WO2021186056A1 - Chimeric antigen receptor specific for human cd45rc and uses thereof - Google Patents

Chimeric antigen receptor specific for human cd45rc and uses thereof Download PDF

Info

Publication number
WO2021186056A1
WO2021186056A1 PCT/EP2021/057132 EP2021057132W WO2021186056A1 WO 2021186056 A1 WO2021186056 A1 WO 2021186056A1 EP 2021057132 W EP2021057132 W EP 2021057132W WO 2021186056 A1 WO2021186056 A1 WO 2021186056A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
lcvr
hcvr
antibody
binding fragment
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2021/057132
Other languages
English (en)
French (fr)
Inventor
Carole GUILLONNEAU
Ignacio ANEGON
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Institut National de la Sante et de la Recherche Medicale INSERM
Nantes Université
Original Assignee
Universite de Nantes
Institut National de la Sante et de la Recherche Medicale INSERM
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Universite de Nantes, Institut National de la Sante et de la Recherche Medicale INSERM filed Critical Universite de Nantes
Priority to CA3172120A priority Critical patent/CA3172120A1/en
Priority to CN202180036571.9A priority patent/CN115916823A/zh
Priority to IL296546A priority patent/IL296546A/en
Priority to JP2022555951A priority patent/JP7796034B2/ja
Priority to AU2021237790A priority patent/AU2021237790A1/en
Priority to EP21712190.4A priority patent/EP4121457A1/en
Priority to KR1020227036234A priority patent/KR20230004510A/ko
Priority to MX2022011683A priority patent/MX2022011683A/es
Priority to US17/912,726 priority patent/US20230147657A1/en
Priority to BR112022018795A priority patent/BR112022018795A2/pt
Publication of WO2021186056A1 publication Critical patent/WO2021186056A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/289Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD45
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/11T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/31Chimeric antigen receptors [CAR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/421Immunoglobulin superfamily
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/7051T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70521CD28, CD152
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/46Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
    • A61K2239/48Blood cells, e.g. leukemia or lymphoma
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/33Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies

Definitions

  • the present invention relates to the field of immunotherapy.
  • the present invention relates to a chimeric antigen receptor (CAR) specific for-human CD45RC, to T cells expressing said CAR and to the use thereof as a medicament, in particular for preventing or treating CDdSRC ⁇ -related diseases (including autoimmune diseases, undesired immune responses, monogenic diseases, lymphoma or cancer), or graft-versus- host disease (GVHD).
  • CDdSRC ⁇ -related diseases including autoimmune diseases, undesired immune responses, monogenic diseases, lymphoma or cancer
  • GVHD graft-versus- host disease
  • CD45 also known as leukocyte common antigen (LCA), EC3.1.3.48, T200, Ly5, and PTPRC) constitutes the first and prototypic receptor-like protein tyrosine phosphatase (RPTP). Its expression is restricted to all nucleated hematopoietic cells, where it is one of the most abundant cell surface glycoproteins, constituting almost 10 percent of the cell surface, and estimated to be present at approximately 25 mM in the plasma membrane (Trowbridge & Thomas, 1994. Annu Rev Immunol. 12:85-116; Hermiston et al, 2003. Annu Rev Immunol. 21:107-37; Holmes, 2006. Immunology. 117(2):145-55).
  • RPTP prototypic receptor-like protein tyrosine phosphatase
  • CD45 comprises an extracellular domain, a single transmembrane domain and a large cytoplasmic domain.
  • the transmembrane and cytoplasmic domains are highly conserved amongst species.
  • the cytoplasmic domain of CD45 comprises two tandemly duplicated phosphatase domains, of which only the membrane-proximal domain has enzymatic activity (Desai et al, 1994. EMBO J. 13(17):4002-10).
  • the function of the more C -terminal second phosphatase domain in CD45 remains uncertain although it is suggested that it may contribute to CD45 activity indirectly by stabilizing the first domain.
  • CD45 functions as a central regulator of phosphotyrosine levels in hematopoietic cells, by modulating the activity of Src family of tyrosine-protein kinases (such as Lck in T cells; or Lyn, Fyn and Lck in B cells) (Palacios & Weiss, 2004. Oncogene. 23(48):7990-8000; Lowell, 2004. Mol Immunol.
  • Src family of tyrosine-protein kinases such as Lck in T cells; or Lyn, Fyn and Lck in B cells
  • the extracellular domain of CD45 shows a higher polymorphism among different leukocyte lineages. Indeed, this extracellular domain is heavily glycosylated and contains three alternatively spliced exons (4, 5, and 6 - which encode the A, B and C determinants, respectively) that are both O-linked glycosylated and sialylated (Hermiston et al., 2003. Annu Rev Immunol. 21:107-37; Holmes, 2006. Immunology. 117(2): 145-55).
  • CD45 isoforms differing in size, shape, and charge can therefore be generated by a dynamically-controlled alternative splicing in both leukocyte differentiation and cellular activation, leading to changes in the extracellular domain of the molecule (Hall etal., 1988. J Immunol. 141(8):2781-7; Lynch, 2004. Nat Rev Immunol. 4(12):931-40).
  • CD45RABC The largest CD45 isoform containing all three alternatively spliced exons, CD45RABC, is approximately 235 kDa, while the smallest isoform lacking all three exons, CD45RO, is approximately 180 kDa.
  • isoforms comprising only two (e.g. , CD45RAB, CD45RBC) or only one (e.g, CD45RB) of the three exons are possible.
  • CD45RA is present on peripheral naive mature CD4 T cells
  • CD45RO is expressed on activated and memory CD4 + T cells.
  • CD45RABC is expressed on B cells and their precursors, on a sub-group of dendritic cells and other antigen-presenting cells.
  • TEMRA Effector memory RA T cells
  • CD45RA naive T cell marker
  • CD45RC isoform
  • CD4 and CD8 + T cells 0O45II£ Me ⁇ 1 are potent T h l effector cells capable of promoting transplant rejection and organ inflammation (Spickett et al. , 1983. J Exp Med. 158(3):795-810; Xystrakis et al. , 2004. Eur J Immunol.
  • T cells expressing undetectable or low levels of CD45RC are T h 2 and regulatory T cells and inhibit allograft rejection, graft-versus-host disease (GVHD) and cell-mediated autoimmune diseases (Xystrakis et al. , 2004. Blood. 104(10):3294-30; Guillonneau etal., 2007. J Clin Invest. 117(4): 1096-106; Powrie & Mason, 1990. J Exp Med. 172(6): 1701- 8).
  • GVHD graft-versus-host disease
  • J Clin Invest. 117(4): 1096-106; Powrie & Mason, 1990. J Exp Med. 172(6): 1701- 8 In humans, a high proportion of CD45RC + CD8 + T cells before transplantation has been correlated with decreased graft survival in kidney transplanted patients (Ordonez et
  • GVHD transplant rejection
  • autoimmune diseases in particular transplant rejection (in particular GVHD) and autoimmune diseases.
  • GVHD is a significant cause of morbidity and mortality in stem cell transplant patients. It is a T cell-mediated immunoreactive process in which donor cells react against recipient cells.
  • immunosuppression with immunomodulating drugs such as corticosteroids are the mainstay of GVHD prevention.
  • CD45RC lugh T cells may represent a potential new therapy in preventing or reducing transplant rejection by decreasing aggressive effector T cells, while increasing tolerogenic regulatory T cells.
  • transient anti-CD45RC mAh treatment triggers rapid CDdSRC 1 ” 811 T cell apoptosis, while preserving memory immunity.
  • short term anti-CD45RC antibody treatment results in permanent allograft survival with no signs of chronic rejection (International patent WO2016016442; Picarda et al, 2017. JCI Insight. 2(3):e90088).
  • the Inventors have developed a chimeric antigen receptor (CAR) comprising an antigen-binding fragment directed against human CD45RC.
  • This antigen-binding fragment competes with the anti -hum an CD45RC antibodies currently available on the market (such as the MT2 clone), exhibiting a comparable pattern of reactivity, however with a significantly better cytotoxic activity to T cells and at a lowest concentration.
  • the anti-hCD45RC antigen-binding fragment according to the present invention shows a better affinity than other antigen-binding fragments currently available, and thereby have better therapeutic effects.
  • the CAR according to the invention may also be useful in the prevention or treatment of certain monogenic diseases in which immune responses are involved in the pathology.
  • Monogenic diseases are caused by single-gene defects. Over 4000 human diseases are caused by these defects linked to one particular gene.
  • Gene therapy is the main hope for durable treatments of this type of diseases.
  • major obstacles have been encountered during the development of techniques for the delivery of genes to the appropriate cells affected by the disorder as well as the fact that immune responses against the transgene product or the vector limit the therapeutic efficacy.
  • monogenic diseases some are linked to genes involved in the immune system (such as T and/or B cells primary immunodeficiencies and polyendocrinopathy candidiasis-ectodermal dystrophy [APECED]), or to genes not associated with immune functions but whose deficiency is associated with inflammation and/or immune reactions [such as Duchenne muscular dystrophy (DMD)].
