 농도로 조정하였다.
민감화된 적혈구를 통해 CH50을 분석하기 위하여, 3% 또는 4.5% 인간 Factor B-결핍 혈청(factor-B depleted serum)을 96-well plate에 추가한 후(50 μL/well), 여러 농도의 C1.01, C1.02, C1.06, C1.01m, C1.02m, C1.06m, 및 C1.07m을 처리하였다. 4℃에서 30분 동안 배양한 후, 민감해진 양 적혈구를 추가하였다(2.5x106/well, 50 uL/well). 37℃에서 30분 동안 배양하였다. 10분 동안 600xg에서 원심분리하여 상층액 110 uL를 수집한 후, OD415 값을 측정하였다.
그 결과, 표 16, 도 12a 내지 12c에 나타낸 것과 같이, C1.01, C1.02, C1.04, C1.05, C1.06, C1.01m, C1.02m, C1.04m, C1.06m, 및 C1.07m 모두 고전적 보체 경로에 의한 용혈작용을 억제시키지 않음을 확인하였다.
실험예 7. VEGF 리포터 세포를 이용한 융합단백질의 효능 분석
일 구체예의 융합단백질이 VEGF 단백질을 효과적으로 저해하는지 확인하기 위하여, VEGF 및 VEGF 수용체와의 결합 저해 여부를 확인하였다.
아필리버셉트, C1.01, C1.02, C1.05 및 C1.06의 VEGF 신호전달 저해 효과를 리포터 세포를 사용하여 확인하였다. 구체적으로, VEGF가 결합하면 수용체-매개 신호전달(receptor-mediated signaling)에 의해 발광 빛이 생성되는 VEGF 리포터 세포(GA3001, Promega, USA)를 이용하여 아필리버셉트, C1.02 및 C1.05가 VEGF 및 VEGF 수용체와의 결합을 저해하는지를 발광(luminescence) 정도로 확인하였다.
그 결과, 도 13에 나타낸 것과 같이, 아필리버셉트, C1.02 및 C1.05가 농도 의존적으로 VEGF에 의한 수용체-매개 신호전달을 저해시킴을 확인하였다.
실험예 8. 융합단백질에 의한 상처 치유 분석 평가
일 구체예의 융합단백질 이량체가 VEGF 단백질을 효과적으로 저해하는지 확인하기 위하여 융합단백질 이량체의 상처 치유 능력 저해 효과를 통해 확인하였다.
구체적으로, C1.01, C1.02, 및 C1.05의 VEGF 신호전달경로 저해 효과를 세포 기반 상처 치유 분석법을 통해 확인하였다. 평가를 위해 ARPE-19(Adult Retinal Pigment Epithelial cell line-19)를 사용하였다. ARPE-19 세포들은 Dulbecco's Modified Eagle's Medium(DMEM)/F12 배지에 10% Fetal Bovine Serum(FBS)를 사용하여 배양하였다. ARPE-19 세포들(80,000 cells/well)을 24-well plate에 하루동안(overnight) 배양하였다. 다음날 각 well에 고르게 상처를 낸 후 배양액에 VEGF(6 ng/ml) 및 C1.01, C1.02, 및 C1.05(35 nM)을 넣어준 후 24시간 뒤에 각 융합단백질들의 상처 치유 저해 능력을 분석하였다.
그 결과, 도 14에 나타낸 것과 같이, C1.02는 대조군 대비 유의미하게 상처 치유를 저해시켰고(p=0.0031), 이러한 효과는 C1.01(p=0.0146) 및 C1.05(p=0.0482)에 비해 현저하였음을 확인하였다.
실험예 9. 종류 교차 반응성(species cross reactivity) 시험
일 구체예의 융합단백질 이량체의 종류 교차 반응성을 확인하기 위하여, 효소면역분석법을 통해 C1.02가 다른 종 유래의 C3b와 VEGF에 결합하는지를 확인하였다.
C1.02에 대한 인간 및 게잡이원숭이의 C3b의 결합능; 및 C1.06에 대한 인간 및 게잡이원숭이의 C3b의 결합능; 및 C1.02에 대한 인간, 게잡이원숭이, 랫트 및 토끼 VEGF의 결합능; 및 C1.01에 대한 인간, 게잡이원숭이, 랫트 및 토끼 VEGF의 결합능을 ELISA를 통해 확인하였다. 구체적으로, 인간 및 게잡이원숭이, 랫트 또는 토끼의 C3b 또는 VEGF를 플레이트에 고정하고, C1.01, C1.02 또는 C1.06를 결합시켰다. 다음으로, 항 인간 면역글로불린 G 항체 및 항 겨자무과산화효소(HRP) 항체를 순차적으로 결합시켰다.