  • T and/or B cells primary immunodeficiencies and polyendocrinopathy candidiasis-ectodermal dystrophy [APECED]
  • APECED polyendocrinopathy candidiasis-ectodermal dystrophy
  • DMD Duchenne muscular dystrophy
  • APECED also known as auto-immune polyglandular syndrome type I (APS 1) is a rare multi-organ autosomal recessive auto-immune disease caused by mutations in the AIRE gene, a transcription regulator that allows the expression of tissue-restricted antigens (TRA) in medullary epithelial thymic cells (mTECs) and auto-reactive T cells deletion.
  • TRA tissue-restricted antigens
  • mTECs medullary epithelial thymic cells
  • APECED also known as auto-immune polyglandular syndrome type I
  • the clinical phenotype of APECED is usually defined by the presence of 2 of the 3 major symptoms: hypoparathyroidism, adrenal insufficiency (Addison’s disease) and chronical muco-cutaneous candidiasis (CMC).
  • This disease is also associated with multiple autoimmune and ectodermal features such as type 1 diabetes, enamel hypoplasia, vitiligo, premature ovarian failure, keratitis, pernicious anemia, alopecia, exocrine pancreatitis, interstitial lung disease, nephritis and other disorders.
  • DMD is a monogenic disease wherein mutations of the DMD gene coding for the protein dystrophin lead to severe X-linked muscular dystrophy, which affects all voluntary muscles as well as the heart and breathing muscles in later stages. Immune responses are involved in the pathophysiology of disease in both DMD patients and mdx mice (for a review, see Rosenberg et al, 2015. Sci Transl Med. 7(299) :299rv4).
  • the standard treatments of DMD are corticoids, such as prednisolone.
  • the CAR according to the present invention represents therefore a promising approach for preventing and/or treating monogenic diseases such as DMD and APECED.
  • the Inventors have also demonstrated that immune cells could be engineered to express a transduced CD45RC-CAR at their cell surface.
  • the inventors have also shown that cells transduced with a CD45RC-CAR induced apoptosis in human T cells, and could be activated after contact with human T cells.
  • the invention relates to a chimeric antigen receptor (CAR) specific for human CD45RC, wherein said CAR comprises:
  • intracellular domain comprises at least one T cell primary signaling domain and optionally at least one T cell costimulatory signaling domain.
  • the extracellular binding domain comprises at least one antigen binding fragment that binds to human CD45RC comprising:
  • V H -CDR1 of sequence SEQ ID NO: 1
  • V H -CDR2 with a sequence selected from the group comprising sequences SEQ ID NOs: 4, 5, 6, 8, 100, 116, 117, 118 and 119
  • V H -CDR3 of sequence SEQ ID NO: 3;
  • V L -CDR1 with a sequence selected from the group comprising sequences SEQ ID NO: 15 (SASSSVS-X12-YMH) and 18 (RAS S S VS-X12- YMH), wherein X 12 is absent or is selected from Asn (N), Ser (S) and Gly (G);
  • V L -CDR2 with a sequence selected from the group comprising sequences SEQ ID NO: 16, 111, and 120;
  • the extracellular binding domain comprises at least one antigen-binding fragment that binds to human CD45RC comprising:
  • V H -CDR2 with a sequence selected from the group comprising sequences SEQ ID NOs: 4 and 5;
  • the extracellular binding domain comprises at least one antigen-binding fragment that binds to human CD45RC comprising:
  • the extracellular binding domain comprises at least one antigen-binding fragment that binds to human CD45RC comprising:
  • HCVR which comprises the following three CDRs: (i) V H -CDR1 of sequence SEQ ID NO: 1;
  • V H -CDR2 with a sequence selected from the group comprising sequences SEQ ID NOs: 4, 6, and 100;
  • LCVR which comprises the following three CDRs: (i) Y L -CDR1 with a sequence selected from the group comprising sequences SEQ ID NOs: 15 and 18, wherein Xn is absent;
  • V L -CDR2 with a sequence selected from the group comprising sequences SEQ ID NO: 16, 111, and 120; and (iii) V L -CDR3 of sequence SEQ ID NO: 17.
  • the extracellular binding domain comprises at least one antigen-binding fragment that binds to human CD45RC comprising:
  • the extracellular binding domain comprises at least one antigen-binding fragment that binds to human CD45RC comprising: (a) a HCVR which comprises the following three CDRs:
  • V H -CDR2 with a sequence selected from the group comprising sequences SEQ ID NOs: 4, 5, 6, 8, 100, 116, 117, 118 and 119;
  • V L -CDR1 with a sequence selected from the group comprising sequences SEQ ID NOs: 15 and 18, wherein Xu in SEQ ID NOs: 15 and 18 is selected from Asn (N), Ser (S) and Gly (G);
  • the extracellular binding domain comprises an scFv fragment directed against human CD45RC.
  • the hinge domain is a hinge region of human CD 8 a, preferably having the sequence of SEQ ID NO: 145 or a sequence having at least 70% identity thereto.
  • the transmembrane domain is a transmembrane domain derived from the human CD 8 a, preferably having the sequence of SEQ ID NO: 153 or a sequence having at least 70% identity thereto.
  • the primary intracellular signaling domain comprises a T cell primary intracellular signaling domain of human CD3 zeta, preferably having the sequence of SEQ ID NO: 157 or a sequence having at least 70% identity thereto.
  • the costimulatory signaling domain is selected from the group consisting of a CD28 cytoplasmic signaling domain, a 4-1BB cytoplasmic signaling domain, a 0X40 cytoplasmic signaling domain, a ICOS cytoplasmic signaling domain, a CD27 cytoplasmic signaling domain and a DAP10 cytoplasmic signaling domain.
  • the CAR according to the invention comprises:
  • an anti -human CD45RC scFv preferably comprising a HCVR having the sequence of SEQ ID NO: 61 and a LCVR having the sequence of SEQ ID NO: 81, preferably linked by a linker having the sequence of SEQ ID NO: 134,
  • a hinge domain derived from CD 8 a preferably having the sequence of SEQ ID NO: 145,
  • a human CD8a transmembrane domain preferably having the sequence of SEQ ID NO: 153
  • an intracellular signaling domain comprising a human CD28 signaling domain, preferably having the sequence of SEQ ID NO: 167 and a human CD3 zeta signaling domain, preferably having the sequence of SEQ ID NO: 157.
  • the invention also relates to a nucleic acid encoding the CAR according to the invention.
  • the invention also pertains to an expression vector comprising the nucleic acid according to the invention.
  • the invention further relates to an immune cell population, engineered to express at the cell surface a CAR according to the invention.
  • said immune cell population is a CD45RC neg cell population.
  • said immune cell population is a regulatory T cell population, an effector T cell population, a memory T cell population, an NKT cell population or a MAIT cell population.
  • said immune cell population is a regulatory T cell population, preferably wherein said regulatory T cell population is selected from the group consisting of CD4 + CD25 + Foxp3 + Treg, Trl cells, TGF-b secreting Th3 cells, regulatory NKT cells, regulatory gd T cells, regulatory CD8 + T cells, and double negative regulatory T cells.
  • the invention also relates to a composition
  • a composition comprising at least one immune cell population engineered to express at the cell surface a CAR according to the invention, wherein said composition is preferably a pharmaceutical composition further comprising at least one pharmaceutically acceptable excipient or carrier.
  • the invention further relates to an immune cell population according to the invention, or the pharmaceutical composition according the invention, for use as a medicament.
  • the invention also pertains to an immune cell population according to the invention, or a composition according to the invention, for use in inducing immune tolerance, in preventing or reducing transplant rejection, or in preventing or treating graft-versus-host disease (GVHD) in a subject in need thereof.
  • GVHD graft-versus-host disease
  • the invention further relates to an immune cell population according to the invention, or a composition according to the invention for use in preventing, reducing and/or treating a CD45RC Msll -rel ated condition selected from the group consisting of an autoimmune disease, an undesired immune response, a monogenic disease, lymphoma and cancer.
  • immunoglobulin refers to a protein having a combination of two heavy and two light chains whether or not it possesses any relevant specific immunoreactivity .
  • Antibodies refers to such assemblies which have significant known specific immunoreactive activity to an antigen of interest (e.g ., human CD45RC).
  • anti-hCD45RC antibodies is used herein to refer to antibodies which exhibit immunological specificity for human CD45RC protein.
  • specificity for human CD45RC does not exclude cross-reaction with species homologues of hCD45RC.
  • Antibodies and immunoglobulins comprise light and heavy chains, with or without an interchain covalent linkage between them.
  • Basic immunoglobulin structures in vertebrate systems are relatively well understood.
  • the generic term “immunoglobulin” comprises five distinct classes of antibody that can be distinguished biochemically. Although the following discussion will generally be directed to the IgG class of immunoglobulin molecules, all five classes of antibodies are within the scope of the present invention.
  • immunoglobulins comprise two identical light polypeptide chains of molecular weight of about 23 kDa, and two identical heavy chains of molecular weight of about 53-70 kDa.
  • the four chains are joined by disulfide bonds in a “Y” configuration wherein the light chains bracket the heavy chains starting at the mouth of the “Y” and continuing through the variable region.
  • the light chains of an antibody are classified as either kappa (K) or lambda (l).
  • K kappa
  • l lambda
  • Each heavy chain class may be bonded with either a k or l light chain.
  • the light and heavy chains are covalently bonded to each other, and the “tail” regions of the two heavy chains are bonded to each other by covalent disulfide linkages or non-covalent linkages when the immunoglobulins are generated either by hybridomas, B cells or genetically engineered host cells.
  • heavy chains In the heavy chain, the amino acid sequences run from an N-terminus at the forked ends of the Y configuration to the C -terminus at the bottom of each chain.
  • heavy chains are classified as gamma (g), mu (m), alpha (a), delta (d) or epsilon (e) with some subclasses among them (e.g. , g1-g4). It is the nature of this chain that determines the “class” of the antibody as IgG, IgM, IgA IgD or IgE, respectively.
  • variable region of an antibody allows the antibody to selectively recognize and specifically bind epitopes on antigens. That is, the light chain variable domain (V L domain) and heavy chain variable domain (V H domain) of an antibody combine to form the variable region that defines a three-dimensional antigen binding site.
  • V L domain light chain variable domain
  • V H domain heavy chain variable domain
  • This quaternary antibody structure forms the antigen binding site presents at the end of each arm of the “Y”. More specifically, the antigen binding site is defined by three complementarity determining regions (CDRs) on each of the V H and V L chains.
  • antibody fragment refers to at least one portion of an intact antibody, preferably the antigen binding region or variable region of the intact antibody, that retains the ability to specifically interact with (e.g, by binding, steric hindrance, stabilizing/destabilizing, spatial distribution) an epitope of an antigen.
  • antibody fragments include, but are not limited to, Fab, Fab', F(ab') 2 , Fv fragments, scFv antibody fragments, disulfide-linked Fvs (sdFv), a Fd fragment consisting of the VH and CHI domains, linear antibodies, single domain antibodies such as sdAb (either VL or VH), camelid VHH domains, multi -specific antibodies formed from antibody fragments such as a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region, and an isolated CDR or other epitope binding fragments of an antibody.
  • An antigen binding fragment can also be incorporated into single domain antibodies, maxibodies, minibodies, nanobodies, intrabodies, diabodies, triabodies, tetrabodies, a v- NAR and a bis-scFv (see, e.g, Hollinger and Hudson, Nature Biotechnology 23:1126- 1136, 2005).
  • Antigen binding fragments can also be grafted into scaffolds based on polypeptides such as a fibronectin type III (see U.S. Patent No. 6,703,199, which describes fibronectin polypeptide minibodies). Papain digestion of antibodies produces two identical antigen-binding fragments, called “Fab” fragments, and a residual “Fc” fragment, a designation reflecting the ability to crystallize readily.
  • the Fab fragment consists of an entire L chain along with the variable region domain of the H chain (VH), and the first constant domain of one heavy chain (CHI).
  • VH variable region domain
  • CHI first constant domain of one heavy chain
  • Each Fab fragment is monovalent with respect to antigen binding, i.e., it has a single antigen-binding site.
  • Pepsin treatment of an antibody yields a single large F(ab') 2 fragment that roughly corresponds to two disulfide linked Fab fragments having divalent antigen-binding activity and is still capable of crosslinking antigen.
  • Fab' fragments differ from Fab fragments by having additional few residues at the carboxy terminus of the CHI domain including one or more cysteines from the antibody hinge region.
  • Fab'-SH is the designation herein for Fab' in which the cysteine residue(s) of the constant domains bear a free thiol group.
  • F(ab') 2 antibody fragments originally were produced as pairs of Fab' fragments that have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
  • binding fragment refers to a part or region of the antibody according to the present invention, which comprises fewer amino acid residues than the whole antibody.
  • a “binding fragment” binds antigen and/or competes with the whole antibody from which it was derived for antigen binding (e.g, specific binding to human CD45RC).
  • Antibody binding fragments encompasses, without any limitation, single chain antibodies, Fv, Fab, Fab', Fab'-SFI, F(ab)’2, Fd, defucosylated antibodies, diabodies, triabodies and tetrabodies.
  • Constant amino acid modifications refers to modifications that do not significantly affect or alter the binding characteristics of the antibody or binding fragment thereof containing the amino acid sequence. Such conservative modifications include amino acid substitutions, additions and deletions. Modifications can be introduced into an antibody or binding fragment thereof by standard techniques known in the art, such as site-directed mutagenesis and PCR-mediated mutagenesis.
  • variable region and CDR sequences may comprise 1, 2, 3, 4, 5, 6, 7,
  • amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g. , lysine, arginine, histidine), acidic side chains (e.g, aspartic acid, glutamic acid), uncharged polar side chains (e.g. , glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan), nonpolar side chains (e.g.
  • b-branched side chains e.g. , threonine, valine, isoleucine
  • aromatic side chains e.g, tyrosine, phenylalanine, tryptophan, histidine.
  • a string of amino acids within the CDRs and/or variable regions of the antibody or binding fragment thereof according to the present invention can be replaced with a structurally similar string that differs in order and/or composition of side chain family members.
  • CDR or “complementarity determining region”
  • CDR complementarity determining region
  • engineered or “modified” refers to a cell that has been transfected, transformed or transduced “Epitope”
  • epitope refers to a specific arrangement of amino acids located on a protein or proteins to which an antibody or binding fragment thereof binds.
  • Epitopes often consist of a chemically active surface grouping of molecules such as amino acids or sugar side chains, and have specific three-dimensional structural characteristics as well as specific charge characteristics.
  • Epitopes can be linear (or sequential) or conformational, i.e ., involving two or more sequences of amino acids in various regions of the antigen that may not necessarily be contiguous.
  • fragment of an antigen refers to any subset of an antigen, as a shorter peptide.
  • a fragment of an antigen is a peptide of at least 6 amino acids in length.
  • a fragment of an antigen is a peptide of 6 to 50 amino acids in length, of 6 to 30 amino acids, or of 6 to 20 amino acids in length. “Framework region” or “FR” or “non-CDR regions”
  • variable region As used herein, the terms “framework region”, “FR” or “non-CDR regions” include the amino acid residues that are part of the variable region, but are not part of the CDRs ( e.g ., using the Kabat/Chothia definition of CDRs). Therefore, a variable region framework is between about 100-120 amino acids in length but includes only those amino acids outside of the CDRs.
  • - FR1 may correspond to the domain of the variable region encompassing amino acids 1-25 according to Chothia/AbM's definition, or 5 residues later according to Rabat's definition;
  • - FR2 may correspond to the domain of the variable region encompassing amino acids 36-49;
  • - FR3 may correspond to the domain of the variable region encompassing amino acids 67-98;
  • - FR4 may correspond to the domain of the variable region from amino acids 104-110 to the end of the variable region.
  • the framework regions for the light chain are similarly separated by each of the LCVR’s CDRs.
  • the six CDRs present on each monomeric antibody are short, non-contiguous sequences of amino acids that are specifically positioned to form the antigen binding site as the antibody assumes its three-dimensional configuration in an aqueous environment.
  • the remainders of the heavy and light variable domains show less inter-molecular variability in amino acid sequence and are termed the framework regions.
  • the framework regions largely adopt a b- sheet conformation and the CDRs form loops which connect, and in some cases form part of, the b-sheet structure. Thus, these framework regions act to form a scaffold that provides for positioning the six CDRs in correct orientation by inter-chain, non-covalent interactions.
  • the antigen binding site formed by the positioned CDRs defines a surface complementary to the epitope on the immunoreactive antigen. This complementary surface promotes the non- covalent binding of the antibody to the immunoreactive antigen epitope.
  • the position of CDRs can be readily identified by one of ordinary skill in the art. “Heavy chain region”
  • the term “heavy chain region” includes amino acid sequences derived from the constant domains of an immunoglobulin heavy chain.
  • a protein comprising a heavy chain region comprises at least one of a C H I domain, a hinge (e.g. , upper, middle, and/or lower hinge region) domain, a C H 2 domain, a C H 3 domain, or a variant or fragment thereof.
  • the antibody or binding fragment thereof according to the present invention may comprise the Fc region of an immunoglobulin heavy chain (e.g. , a hinge portion, a C H 2 domain, and a C H 3 domain).
  • the antibody or binding fragment thereof according to the present invention lacks at least a region of a constant domain (e.g, all or part of a C H 2 domain).
  • at least one, and preferably all, of the constant domains are derived from a human immunoglobulin heavy chain.
  • the heavy chain region comprises a fully human hinge domain.
  • the heavy chain region comprising a fully human Fc region (e.g., hinge, C H 2 and C H 3 domain sequences from a human immunoglobulin).
  • the constituent constant domains of the heavy chain region are from different immunoglobulin molecules.
  • a heavy chain region of a protein may comprise a C H 2 domain derived from an IgGl molecule and a hinge region derived from an IgG3 or IgG4 molecule.
  • the constant domains are chimeric domains comprising regions of different immunoglobulin molecules.
  • a hinge may comprise a first region from an IgGl molecule and a second region from an IgG3 or IgG4 molecule.