그 결과, 도 15a 내지 15c에 나타낸 것과 같이, C1.02는 게잡이원숭이, 토끼, 및 랫트 C3b와 VEGF에 결합하여 종류 교차 반응성이 있음을 확인하였다.
실험예 10. 습성 황반 변성 마우스 동물 모델을 활용한 효능 평가
일 구체예의 융합단백질의 습성 황반 변성(Wet Age-related Macular Degeneration) 치료 효과를 확인하기 위하여, 마우스 동물 모델에 맥락막 혈관신생(Choroidal neovascularization)을 유도한 후, 안구 내에 일 실시예의 융합단백질 이량체를 직접 주입하여 효과를 확인하였다.
마우스에 맥락막 혈관신생 표현형을 유도하기 위하여, 유도 전 스펙트럼 영역광간섭단층촬영기(Envisu R2200 SD-OCT System; Bioptigen, Inc., USA)를 통해 마우스에 구조적 이상이 있는지 확인하였다.
다음으로, 마우스 오른쪽 눈에 다이오드 레이저(OcuLight TX - Green 532nm Laser; Iridex Corporate, USA)를 사용하여 부르크막을 관통시켜 3개의 맥락막 혈관신생을 유도하였다(Day 0). 맥락막 혈관신생 유도 후, 스펙트럼 영역광간섭단층촬영기와 형광안저혈관조영술(HRA2 FA system; Heidelberg Engineering GmbH, Germany)을 사용하여 모델이 정상적으로 유발되었는지 확인하였다.
유도 후 즉시 C1.02m(350 μM; 48.3 ㎍/㎕, 2 ㎕), 아필리버셉트 (Eylea; 350 μM; 40.0 ㎍/㎕, 2 ㎕) 또는 vehicle control(2 ㎕)을 안구내 주사(Intravitreal injection)를 통해 주입하였다. 맥락막 혈관신생 유도 직후(Day 0)와 유도 후 7일 후(Day 7)에 스펙트럼 영역광간섭단층촬영기와 형광안저혈관조영촬영기를 사용하여 생체 내 촬영을 하였다. 형광안저혈관조영촬영기 사진에서 각 맥락막 혈관신생 당 혈관 누출(vascular leak)이 있다면 1점, 없다면 0점을 주어 점수를 매긴 후 병변 확률을 계산하였다. 예를 들어, 100% 표기는 세 군데의 맥락막 혈관신생에서 혈관 누출이 관찰됨을 의미한다.
그 결과, 도 16a 내지 도 16c에 나타낸 것과 같이, 투여 7일 후 C1.02m 군은 아필리버셉트 군과 비슷한 보호 효과를 가지며, vehicle 군 대비 유의미한 보호 효과가 있는 것을 확인하였다.
실험예 11. 습성 황반 변성 토끼 동물 모델을 활용한 효능 평가
일 구체예의 융합단백질의 습성 황반 변성(Wet Age-related Macular Degeneration) 치료 효과를 확인하기 위하여, 토끼 동물 모델에 맥락막 혈관신생(Choroidal neovascularization)를 유도한 후, 안구 내 일 구체예의 융합단백질을 직접 주입하여 효과를 확인하였다.
6개의 맥락맥 혈관신생을 유도하였다는 것 이외에는 상기 실험예 10에서 전술한 방법과 유사한 방법으로 토끼에 맥락막 혈관신생을 유도하여 습성 황반 변성 토끼 모델을 제조하였다. 맥락막 혈관신생 유도 후 즉시 C1.01(350 μM; 38.45 ㎍/㎕, 50 ㎕), 아필리버셉트(Aflibercept)(350 μM; 40 ㎍/㎕, 50 ㎕), 또는 vehicle control(50 ㎕)을 안구내 주사를 통해 주입하였다. 맥락막 혈관신생 유도 직후(Day 0)와 유도 후 7일 후(Day 7) 및 14일 후(Day 14) 형광안저혈관조영촬영기를 사용하여 생체 내 촬영을 하였다. 맥락막 혈관신생에서 형광강도를 측정하여 혈관 누출(vascular leak)을 측정하였다.
그 결과, 도 17에 나타낸 것과 같이, 투여 7일 후 C1.01 군은 아필리버셉트 군과 비슷한 보호 효과를 가지며, vehicle 군 대비 유의미한 보호 효과가 있는 것을 확인하였다.
실험예 12. 습성 황반 변성 랫트 동물 모델을 활용한 효능 평가
일 구체예의 융합단백질의 습성 황반 변성 치료 효과를 확인하기 위하여, 랫트 동물 모델에 맥락막 혈관신생을 유도한 후, 안구 내 일 구체예의 융합단백질을 직접 주입하여 효과를 확인하였다.