  • the constant domains of the heavy chain region may be modified such that they vary in amino acid sequence from the naturally occurring (wild-type) immunoglobulin molecule.
  • the antibody or binding fragment thereof according to the present invention may comprise alterations or modifications to one or more of the heavy chain constant domains (C H I, hinge, C H 2 or C H 3) and/or to the light chain constant domain (C L ).
  • exemplary modifications include additions, deletions or substitutions of one or more amino acids in one or more domains.
  • Hinge region Within an antibody, the term “hinge region” includes the region of a heavy chain molecule that joins the C H I domain to the C H 2 domain. This hinge region comprises approximately 25 residues and is flexible, thus allowing the two N-terminal antigen binding regions to move independently. Hinge regions can be subdivided into three distinct domains: upper, middle, and lower hinge domains (Roux et al., 1998. J Immunol. 161(8):4083-90). Within a CAR molecule, the term “hinge region” refers to the region that connects the extracellular binding domain with the transmembrane domain.
  • hypervariable loop is not strictly synonymous to complementarity determining region (CDR), since the hypervariable loops (HVs) are defined on the basis of structure, whereas CDRs are defined based on sequence variability (Rabat etal. , 1991. Sequences of proteins of immunological interest (5 th ed.). Bethesda, MD: U.S. Dep. of Health and Human Services) and the limits of the HVs and the CDRs may be different in some VH and VL domains.
  • the CDRs of the VL and VH domains can typically be defined by the Kabat/Chothia definition as already explained hereinabove.
  • identity or “identical” As used herein, the term “identity” or “identical”, when used in a relationship between the sequences of two or more amino acid sequences, or of two or more nucleic acid sequences, refers to the degree of sequence relatedness between amino acid sequences or nucleic acid sequences, as determined by the number of matches between strings of two or more amino acid residues or nucleic acid residues. “Identity” measures the percent of identical matches between the smaller of two or more sequences with gap alignments (if any) addressed by a particular mathematical model or computer program (i.e ., “algorithms”).
  • Preferred methods for determining identity are designed to give the largest match between the sequences tested. Methods of determining identity are described in publicly available computer programs. Preferred computer program methods for determining identity between two sequences include the GCG program package, including GAP (Genetics Computer Group, University of Wisconsin, Madison, WI; Devereux etal, 1984. Nucleic Acids Res. 12(1 Pt l):387-95), BLASTP, BLASTN, and FASTA (Altschul etal , 1990 J Mol Biol. 215(3):403-10). The BLASTX program is publicly available from the National Center for Biotechnology Information (NCBI) and other sources (BLAST Manual, Altschul etal. NCB/NLM/NIH Bethesda, Md. 20894). The well-known Smith Waterman algorithm may also be used to determine identity.
  • GAP Genetics Computer Group, University of Wisconsin, Madison, WI; Devereux etal, 1984. Nucleic Acids Res. 12(1 Pt l):387-95)
  • immune cells generally includes white blood cells (leukocytes) that are derived from hematopoietic stem cells (HSC) produced in the bone marrow.
  • HSC hematopoietic stem cells
  • immune cells include, but are not limited to, lymphocytes (T cells, B cells, and natural killer (NK) cells) and myeloid-derived cells (neutrophil, eosinophil, basophil, monocyte, macrophage, dendritic cells).
  • an antibody or binding fragment thereof is said to be “immunospecific”, “specific for” or to “specifically bind” an antigen if it reacts at a detectable level with said antigen (e.g. , hCD45RC), preferably with an affinity constant (KA) of greater than or equal to about 10 6 M 1 , preferably greater than or equal to about 10 7 M 1 , 10 8 M 1 , 5 x 10 8 M 1 , 10 9 M 1 , 5 x 10 9 M 1 or more.
  • Affinity of an antibody or binding fragment thereof for its cognate antigen is also commonly expressed as an equilibrium dissociation constant (K D ).
  • an antibody or binding fragment thereof is said to be “immunospecific”, “specific for” or to “specifically bind” an antigen if it reacts at a detectable level with said antigen (e.g, hCD45RC), preferably with a K D of less than or equal to 10 6 M, preferably less than or equal to 10 7 M, 5xl0 8 M, 10 8 M, 5xl0 9 M, 10 9 M or less.
  • K D of less than or equal to 10 6 M, preferably less than or equal to 10 7 M, 5xl0 8 M, 10 8 M, 5xl0 9 M, 10 9 M or less.
  • Affinities of antibodies or binding fragment thereof can be readily determined using conventional techniques, for example, those described by Scatchard, 1949. Ann NY Acad Sci. 51:660-672.
  • Binding properties of an antibody or binding fragment thereof to antigens, cells or tissues may generally be determined and assessed using immunodetection methods including, for example, ELISA, immunofluorescence-based assays, such as immuno-hi stochemi stry (IHC) and/or fluorescence-activated cell sorting (FACS) or by surface plasmon resonance (SPR, e.g, using BIAcore ® ).
  • immunodetection methods including, for example, ELISA, immunofluorescence-based assays, such as immuno-hi stochemi stry (IHC) and/or fluorescence-activated cell sorting (FACS) or by surface plasmon resonance (SPR, e.g, using BIAcore ® ).
  • isolated antibody is intended to refer to an antibody that is substantially free of other antibodies having different antigenic specificities (e.g, an isolated antibody that specifically binds hCD45RC is substantially free of antibodies that specifically bind antigens other than hCD45RC).
  • An isolated antibody that specifically binds hCD45RC may, however, have cross-reactivity to other antigens, such as CD45RC molecules from other species.
  • an isolated antibody may be substantially free of other cellular material and/or chemicals, in particular those that would interfere with diagnostic or therapeutic uses of the antibody, including without limitation, enzymes, hormones, and other proteinaceous or non-proteinaceous components.
  • isolated nucleic acid is intended to refer to a nucleic acid that is substantially separated from other genome DNA sequences as well as proteins or complexes such as ribosomes and polymerases, which naturally accompany a native sequence.
  • the term embraces a nucleic acid sequence that has been removed from its naturally occurring environment, and includes recombinant or cloned DNA isolates and chemically synthesized analogues or analogues biologically synthesized by heterologous systems.
  • a substantially pure nucleic acid includes isolated forms of the nucleic acid. Of course, this refers to the nucleic acid as originally isolated and does not exclude genes or sequences later added to the isolated nucleic acid by the hand of man.
  • ligand refers to a member of a pair ligand/receptor, and binds to the other member of the pair.
  • the term “monoclonal antibody” refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprised in the population are identical except for possible naturally occurring mutations that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic site. Furthermore, in contrast to polyclonal antibody preparations that include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen. In addition to their specificity, the monoclonal antibodies are advantageous in that they may be synthesized uncontaminated by other antibodies. The modifier “monoclonal” is not to be construed as requiring production of the antibody by any particular method.
  • the monoclonal antibodies or binding fragment thereof according to the present invention may be prepared by the hybridoma methodology first described by Kohler et al, 1975. Nature. 256(5517):495-7, or may be made using recombinant DNA methods in bacterial, eukaryotic animal or plant cells (Patent US4,816,567).
  • the “monoclonal antibodies” may also be isolated from phage antibody libraries using the techniques described in Clackson et al. , 1991. Nature. 352(6336):624-8 and Marks et al. , 1991. JMol Biol. 222(3):581-97, for example.
  • MAIT cell refers to mucosal -associated invariant T cell.
  • MAIT cells can be activated via their TCR and TCR-independent signals (e.g . cytokines).
  • MAIT cells are able to sense bacterial or viral infections and to produce effector cytokines and/or degranulate in response to these signals.
  • NK cell refers to mucosal -associated invariant T cell.
  • NK cell or “natural killer cell” refers to a cytotoxic lymphocyte playing an important role in the innate immunity. NK cells are constantly in contact with other cells. NK cells express activating and inhibitory receptors in their cell surface. This mechanism allows NK cells to recognize if a cell is “normal” (and thus not to be eliminated) or if a cell is “anormal” (and thus to be killed) such as a tumor cell or an infected cell.
  • NKT cell or “natural killer T cell” refers to a cytotoxic lymphocyte which display T lymphocyte markers as well as NK lymphocyte markers.
  • Natural killer (NK) cells and natural killer T (NKT) cells are two types of important cells in innate immunity. Both NK and NKT cells are cytotoxic cells, which induce cell death of pathogenic cells as well as tumor cells. The main difference between NK cells and NKT cells is that NK cells are large granular lymphocytes while NKT cells are a type of T cells.
  • nucleic acid or “polynucleotide” refers to a polymer of nucleotides covalently linked by phosphodiester bonds, such as deoxyribonucleic acids (DNA) or ribonucleic acids (RNA), in either single- or double-stranded form.
  • DNA deoxyribonucleic acids
  • RNA ribonucleic acids
  • the term encompasses nucleic acids containing known analogues of natural nucleotides that have similar binding properties as the reference nucleic acid and are metabolized in a manner similar to naturally occurring nucleotides.
  • a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g.
  • degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et ak, Nucleic Acid Res. 19:5081 (1991); Ohtsuka et ak, J. Biol.Chem. 260:2605-2608 (1985); and Rossolini et ak, Mol. Cell. Probes 8:91-98 (1994)). “Prevent” or “preventing” or “prevention”
  • the terms “prevent”, “preventing” and “prevention” refer to prophylactic and preventative measures, wherein the object is to reduce the chances that a subject will develop the pathologic condition or disorder over a given period of time. Such a reduction may be reflected, e.g, in a delayed onset of at least one symptom of the pathologic condition or disorder in the subject. “Promoter”
  • promoter refers to a DNA sequence recognized by the synthetic machinery of the cell, or introduced synthetic machinery, required to initiate the specific transcription of a polynucleotide sequence. “Subject”
  • the term “subject” refers to a mammal, preferably a human.
  • a subject may be a “patient”, i.e., a warm-blooded animal, more preferably a human, who/which is awaiting the receipt of, or is receiving medical care or was/is/will be the object of a medical procedure, or is monitored for the development of a disease.
  • patient refers here to any mammal, including humans, domestic and farm animals, and zoo, sports, or pet animals, such as dogs, cats, cattle, horses, sheep, pigs, goats, rabbits, etc.
  • the mammal is a primate, more preferably a human.
  • transfected or “transformed” or “transduced” refers to a process by which exogenous nucleic acid is transferred or introduced into the host cell.
  • a “transfected” or “transformed” or “transduced” cell is one which has been transfected, transformed or transduced with exogenous nucleic acid.
  • the cell includes the primary subject cell and its progeny.
  • Treating” or “treatment” or “alleviation” refer to therapeutic treatment, excluding prophylactic or preventative measures; wherein the object is to slow down (lessen) the targeted pathologic condition or disorder.
  • Those in need of treatment include those already with the disorder as well those suspected to have the disorder.
  • a subject is successfully “treated” for the targeted pathologic condition or disorder if, after receiving a therapeutic amount of the isolated antibody or binding fragment thereof, nucleic acid, expression vector, composition, pharmaceutical composition or medicament according to the present invention, said subject shows observable and/or measurable reduction in or absence of one or more of the following: reduction in the number of CD45RC Mgh cells; reduction in the percent of total cells that are 0O45K € Mb ⁇ 1 ; relief to some extent, of one or more of the symptoms associated with the specific disease or condition; reduced morbidity and mortality; and/or improvement in quality of life issues.
  • the above parameters for assessing successful treatment and improvement in the disease are readily measurable by routine procedures familiar to a physician.
  • Treg cell refers to a cell capable of suppressing, inhibiting or preventing excessive or unwanted inflammatory responses, such as, for example, autoimmunity or allergic reactions.
  • the Treg cell population of the invention is capable of suppressive activity.
  • said suppressive activity is contact independent.
  • said suppressive activity is contact dependent.
  • the Treg cell population of the invention presents a suppressive action on effector T cells, preferably said suppressive action is dependent on TCR expression and/or activation.
  • Teff cell refers to a T effector cell. Teff cells include CD4+ T helper cells and CD8+ cytotoxic T cells. Teff cells play a central role in cellular-mediated immunity following antigen challenge. Treg cells are a key regulator of the Teff cells.
  • memory T cell refers to a subset of T cells that have previously encountered and responded to their cognate antigen. In comparison to naive T cells, which are T cells have not been exposed to antigens yet, memory T cells can mount a faster and stronger immune response.
  • variable refers to the fact that certain regions of the variable domains VH and VL differ extensively in sequence among antibodies and are used in the binding and specificity of each particular antibody for its target antigen. However, the variability is not evenly distributed throughout the variable domains of antibodies. It is concentrated in three segments called “hypervariable loops” in each of the VL domain and the VH domain which form part of the antigen binding site.
  • the first, second and third hypervariable loops of the Ul light chain domain are referred to herein as LI (l), L2 (l) and L3 (l) and may be defined as comprising residues 24-33 (Ll(k), consisting of 9, 10 or 11 amino acid residues), 49-53 L2 (l), consisting of 3 residues) and 90-96 (L3( ), consisting of 6 residues) in the Y L domain (Morea et al , 2000 Methods. 20(3):267-79).
  • the first, second and third hypervariable loops of the VK light chain domain are referred to herein as L1(K), L2(K) and L3(K) and may be defined as comprising residues 25-33 (L1(K), consisting of 6, 7, 8, 11, 12 or 13 residues), 49-53 (L2(K), consisting of 3 residues) and 90-97 (L3(K), consisting of 6 residues) in the V L domain (Morea et al, 2000 Methods. 20(3):267-79).
  • the first, second and third hypervariable loops of the V H domain are referred to herein as HI, H2 and H3 and may be defined as comprising residues 25-33 (HI, consisting of 7, 8 or 9 residues), 52-56 (H2, consisting of 3 or 4 residues) and 91-105 (H3, highly variable in length) in the V H domain (Morea et al , 2000 Methods. 20(3):267-79).
  • the terms LI, L2 and L3 respectively refer to the first, second and third hypervariable loops of a V L domain, and encompass hypervariable loops obtained from both VK and Vk isotypes.
  • HI, H2 and H3 respectively refer to the first, second and third hypervariable loops of the V H domain, and encompass hypervariable loops obtained from any of the known heavy chain isotypes, including gamma (y), mu (m), alpha (a), delta (d) or epsilon (e).
  • the hypervariable loops LI, L2, L3, HI, H2 and H3 may each comprise part of a “complementarity determining region” or “CDR”, as defined hereinabove.
  • variant of an antigen refers herein to an antigen that is almost identical to the natural antigen and which shares the same biological activity.
  • the minimal difference between the natural antigen and its variant may lie for example in an amino acid substitution, deletion, and/or addition.
  • variants may contain, for example, conservative amino acid substitutions.
  • the variant of an antigen presents a sequence identity of at least or of about 70, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% with the sequence of the natural antigen.
  • a first aspect of the present invention relates to a chimeric antigen receptor (CAR) specific for human CD45RC, wherein said CAR comprises at least one extracellular binding domain that binds to said human CD45RC.
  • the extracellular binding domain is an antigen-binding domain, such as for instance an antibody or a binding fragment thereof as described hereafter.
  • an isolated antibody or a binding fragment thereof, binding to human CD45RC (hCD45RC).
  • the isolated antibody or a binding fragment thereof may be purified.
  • the isolated antibody or a binding fragment thereof is purified to:
  • CD45RC human CD45RC
  • CD45R also known as CD45R or PTPRC
  • CD45R transmembrane glycoprotein existing in different isoforms.
  • CD45R 3 variable exons
  • Antibodies reactive with restricted epitope are clustered as “CD45R”.
  • anti-CD45RA, anti-CD45RB and anti-CD45RC antibodies recognize CD45 isoforms which include the expression of the A, B and C determinants, respectively.
  • CD45 has different extracellular domains, but have an identical extracellular sequence proximal to the membrane, as well as for the transmembrane domain and a large cytoplasmic tail segments containing two tandemly homologous highly conserved phosphatase domains of approximately 300 residues.
  • CD45 and its isoforms non-covalently associate with lymphocyte phosphatase-associated phosphoprotein (LPAP) on T and B lymphocytes.
  • LPAP lymphocyte phosphatase-associated phosphoprotein
  • CD45 has been reported to be associated with several other cell surface antigens, including CD1, CD2, CD3, and CD4.
  • CD45 is involved in signaling lymphocytes activation. When preceded by the letter “h” (e.g. , hCD45), it is implied that the CD45 is of human origin.
  • CD45RC refers to a 200-220 kDa single chain type I membrane glycoprotein well-known from the skilled artisan.
  • CD45RC is an alternative splicing isoform of CD45 comprising exon 6 encoding the C determinant (hence the terminology CD45RC, i.e., CD45 Restricted to the C determinant), but lacking exons 4 and 5, respectively encoding the A and B determinants.
  • An amino acid sequence of human CD45RC is given in SEQ ID NO: 104, corresponding to UniProt Accession P08575-10 (version 10, modified March 28, 2018 - Checksum: F92C874C9A114890).
  • This CD45RC isoform is expressed on B cells, and a subset of CD8 + T cells and CD4 + T cells, but not on CD8 + or CD4 + Treg, CD14 + monocytes or PMN (Picarda et al, 2017 JCI Insight. 2(3):e90088). While some monoclonal antibodies can recognize an epitope in the portion of CD45 common to all the different isoforms (these are termed anti-CD45 antibodies), other monoclonal antibodies have restricted specificity to a given isoform, depending on which determinant they recognize (A, B or C). When preceded by the letter “h” (e.g., hCD45RC), it is implied that the CD45RC is of human origin.
  • the antibody or binding fragment thereof binds to the extracellular domain of hCD45RC. In one embodiment, the antibody or binding fragment thereof binds to at least one epitope present on the extracellular domain of hCD45RC.
  • the antibody or binding fragment thereof binds to the C determinant encoded by exon 6 of hCD45. In one embodiment, the antibody or binding fragment thereof binds to at least one epitope on the C determinant encoded by exon 6 of hCD45.