4개의 맥락맥 혈관신생을 유도하였다는 것 이외에는 상기 실험예 10에서 전술한 방법과 유사한 방법으로 랫트에 맥락막 혈관신생을 유도하여 습성 황반 변성 랫트 모델을 제조하였다. 맥락막 혈관신생 유도 후 즉시 C1.02(350 μM; 54.93 ㎍/㎕, 5 ㎕), 아필리버셉트(350 μM; 40 ㎍/㎕, 5 ㎕) 또는 vehicle control(5 ㎕)을 안구내 주사를 통해 주입한 후 Day 0 및 Day 10에 형광안저혈관조영촬영기와 스펙트럼 영역광간섭단층촬영기를 사용하여 생체 내 촬영을 하였다. 촬영을 통해 유도 직후와 유도 10일 후의 맥락막 혈관신생 유무 및 혈관 누출(vascular leak) 넓이를 정량화하여 나타내었다.
그 결과, 도 18a 및 18b에 나타낸 것과 같이, 투여 10일 후 C1.02 군은 맥락막 혈관신생 숫자 및 혈관 누출 넓이를 유의미하게 감소시켜 아필리버셉트 군과 비슷한 보호 효과를 가지며, vehicle 군 대비 유의미한 보호 효과가 있는 것을 확인하였다.
실험예 13. 건성 황반 변성 마우스 동물 모델을 활용한 효능 평가
일 구체예의 융합단백질의 건성 황반 변성(Dry Age-related Macular Degeneration) 치료 효과를 확인하기 위하여, 마우스 동물 모델에 건성 황반 변성을 유도한 후, 안구 내 일 구체예의 융합단백질을 직접 주입하여 효과를 확인하였다.
먼저, 8주 차 C57BL/6 마우스에 꼬리 정맥주사를 통해 20 mg/kg 아이오딘산 나트륨(NaIO3)을 투여하여 건성 황반 변성 마우스 동물 모델을 유도하였다.
모델 유도 후, C1.02m(260 μM; 36.1 ㎍/㎕, 1.5 ㎕) 또는 vehicle control(1.5 ㎕)을 안구 내 주사를 통해 Day 0 및 Day 7에 투여하였다. 모델 유도 후 2주 뒤 시험 동물들을 안락사시킨 후 안구 적출하여 Davidson 용액에 24시간 동안 4℃에서 고정시켰다. 다음으로, 고정시킨 샘플을 30% 수크로스 용액에 3일 동안 4℃에서 보관하였다. 샘플들을 OCT compound(Cat #4583, Sakura)에 얼린 후 20 ㎛ 두께로 절단하였다. 절단된 조직들은 면역형광법을 사용하여 C3(Cat #MA1-40046, Thermofisher) 단백질을, DAPI(Cat #H-1200, Vector Laboratories) 염색법을 통해 외 과립층(Outer nuclear layer, ONL)을 염색하였다. 염색된 샘플들은 공초점 현미경(LSM700; Zeiss, Germany)을 사용하여 분석하였다. 구체적으로, 건성 황반 변성 모델의 각 실험군의 외과립층(ONL), 외과립층 세포 수, 외과립층 넓이 및 망막에서의 C3 발현량을 확인하였다.
그 결과, 도 19a 내지 도 19f에 나타낸 것과 같이, 외과립층의 세포 수 및 넓이를 측정하였을 때 vehicle 군에 비해 C1.02m 군에서 유의미하게 망막의 퇴화를 억제시키는 것을 확인하였다. 또한 Non-AMD 군에 비해 vehicle 군에서 C3 발현이 유의미하게 상승한 것을 확인하였고, C1.02m 군에서는 C3 발현이 유의미하게 감소한 것을 확인하였다.
실험예 14. C1.02의 약력학 프로파일 분석
일 구체예의 융합단백질 이량체의 약력학 프로파일을 분석하기 위하여, 15 마리의 뉴질랜드 흰토끼들을 그룹당 세 마리씩 5개의 그룹(G01 내지 G05)으로 나누었다. 그룹을 나눈 후, 2,500 ㎍ C1.02(50 ㎕/eye)를 안구 내 주사를 통해 투여하였다.
약력학 프로파일을 분석하기 위한 샘플을 채취하기 위하여, 먼저 각 시간별로 토끼에서 0.5 ㎖의 혈액을 정맥에서 채취하였다. 채취한 혈액 샘플에서 혈장을 분리한 후, -60℃에서 냉동 보관하였다. 또한 각 시간별로 유리체액(0.2 ㎖) 및 안방수(0.2 ㎖)를 채취 후 -60℃에서 냉동 보관하였다.
하기 표 18은 수집된 토끼 샘플을 토끼 그룹, 개체별, 수득 시간별로 나타낸 것이다.
Group Animal Number Dose Route Sample and Tissue Collection Time Points(Days)
1 hr 24 hr 3 days 7 days 14 days
G01 RB1001, RB1002, RB1003 Intravitreal injection Vitreous humor, Aqueous humor, Plasma
G02 RB2001, RB2002, RB2003 Vitreous humor, Aqueous humor, Plasma
G03 RB3001, RB3002, RB3003 Vitreous humor, Aqueous humor, Plasma
G04 RB4001, RB4002, RB4003 Vitreous humor, Aqueous humor, Plasma
G05 RB5001, RB5002, RB5003 Vitreous humor, Aqueous humor, Plasma
효소면역분석법(ELISA)을 사용하여 혈장, 유리체액 및 안방수에서 C1.02의 농도를 측정하였다. 측정된 값들로 non-compartmental pharmacokinetic 분석을 수행하여 약물동태 파라미터들을 구하였다. 하기 표 19는 non-compartmental pharmacokinetic 분석으로 구한 약물동태 파라미터를 나타낸 것이다.
Matrix Aqueous humor Vitreous humor
PK parameters Mean Mean
Cmax(ng/mL) 103705 3204272
Tmax(h) 1.00 1.00
T1/2(h) 114 226
Tlast(h) 168 336
AUC0-last(ng.h/mL) 10206790 545028800
하기 표 20는 토끼에서 안구내 주사를 통한 2,500 ㎍의 C1.02 투여 후의 유리체액 내에서의 농도를 나타낸 그래프이다; RB#은 동물 번호, BQL은 below the quantifiable limit 및 ND는 not determined를 의미한다.
Time(h) RBn001* RBn002 RBn003 Mean SD CV(%)
n=1 1 2789070 3594376 3229369 3204272 403239 12.6
n=2 24 1561470 1336610 2160474 1686185 425856 25.3
n=3 72 1638252 2031203 2506814 2058756 434936 21.1
n=4 168 1659880 1767054 1783308 1736747 67064 3.86
n=5 336 1206629 1286796 317153 936859 538176 57.4
하기 표 21는 토끼에서 안구내 주사를 통한 2,500 ㎍의 C1.02 투여 후의 안방수 내에서의 농도를 나타낸 그래프이다; RB#은 동물 번호, BQL은 below the quantifiable limit 및 ND는 not determined를 의미한다.
Time(h) RBn001* RBn002 RBn003 Mean SD CV(%)
n=1 1 1542 4803 304769 103705 174135 168
n=2 24 84982 54751 85448 75061 17590 23.4
n=3 72 38192 78324 90493 69003 27368 39.7
n=4 168 30505 37937 29392 32612 4646 14.2
n=5 336 BQL** BQL BQL ND*** ND ND
하기 표 22는 토끼에서 안구내 주사를 통한 2,500 ㎍의 C1.02 투여 후의 혈장에서의 농도를 나타낸 그래프이다; RB#은 동물 번호, BQL은 below the quantifiable limit 및 ND는 not determined를 의미한다.
Time(h) RBn001* RBn002 RBn003 Mean SD CV(%)
n=1 1 BQL** BQL BQL ND*** ND ND
n=2 24 BQL BQL BQL ND ND ND
n=3 72 BQL BQL BQL ND ND ND
n=4 168 BQL BQL BQL ND ND ND
n=5 336 BQL BQL BQL ND ND ND
토끼에서 안구내 주사를 통한 2,500 ㎍의 C1.02 투여 후의 유리체액 및 안방수내에서의 C1.02의 농도를 확인하였다.
그 결과, 표 20 내지 표 22, 도 20a 및 도 20b에 나타낸 것과 같이, 2,500 μg의 C1.02를 안구 내 주사를 통해 투여하였을 때 유리체액 내에서의 반감기가 226시간, 그리고 안방수 내에서의 반감기가 114시간인 것을 확인하였다. 혈장 내에서는 유의미한 농도가 관찰되지 않아 약력학 프로파일 분석이 불가능하였다.