  • the amino acid sequence of the C determinant encoded by exon 6 of hCD45 comprises or consists of SEQ ID NO: 23. In one embodiment, the nucleic acid sequence of exon 6 encoding the C determinant of hCD45 comprises or consists of SEQ ID NO: 24.
  • the antibody or binding fragment thereof binds to at least one epitope comprising or consisting of SEQ ID NO: 23 or a fragment thereof.
  • the antibody or binding fragment thereof binds to at least one epitope comprising or consisting of a sequence sharing at least about 70%, preferably at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identity with SEQ ID NO: 23 or a fragment thereof.
  • the antibody or binding fragment thereof binds to at least one epitope encoded by a nucleic acid sequence comprising or consisting of SEQ ID NO: 24 or a fragment thereof.
  • the antibody or binding fragment thereof binds to at least one epitope encoded by a nucleic acid sequence comprising or consisting of a sequence sharing at least about 70%, preferably at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identity with SEQ ID NO: 24 or a fragment thereof.
  • the antibody or binding fragment thereof binds to at least one epitope comprising or consisting of at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17,
  • SEQ ID NO: 23 amino acids of SEQ ID NO: 23 or a fragment thereof; or of a sequence sharing at least about 70%, preferably at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identity with SEQ ID NO: 23 or a fragment thereof.
  • the antibody or binding fragment thereof binds to at least one epitope comprising or consisting of at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17,
  • SEQ ID NO: 23 contiguous amino acids of SEQ ID NO: 23 or a fragment thereof; or of a sequence sharing at least about 70%, preferably at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identity with SEQ ID NO: 23 or a fragment thereof.
  • a fragment of the at least one epitope comprising or consisting of SEQ ID NO: 23 comprises or consists of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16,
  • a fragment of the at least one epitope comprising or consisting of SEQ ID NO: 23 comprises or consists of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16,
  • a sequence comprising SEQ ID NO: 23 is the sequence of hCD45 set forth in SEQ ID NO: 99, corresponding to UniProt Accession P08575-3 (version 3, modified March 28, 2018 - Checksum: 6E942E2BF 6B 17 AC 5 ) .
  • a sequence comprising SEQ ID NO: 23 is the sequence of hCD45RC set forth in SEQ ID NO: 104, corresponding to UniProt Accession P08575-10 (version 10, modified March 28, 2018 - Checksum: F92C874C9A114890).
  • the antibody or binding fragment thereof does not bind to the A determinant encoded by exon 4 of hCD45. In one embodiment, the antibody or binding fragment thereof does not bind to at least one epitope on the A determinant encoded by exon 4 of hCD45.
  • the amino acid sequence of the A determinant encoded by exon 4 of hCD45 comprises or consists of SEQ ID NO: 105.
  • the antibody or binding fragment thereof does not bind to the B determinant encoded by exon 5 of hCD45. In one embodiment, the antibody or binding fragment thereof does not bind to at least one epitope on the B determinant encoded by exon 5 of hCD45.
  • the amino acid sequence of the B determinant encoded by exon 5 of hCD45 comprises or consists of SEQ ID NO: 106.
  • the antibody or binding fragment thereof does not bind to hCD45RA. In one embodiment, the antibody or binding fragment thereof does not bind to at least one epitope of hCD45RA. In one embodiment, the amino acid sequence of hCD45RA comprises or consists of SEQ ID NO: 107, corresponding to UniProt Accession P08575-8 (version 8, modified March 28, 2018 - Checksum: F42C1FEC9EDE4BC0).
  • the antibody or binding fragment thereof does not bind to hCD45RB. In one embodiment, the antibody or binding fragment thereof does not bind to at least one epitope of hCD45RB.
  • the amino acid sequence of hCD45RB comprises or consists of SEQ ID NO: 108, corresponding to UniProt Accession P08575-9 (version 9, modified March 28, 2018 - Checksum: 745870037910C575).
  • the antibody or binding fragment thereof does not bind to hCD45RAB. In one embodiment, the antibody or binding fragment thereof does not bind to at least one epitope of hCD45RAB.
  • the amino acid sequence of hCD45RAB comprises or consists of SEQ ID NO: 109, corresponding to UniProt Accession P08575-5 (version 5, modified March 28, 2018 - Checksum: EA40BE995CD98F7C).
  • the antibody or binding fragment thereof does not bind to hCD45R0. In one embodiment, the antibody or binding fragment thereof does not bind to at least one epitope of hCD45R0.
  • the amino acid sequence of hCD45R0 comprises or consists of SEQ ID NO: 110, corresponding to UniProt Accession P08575-4 (version 4, modified March 28, 2018 - Checksum: D3CB364EF4243384).
  • the at least one epitope is a conformational epitope. In another embodiment, the at least one epitope is a sequential epitope.
  • the antibody or binding fragment thereof binds to hCD45RC with an equilibrium dissociation constant (K d ) of about 5x 10 7 M or less, preferably of about 2.5xl0 7 M or less, about lxlO 7 M or less, about 7.5xl0 8 M or less, about 5xl0 8 M or less, about 1 c 10 8 M or less.
  • K d equilibrium dissociation constant
  • the antibody or binding fragment thereof binds to hCD45RC with an association rate (K on ) of about lxlO 4 M _1 sec 1 or more, preferably of about 5xl0 4 M ⁇ sec 1 or more, about lxlO 5 M ⁇ sec 1 or more, about 2.5xl0 5 M ⁇ sec 1 or more, about 5xl0 5 M ⁇ sec 1 or more.
  • the antibody or binding fragment thereof binds to hCD45RC with a dissociation rate (K 0ff ) of about 5xl0 2 sec 1 or less, preferably of about 4xl0 2 sec 1 or less, about 3xl0 2 sec 1 or less, about 2x1 O 2 sec 1 or less, about 1.5 xlO 2 sec 1 or less.
  • K 0ff dissociation rate
  • the antibody or binding fragment thereof binds to hCD45RC with at least one of, preferably at least two of, more preferably the three of: an equilibrium dissociation constant (K d ) of about 5x10 7 M or less, preferably of about 2.5xl0 7 M or less, about IxlO 7 M or less, about 7.5x 10 8 M or less, about
  • K d equilibrium dissociation constant
  • Methods for determining the affinity include, without limitation, surface plasmon resonance (SPR), fluorescence-activated cell sorting (FACS), enzyme-linked immunosorbent assay (ELISA), AlphaLISA and KinExA.
  • SPR surface plasmon resonance
  • FACS fluorescence-activated cell sorting
  • ELISA enzyme-linked immunosorbent assay
  • AlphaLISA AlphaLISA
  • BIAcore ® which relies on SPR using immobilized CD45RC to determine the affinity of an antibody or binding fragment thereof. A way of implementing this method will be further illustrated in the Examples section.
  • the antibody or binding fragment thereof is a polyclonal antibody or binding fragment thereof. In a preferred embodiment, the antibody or binding fragment thereof is a monoclonal antibody or binding fragment thereof.
  • the antibody or binding fragment thereof is a molecule selected from the group comprising or consisting of a whole antibody, a single-chain antibody, a dimeric single chain antibody, a single-domain antibody, a Fv, a Fab, a Fab', a Fab'-SH, a F(ab)’2, a Fd, a defucosylated antibody, a bi-specific antibody, a diabody, a triabody and a tetrabody.
  • Antibody binding fragments can be obtained using standard methods. For instance, Fab or F(ab')2 fragments may be produced by protease digestion of the isolated antibodies, according to conventional techniques. It will also be appreciated that antibodies or binding fragments thereof can be modified using known methods. For example, to slow clearance in vivo and obtain a more desirable pharmacokinetic profile, the antibody or binding fragment thereof may be modified with polyethylene glycol (PEG). Methods for coupling and site-specifically conjugating PEG to an antibody or binding fragment thereof are described in, e.g., Leong et al. , 2001. Cytokine. 16(3): 106-19; Delgado et ah, 1996 BrJ Cancer. 73(2): 175-82.
  • PEG polyethylene glycol
  • the antibody or binding fragment thereof is a molecule selected from the group comprising or consisting of a unibody, a domain antibody, and a nanobody.
  • the antibody or binding fragment thereof is a mimetic selected from the group comprising or consisting of an affibody, an affilin, an affitin, an adnectin, an atrimer, an evasin, a DARPin, an anticalin, an avimer, a fynomer, a versabody and a duocalin.
  • the antibody or binding fragment thereof also encompasses multispecific antibodies or binding fragments thereof, i.e., being immunospecific for more than one, such as at least two, different antigens, one of which being hCD45RC according to the present invention.
  • the antibody or binding fragment thereof also encompasses polymers of antibodies or binding fragments thereof, i.e., more than one, such as at least two, antibodies or binding fragments thereof, whether identical or different, being covalently linked together, directly or indirectly.
  • CDR numbering and definitions are according to the Kabat/Chothia definition.