Claims (25)

  1. CRIg(Complement receptor of the immunoglobulin superfamily)의 세포외도메인 또는 이의 단편; 및 VEGF(Vascular endothelial growth factor)에 특이적으로 결합하는 단백질을 포함하는 융합단백질.
  2. 제1항에 있어서,
    CRIg의 세포외도메인 또는 이의 단편; 및 VEGF에 특이적으로 결합하는 단백질은 링커에 의해 결합된 것인, 융합단백질.
  3. 제2항에 있어서,
    상기 링커는 펩타이드 링커, 면역글로불린 단편 또는 이의 조합인 것인, 융합단백질.
  4. 제3항에 있어서,
    상기 면역글로불린 단편은 DANG 변이 또는 NG 변이를 포함하는 것인, 융합단백질.
  5. 제3항에 있어서,
    상기 면역글로불린 단편은 서열번호 6, 서열번호 11 또는 서열번호 76의 아미노산 서열을 포함하는 것인, 융합단백질.
  6. 제1항에 있어서,
    상기 VEGF에 특이적으로 결합하는 단백질은 VEGF에 특이적으로 결합하는 항체 또는 이의 단편; VEGF 수용체의 세포외도메인을 포함하는 것인, 융합단백질.
  7. 제6항에 있어서,
    상기 VEGF 수용체는 VEGF 수용체 1 또는 VEGF 수용체 2인 것인, 융합단백질.
  8. 제7항에 있어서,
    상기 VEGF 수용체의 세포외도메인은 서열번호 14의 아미노산 서열을 포함하는 것인, 융합단백질.
  9. 제1항에 있어서,
    상기 융합단백질은 하기 구조식(I) 또는(II)로 이루어진 것인, 융합단백질:
    N'-X-[링커(1)]n-Fc 도메인-[링커(2)]m-Y-C'(I)
    N'-Y-[링커(1)]n-Fc 도메인-[링커(2)]m-X-C'(II)
    이때, 상기 구조식(I) 및 (II)에 있어서,
    상기 N'은 융합단백질의 N-말단이고,
    상기 C'는 융합단백질의 C-말단이며,
    상기 X는 CRIg의 세포외도메인 또는 이의 단편이고,
    상기 Y는 VEGF에 특이적으로 결합하는 단백질이며,
    상기 링커(1) 및 링커(2)는 펩타이드 링커이고,
    상기 n 및 m은 각각 독립적으로, O 또는 1이다.
  10. 제9항에 있어서,
    상기 링커(1)이 서열번호 15 또는 서열번호 17의 아미노산 서열을 포함하는 것인, 융합단백질.
  11. 제9항에 있어서,
    상기 링커(2)이 서열번호 16 또는 서열번호 18의 아미노산 서열을 포함하는 것인, 융합단백질.
  12. 제9항에 있어서,
    상기 융합단백질은 구조식(I)인, 융합단백질.
  13. 제1항에 있어서,
    상기 융합단백질은 서열번호 2, 서열번호 4, 서열번호 8 및 서열번호 10으로 이루어지는 군에서 선택된 어느 하나인, 융합단백질.
  14. 제1항 내지 제13항 중 어느 한 항의 융합단백질 2개가 결합된 융합단백질 이량체.
  15. 제14항에 있어서,
    상기 융합단백질 이량체는 동형이량체(Homodimer)인 것인, 융합단백질 이량체.
  16. 제1항 내지 제13항 중 어느 한 항의 융합단백질을 코딩하는 폴리뉴클레오티드.
  17. 제16항에 있어서,
    상기 폴리뉴클레오티드는 서열번호 24, 서열번호 26, 서열번호 30 및 서열번호 32로 이루어지는 군에서 선택된 어느 하나인 것인, 폴리뉴클레오티드.
  18. 제16항의 폴리뉴클레오티드를 포함하는 벡터.
  19. 제18항의 벡터가 도입된 형질전환 세포.
  20. 제1항의 융합단백질; 또는 제14항의 융합단백질 이량체를 유효성분으로 포함하는 안질환 치료 또는 예방용 약학 조성물.
  21. 제20항에 있어서,
    상기 안질환은 노화-관련 황반 변성(AMD), 지도모양 위축증(GA), 맥락막 혈관신생(CNV), 포도막염, 당뇨병성 및 다른 허혈-관련 망막증, 당뇨병성 황반 부종, 병리적 근시, 폰 힙펠-린다우병, 눈의 히스토플라스마증, 망막 중심 정맥 폐색(CRVO), 각막 혈관신생 및 망막 혈관신생으로 구성된 군에서 선택된 어느 하나인 것인, 안질환 치료 또는 예방용 약학 조성물.
  22. 제20항에 있어서,
    상기 약학 조성물은 약제학적으로 허용가능한 담체를 추가적으로 포함하는 것인, 안질환 치료 또는 예방용 약학 조성물.
  23. 안질환을 치료하기 위한 CRIg의 세포외도메인 또는 이의 단편; 및 VEGF에 특이적으로 결합하는 단백질을 포함하는 융합단백질 또는 이의 이량체의 용도.
  24. 안질환 치료 또는 예방용 약제를 제조하기 위한 CRIg의 세포외도메인 또는 이의 단편; 및 VEGF에 특이적으로 결합하는 단백질을 포함하는 융합단백질 또는 이의 이량체의 용도.
  25. CRIg의 세포외도메인 또는 이의 단편; 및 VEGF에 특이적으로 결합하는 단백질을 포함하는 융합단백질 또는 이의 이량체를 개체에 투여하는 단계를 포함하는 안질환을 치료 및/또는 예방하는 방법.
PCT/KR2021/008681 2020-07-07 2021-07-07 보체 경로 억제제 및 혈관신생 억제제를 포함하는 융합단백질 및 이의 용도 WO2022010271A1 (ko)

Priority Applications (6)

Application Number Priority Date Filing Date Title
US18/004,613 US20230242633A1 (en) 2020-07-07 2021-07-07 Fusion protein including complement pathway inhibitor and angiogenesis inhibitor and use thereof
CN202180053141.8A CN116234822A (zh) 2020-07-07 2021-07-07 一种包括补体途径抑制剂和血管生成抑制剂的融合蛋白及其用途
AU2021304993A AU2021304993B2 (en) 2020-07-07 2021-07-07 Fusion protein including complement pathway inhibitor and angiogenesis inhibitor and use thereof
CA3189030A CA3189030A1 (en) 2020-07-07 2021-07-07 Fusion protein including complement pathway inhibitor and angiogenesis inhibitor and use thereof
EP21838564.9A EP4180453A4 (en) 2020-07-07 2021-07-07 FUSION PROTEIN WITH COMPLEMENT PATHWAY INHIBITOR AND ANGIOGENESIS INHIBITOR AND USE THEREOF
JP2023501223A JP2023533038A (ja) 2020-07-07 2021-07-07 補体経路阻害剤及び血管新生阻害剤を含む融合タンパク質並びにその使用

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR10-2020-0083536 2020-07-07
KR20200083536 2020-07-07

Publications (1)

Publication Number Publication Date
WO2022010271A1 true WO2022010271A1 (ko) 2022-01-13

Family

ID=79343023

Family Applications (2)

Application Number Title Priority Date Filing Date
PCT/KR2021/008681 WO2022010271A1 (ko) 2020-07-07 2021-07-07 보체 경로 억제제 및 혈관신생 억제제를 포함하는 융합단백질 및 이의 용도
PCT/KR2021/008683 WO2022010273A1 (ko) 2020-07-07 2021-07-07 보체 경로 억제제를 포함하는 융합단백질 및 이의 용도

Family Applications After (1)

Application Number Title Priority Date Filing Date
PCT/KR2021/008683 WO2022010273A1 (ko) 2020-07-07 2021-07-07 보체 경로 억제제를 포함하는 융합단백질 및 이의 용도