  • the antibody or binding fragment thereof comprises a heavy chain variable region (abbreviated herein as HCVR or V H ) which comprises at least one, preferably at least two, more preferably the following three complementary-determining regions (CDRs):
  • HCVR heavy chain variable region
  • V H three complementary-determining regions
  • VH-CDRI NYYIG (SEQ ID NO: 1); VH-CDR2: X 1 -IF-X 2 -GG-X 3 -Y-X 4 -N-X 5 -X 6 -X 7 -X 8 -X 9 -X 10 -G (SEQ ID NO: 2); and
  • VH-CDR3 RNFDY (SEQ ID NO: 3), with: Xi being selected from Asp (D), He (I) and Arg (R);
  • X 2 being selected from Pro (P) and Ser (S);
  • X 3 being selected from Asp (D), Ser (S) and Gly (G);
  • X4 being selected from Ala (A) and Thr (T);
  • X5 being selected from Ser (S) and Tyr (Y); Xe being selected from Asn (N), Ala (A) and Ser (S);
  • X7 being selected from Glu (E), Asp (D), Pro (P) and Gin (Q);
  • Xs being selected from Lys (K) and Ser (S);
  • X 9 being selected from Phe (F) and Yal (Y); and X 10 being selected from Lys (K) and Gin (Q).
  • the antibody or binding fragment thereof comprises a HCVR which comprises the following three CDRs:
  • VH-CDR1 NYYIG (SEQ ID NO: 1);
  • VH-CDR2 X 1 -IF-X 2 -GG-X 3 -Y-X 4 -N-X 5 -X 6 -X 7 -X 8 -X 9 -X 10 -G (SEQ ID NO: 2); and VH-CDR3: RNFDY (SEQ ID NO: 3), with: DIFPGGD Y AN SNEKFKG Xi being selected from Asp (D), lie (I) and Arg (R);
  • X2 being selected from Pro (P) and Ser (S);
  • X 3 being selected from Asp (D), Ser (S) and Gly (G);
  • X 4 being selected from Ala (A) and Thr (T);
  • X 5 being selected from Ser (S) and Tyr (Y);
  • Xe being selected from Asn (N), Ala (A) and Ser (S);
  • Xi being selected from Glu (E), Asp (D), Pro (P) and Gin (Q);
  • the antibody or binding fragment thereof comprises a HCVR which comprises at least one, preferably at least two, more preferably the following three CDRs: VH-CDR1: NYYIG (SEQ ID NO: 1);
  • VH-CDR2 DIFPGGDYANSNEKFKG (SEQ ID NO: 4); and VH-CDR3: RNFDY (SEQ ID NO: 3).
  • the antibody or binding fragment thereof comprises a HCVR which comprises the following three CDRs:
  • VH-CDR1 NYYIG (SEQ ID NO: 1);
  • VH-CDR2 DIFPGGDYANSNEKFKG (SEQ ID NO: 4); and VH-CDR3: RNFDY (SEQ ID NO: 3).
  • the antibody or binding fragment thereof comprises a HCVR which comprises at least one, preferably at least two, more preferably the following three CDRs: VH-CDR1: NYYIG (SEQ ID NO: 1);
  • VH-CDR2 DIFPGGDYANSNEKVKG (SEQ ID NO: 5); and VH-CDR3: RNFDY (SEQ ID NO: 3).
  • the antibody or binding fragment thereof comprises a HCVR which comprises the following three CDRs:
  • VH-CDR1 NYYIG (SEQ ID NO: 1);
  • VH-CDR2 DIFPGGDYANSNEKVKG (SEQ ID NO: 5); and VH-CDR3: RNFDY (SEQ ID NO: 3).
  • the antibody or binding fragment thereof comprises a HCVR which comprises at least one, preferably at least two, more preferably the following three CDRs: VH-CDR1: NYYIG (SEQ ID NO: 1);
  • VH-CDR2 DIFPGGGYTNYAEKFQG (SEQ ID NO: 6); and VH-CDR3: RNFDY (SEQ ID NO: 3).
  • the antibody or binding fragment thereof comprises a HCVR which comprises the following three CDRs:
  • VH-CDR1 NYYIG (SEQ ID NO: 1);
  • VH-CDR2 DIFPGGGYTNYAEKFQG (SEQ ID NO: 6); and VH-CDR3: RNFDY (SEQ ID NO: 3).
  • the antibody or binding fragment thereof comprises a HCVR which comprises at least one, preferably at least two, more preferably the following three CDRs: VH-CDRI: NYYIG (SEQ ID NO: 1);
  • VH-CDR2 DIFPGGSYTNYSESFQG (SEQ ID NO: 7); and VH-CDR3: RNFDY (SEQ ED NO: 3).
  • the antibody or binding fragment thereof comprises a HCVR which comprises the following three CDRs:
  • VH-CDRI NYYIG (SEQ ID NO: 1);
  • VH-CDR2 DIFPGGSYTNYSESFQG (SEQ ID NO: 7); and VH-CDR3: RNFDY (SEQ ID NO: 3).
  • the antibody or binding fragment thereof comprises a HCVR which comprises at least one, preferably at least two, more preferably the following three CDRs: VH-CDRI: NYYIG (SEQ ID NO: 1);
  • VH-CDR2 DIFPGGSYTNYADSVKG (SEQ ID NO: 8); and VH-CDR3: RNFDY (SEQ ID NO: 3).
  • the antibody or binding fragment thereof comprises a HCVR which comprises the following three CDRs:
  • VH-CDRI NYYIG (SEQ ID NO: 1);
  • VH-CDR2 DIFPGGSYTNYADSVKG (SEQ ID NO: 8); and VH-CDR3: RNFDY (SEQ ID NO: 3).
  • the antibody or binding fragment thereof comprises a HCVR which comprises at least one, preferably at least two, more preferably the following three CDRs: VH-CDRI: NYYIG (SEQ ID NO: 1);
  • VH-CDR2 RIFPGGGYTNYAQKFQG (SEQ ID NO: 9); and VH-CDR3: RNFDY (SEQ ID NO: 3).
  • the antibody or binding fragment thereof comprises a HCVR which comprises the following three CDRs: VH-CDR1: NYYIG (SEQ ID NO: 1);
  • VH-CDR2 RIFPGGGYTNYAQKFQG (SEQ ID NO: 9);
  • VH-CDR3 RNFDY (SEQ ID NO: 3).
  • the antibody or binding fragment thereof comprises a HCVR which comprises at least one, preferably at least two, more preferably the following three CDRs: VH-CDR1: NYYIG (SEQ ID NO: 1);
  • VH-CDR2 IIFPGGSYTNYSPSFQG (SEQ ID NO: 10); and VH-CDR3: RNFDY (SEQ ID NO: 3).
  • the antibody or binding fragment thereof comprises a HCVR which comprises the following three CDRs:
  • VH-CDR1 NYYIG (SEQ ID NO: 1);
  • VH-CDR2 IIFPGGSYTNYSPSFQG (SEQ ID NO: 10); and VH-CDR3: RNFDY (SEQ ID NO: 3).
  • the antibody or binding fragment thereof comprises a HCVR which comprises at least one, preferably at least two, more preferably the following three CDRs: VH-CDR1: NYYIG (SEQ ID NO: 1);
  • VH-CDR2 DIFSGGSYTNYADSVKG (SEQ ID NO: 11); and VH-CDR3: RNFDY (SEQ ID NO: 3).
  • the antibody or binding fragment thereof comprises a HCVR which comprises the following three CDRs:
  • VH-CDR1 NYYIG (SEQ ID NO: 1);
  • VH-CDR2 DIFSGGSYTNYADSVKG (SEQ ID NO: 11); and VH-CDR3: RNFDY (SEQ ID NO: 3).
  • the antibody or binding fragment thereof comprises a HCVR which comprises at least one, preferably at least two, more preferably the following three CDRs: VH-CDR1: NYYIG (SEQ ID NO: 1);
  • VH-CDR2 DIFPGGDYTNYAEKFQG (SEQ ID NO: 100); and VH-CDR3: RNFDY (SEQ ID NO: 3).
  • the antibody or binding fragment thereof comprises a HCVR which comprises the following three CDRs:
  • VH-CDR1 NYYIG (SEQ ID NO: 1);
  • VH-CDR2 DIFPGGDYTNYAEKFQG (SEQ ID NO: 100); and VH-CDR3: RNFDY (SEQ ID NO: 3).
  • the antibody or binding fragment thereof comprises a HCVR which comprises at least one, preferably at least two, more preferably the following three CDRs: VH-CDR1: NYYIG (SEQ ID NO: 1);
  • VH-CDR2 DIFPGGGYANYAEKFQG (SEQ ID NO: 116); and VH-CDR3: RNFDY (SEQ ID NO: 3).
  • the antibody or binding fragment thereof comprises a HCVR which comprises the following three CDRs:
  • VH-CDR1 NYYIG (SEQ ID NO: 1);
  • VH-CDR2 DIFPGGGYANYAEKFQG (SEQ ID NO: 116); and VH-CDR3: RNFDY (SEQ ID NO: 3).
  • the antibody or binding fragment thereof comprises a HCVR which comprises at least one, preferably at least two, more preferably the following three CDRs: VH-CDR1: NYYIG (SEQ ID NO: 1);
  • VH-CDR2 DIFPGGGYTNYAEKFKG (SEQ ID NO: 117); and VH-CDR3: RNFDY (SEQ ID NO: 3).