Country Status (9)

Country Link
US (1) US20230242633A1 (ko)
EP (1) EP4180453A4 (ko)
JP (1) JP2023533038A (ko)
KR (2) KR20220006010A (ko)
CN (1) CN116234822A (ko)
AU (1) AU2021304993B2 (ko)
CA (1) CA3189030A1 (ko)
TW (1) TW202216755A (ko)
WO (2) WO2022010271A1 (ko)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2024114641A1 (en) * 2022-11-28 2024-06-06 Shenzhen Oculgen Biomedical Technology Co., Ltd C5/vegf bispecific binding molecules

Citations (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2006042329A2 (en) * 2004-10-12 2006-04-20 Genentech, Inc. Crig polypeptide for prevention and treatment of complement-associated disorders
JP2007536964A (ja) 2004-05-11 2007-12-20 ライジョキ−プスカ、リトバ 仮想風景を表示するための方法と装置
US8268314B2 (en) 2008-10-08 2012-09-18 Hoffmann-La Roche Inc. Bispecific anti-VEGF/anti-ANG-2 antibodies
KR20130130732A (ko) * 2010-11-01 2013-12-02 제넨테크, 인크. 다유전자 스코어를 이용한 진행성 노인성 황반 변성으로의 진행 예측
US20140294837A1 (en) * 2013-03-28 2014-10-02 Samsung Electronics Co., Ltd. Fusion protein comprising anti-c-met antibody and vegf-binding fragment
US9527925B2 (en) 2011-04-01 2016-12-27 Boehringer Ingelheim International Gmbh Bispecific binding molecules binding to VEGF and ANG2
US20180312819A1 (en) * 2011-12-01 2018-11-01 Ap Biosciences, Inc. Protein inhibitors to complement and vegf pathways and methods of use thereof
US20190167790A1 (en) 2017-12-05 2019-06-06 Abbvie Biotherapeutics Inc. Abt-165 in combination with folinic acid, 5-fluorouracil, and irinotecan for the treatment of cancers
KR20190138636A (ko) * 2017-03-22 2019-12-13 제넨테크, 인크. 안구 장애의 치료를 위한 최적화된 항체 조성물

Family Cites Families (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8007798B2 (en) * 1997-11-21 2011-08-30 Genentech, Inc. Treatment of complement-associated disorders
JP4897690B2 (ja) * 2004-10-12 2012-03-14 ジェネンテック， インコーポレイテッド 補体関連障害の予防および処置のためのＣＲＩｇポリペプチド
CN104231085B (zh) * 2013-09-05 2017-03-15 复旦大学附属肿瘤医院 靶向特异性补体系统抑制剂、其制备方法及应用
US20190071477A1 (en) * 2015-12-31 2019-03-07 Quassia Biopharma Co., Ltd Recombinant complement Factor H-immunoglobulin fusion protein with complement regulatory activity, and preparation method therefor and use thereof

Patent Citations (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2007536964A (ja) 2004-05-11 2007-12-20 ライジョキ−プスカ、リトバ 仮想風景を表示するための方法と装置
WO2006042329A2 (en) * 2004-10-12 2006-04-20 Genentech, Inc. Crig polypeptide for prevention and treatment of complement-associated disorders
US8268314B2 (en) 2008-10-08 2012-09-18 Hoffmann-La Roche Inc. Bispecific anti-VEGF/anti-ANG-2 antibodies
KR20130130732A (ko) * 2010-11-01 2013-12-02 제넨테크, 인크. 다유전자 스코어를 이용한 진행성 노인성 황반 변성으로의 진행 예측
US9527925B2 (en) 2011-04-01 2016-12-27 Boehringer Ingelheim International Gmbh Bispecific binding molecules binding to VEGF and ANG2
US20180312819A1 (en) * 2011-12-01 2018-11-01 Ap Biosciences, Inc. Protein inhibitors to complement and vegf pathways and methods of use thereof
US20140294837A1 (en) * 2013-03-28 2014-10-02 Samsung Electronics Co., Ltd. Fusion protein comprising anti-c-met antibody and vegf-binding fragment
KR20190138636A (ko) * 2017-03-22 2019-12-13 제넨테크, 인크. 안구 장애의 치료를 위한 최적화된 항체 조성물
US20190167790A1 (en) 2017-12-05 2019-06-06 Abbvie Biotherapeutics Inc. Abt-165 in combination with folinic acid, 5-fluorouracil, and irinotecan for the treatment of cancers

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
"Remington's Pharmaceutical Sciences", 1995
See also references of EP4180453A4

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2024114641A1 (en) * 2022-11-28 2024-06-06 Shenzhen Oculgen Biomedical Technology Co., Ltd C5/vegf bispecific binding molecules

Also Published As

Publication number Publication date
CN116234822A (zh) 2023-06-06
CA3189030A1 (en) 2022-01-13
EP4180453A4 (en) 2023-12-27
KR20220006010A (ko) 2022-01-14
KR20220006013A (ko) 2022-01-14
AU2021304993B2 (en) 2024-05-09
JP2023533038A (ja) 2023-08-01
AU2021304993A1 (en) 2023-02-23
WO2022010273A1 (ko) 2022-01-13
EP4180453A1 (en) 2023-05-17
US20230242633A1 (en) 2023-08-03
TW202216755A (zh) 2022-05-01

Similar Documents

Publication Publication Date Title
WO2020060122A1 (ko) Il-2 단백질 및 cd80 단백질을 포함하는 융합단백질 및 이의 용도
WO2019225787A1 (ko) 항-b7-h3 항체 및 그 용도
WO2015058573A1 (zh) 拮抗抑制程序性死亡受体pd-1与其配体结合的单克隆抗体及其编码序列与用途
WO2019004799A1 (ko) Vegf-grab 단백질과 약물의 결합체 및 이의 용도
WO2014090053A1 (zh) 拮抗抑制血管内皮细胞生长因子与其受体结合的单克隆抗体及其编码序列与用途
WO2016137108A1 (en) Novel antibody binding to tfpi and composition comprising the same
WO2012165925A2 (ko) Hgf 활성을 가지는 c-met에 대한 인간항체 및 이의 용도
WO2019164219A1 (en) Anti-angiopoietin-2 antibodies and uses thereof
WO2021071319A1 (ko) 다중 특이적 융합 단백질 및 이의 용도
WO2022010271A1 (ko) 보체 경로 억제제 및 혈관신생 억제제를 포함하는 융합단백질 및 이의 용도
EP3755714A1 (en) Anti-angiopoietin-2 antibodies and uses thereof
WO2020101365A1 (ko) 안정성이 향상된 항 c-met 항체 또는 그의 항원 결합 단편
WO2019045477A1 (ko) 비멘틴 유래 펩타이드에 특이적으로 결합하는 물질을 포함하는 피부질환 예방 및 치료용 조성물
WO2022035200A1 (ko) Il-12 및 항-cd20 항체를 포함하는 융합단백질 및 이의 용도
WO2019132579A2 (ko) 세포질 침투 항체에 융합된 rna 분해효소를 포함하는 면역독소
WO2019235856A1 (ko) Tie2에 결합하는 항체 및 이의 용도
WO2023132547A1 (ko) 혈관신생 억제제가 결합된 항-c3b 항체 또는 항-c5 항체 및 이의 용도
WO2022235140A1 (ko) 단일사슬항체조각 및 페리틴의 융합단백질을 포함하는 나노입자 및 이의 용도
WO2023224429A1 (ko) Light 단백질 및 항-fap 항체를 포함하는 융합단백질 및 이의 용도
WO2020138868A1 (ko) 타입 1 인터페론 중화 fc-융합 단백질 및 이의 용도
WO2022045865A1 (ko) 항-ｖｅｇｆ 육량체 항체, 및 이를 포함하는 조성물
WO2019088658A1 (ko) Scf 및 갈렉틴-1을 표적으로 하는 이중표적항체 및 그 용도
WO2022169269A1 (ko) 항 ctla-4 항체 및 이의 용도
WO2023048516A1 (ko) Pd-1 및 il-21을 포함하는 융합단백질 이량체 및 이의 용도
WO2023249425A1 (ko) 항-cd73 항체 및 il-2를 포함하는 융합단백질 및 이의 용도

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21838564

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2023501223

Country of ref document: JP

Kind code of ref document: A

Ref document number: 3189030

Country of ref document: CA

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021838564

Country of ref document: EP

Effective date: 20230207

ENP Entry into the national phase

Ref document number: 2021304993

Country of ref document: AU

Date of ref document: 20210707

Kind code of ref document: A