  • the antibody or binding fragment thereof comprises a HCVR which comprises the following three CDRs:
  • VH-CDR1 NYYIG (SEQ ID NO: 1);
  • VH-CDR2 DIFPGGGYTNYAEKFKG (SEQ ID NO: 117); and VH-CDR3: RNFDY (SEQ ID NO: 3).
  • the antibody or binding fragment thereof comprises a HCVR which comprises at least one, preferably at least two, more preferably the following three CDRs: VH-CDR1: NYYIG (SEQ ID NO: 1);
  • VH-CDR2 DIFPGGGYTNYNEKFQG (SEQ ID NO: 118); and VH-CDR3: RNFDY (SEQ ID NO: 3).
  • the antibody or binding fragment thereof comprises a HCVR which comprises the following three CDRs:
  • VH-CDR1 NYYIG (SEQ ID NO: 1); VH-CDR2: DIFPGGGYTNYNEKFQG (SEQ ID NO: 118); and
  • VH-CDR3 RNFDY (SEQ ID NO: 3).
  • the antibody or binding fragment thereof comprises a HCVR which comprises at least one, preferably at least two, more preferably the following three CDRs: VH-CDR1: NYYIG (SEQ ID NO: 1); VH-CDR2: DIFPGGGYTNSAEKFQG (SEQ ID NO: 119); and
  • VH-CDR3 RNFDY (SEQ ID NO: 3).
  • the antibody or binding fragment thereof comprises a HCVR which comprises the following three CDRs:
  • VH-CDR1 NYYIG (SEQ ID NO: 1); VH-CDR2: DIFPGGGYTNSAEKFQG (SEQ ID NO: 119); and
  • VH-CDR3 RNFDY (SEQ ID NO: 3).
  • the antibody or binding fragment thereof comprises a light chain variable region (abbreviated herein as LCVR or V L ) which comprises at least one, preferably at least two, more preferably the following three complementary-determining regions (CDRs):
  • LCVR light chain variable region
  • V L three complementary-determining regions
  • VL-CDR1 X11-ASSSVS-X12-YMH (SEQ ID NO: 12);
  • VL-CDR2 X13-TSN-X14-X15-X1 6 (SEQ ID NO: 13); and VL-CDR3: Xn-QRSSYPLTF (SEQ ID NO: 14), with: X11 being selected from Ser (S) and Arg (R);
  • X12 being absent or being selected from Asn (N), Ser (S) and Gly (G);
  • Xi 3 being selected from Asn (N) and Ala (A); or X 13 being any amino acid but Ala (A) or Asn (N);
  • Xi4 being selected from Leu (L), Ser (S) and Arg (R); Xi 5 being selected from Pro (P), Ala (A) and Gin (Q);
  • Xi 6 being selected from Ser (S) and Thr (T); and Xi 7 being selected from Gin (Q) and His (H).
  • the antibody or binding fragment thereof comprises a LCVR which comprises the following three CDRs:
  • VL-CDR1 X 11 -ASSSVS-X 12 -YMH (SEQ ID NO: 12);
  • VL-CDR2 X13-TSN-X14-X15-X16 (SEQ ID NO: 13); and VL-CDR3: X 17 -QRS S YPLTF (SEQ ID NO: 14), with: X 11 being selected from Ser (S) and Arg (R);
  • X 12 being absent or being selected from Asn (N), Ser (S) and Gly (G);
  • Xi 3 being selected from Asn (N) and Ala (A); or X 13 being any amino acid but Ala (A) or Asn (N);
  • Xi 4 being selected from Leu (L), Ser (S) and Arg (R); Xi5 being selected from Pro (P), Ala (A) and Gin (Q);
  • Xi 6 being selected from Ser (S) and Thr (T); and Xi 7 being selected from Gin (Q) and His (H).
  • the antibody or binding fragment thereof comprises a LCVR which comprises at least one, preferably at least two, more preferably the following three complementary-determining regions (CDRs):
  • VL-CDRI X 11 -ASSSVS-X 12 -YMH (SEQ ID NO: 12);
  • VL-CDR2 X1 3 -TSN-X14-X15-X16 (SEQ ID NO: 13); and VL-CDR3: Xn-QRSS YPLTF (SEQ ID NO: 14), with: Xu being Ser (S);
  • X 12 being absent or being selected from Asn (N), Ser (S) and Gly (G);
  • Xi 3 being Asn (N); or X 13 being any amino acid but Ala (A) or Asn (N);
  • Xi 5 being Pro (P); Xi 6 being Ser (S); and Xi7 being Gin (Q).
  • the antibody or binding fragment thereof comprises a LCVR which comprises the following three CDRs:
  • VL-CDR1 Xii-ASSSYS-Xo-YMH (SEQ ID NO: 12);
  • VL-CDR2 Xo-TSN-Xw-Xis-Xie (SEQ ID NO: 13);
  • VL-CDR3 Xn-QRSSYPLTF (SEQ ID NO: 14), with:
  • Xi2 being absent or being selected from Asn (N), Ser (S) and Gly (G); Xi3 being Asn (N); or Xu being any amino acid but Ala (A) or Asn (N);
  • the antibody or binding fragment thereof comprises a LCVR which comprises at least one, preferably at least two, more preferably the following three CDRs: VL-CDR1: SASSSVS-X O -YMH (SEQ ID NO: 15);
  • VL-CDR2 NTSNLPS (SEQ ID NO: 16); and VL-CDR3: QQRSSYPLTF (SEQ ID NO: 17), with:
  • Xi2 being absent or being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a LCVR which comprises the following three CDRs:
  • VL-CDR1 SASSSVS-X12-YMH (SEQ ID NO: 15); VL-CDR2: NTSNLPS (SEQ ID NO: 16); and
  • VL-CDR3 QQRSSYPLTF (SEQ ED NO: 17), with:
  • the antibody or binding fragment thereof comprises a LCVR which comprises at least one, preferably at least two, more preferably the following three CDRs: VL-CDRI SASSSVSYMH (SEQ ID NO: 15);
  • VL-CDR2 NTSNLPS (SEQ ID NO: 16); and VL-CDR3: QQRSSYPLTF (SEQ ID NO: 17).
  • the antibody or binding fragment thereof comprises a LCVR which comprises the following three CDRs:
  • VL-CDRI SASSSVSYMH (SEQ ID NO: 15);
  • VL-CDR2 NTSNLPS (SEQ ID NO: 16); and VL-CDR3: QQRSSYPLTF (SEQ ED NO: 17).
  • the antibody or binding fragment thereof comprises a LCVR which comprises at least one, preferably at least two, more preferably the following three CDRs: VL-CDRI: SASSSVS-X12-YMH (SEQ ID NO: 15);
  • VL-CDR2 NTSNLPS (SEQ ID NO: 16); and VL-CDR3: QQRSSYPLTF (SEQ ID NO: 17), with:
  • X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a LCVR which comprises the following three CDRs: VL-CDRI: SASSSVS-X12-YMH (SEQ ID NO: 15);
  • VL-CDR2 NTSNLPS (SEQ 3D NO: 16); and VL-CDR3: QQRSSYPLTF (SEQ ID NO: 17), with:
  • X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a LCVR which comprises at least one, preferably at least two, more preferably the following three CDRs: VL-CDRI: RASSSVS-X12-YMH (SEQ ID NO: 18);
  • VL-CDR2 NTSNLPS (SEQ ID NO: 16); and VL-CDR3: QQRSSYPLTF (SEQ ID NO: 17), with:
  • Xi 2 being absent or being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a LCVR which comprises the following three CDRs: VL-CDR1: RASSSVS-X 12 -YMH (SEQ ID NO: 18);
  • VL-CDR2 NTSNLPS (SEQ ID NO: 16); and VL-CDR3: QQRSSYPLTF (SEQ ID NO: 17), with:
  • X 12 being absent or being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a LCVR which comprises at least one, preferably at least two, more preferably the following three CDRs: VL-CDRI: RASSSVSYMH (SEQ ID NO: 18);
  • VL-CDR2 NTSNLPS (SEQ ID NO: 16); and VL-CDR3: QQRSSYPLTF (SEQ ID NO: 17).
  • the antibody or binding fragment thereof comprises a LCVR which comprises the following three CDRs:
  • VL-CDRI RASSSVSYMH (SEQ ID NO: 18);
  • VL-CDR2 NTSNLPS (SEQ ID NO: 16); and VL-CDR3: QQRSSYPLTF (SEQ ID NO: 17).
  • the antibody or binding fragment thereof comprises a LCVR which comprises at least one, preferably at least two, more preferably the following three CDRs: VL-CDRI: RASSSVS-X12-YMH (SEQ ID NO: 18);
  • VL-CDR2 NTSNLPS (SEQ ID NO: 16); and VL-CDR3: QQRSSYPLTF (SEQ ID NO: 17), with:
  • X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a LCVR which comprises the following three CDRs:
  • VL-CDRI RASSSVS-X12-YMH (SEQ ID NO: 18); VL-CDR2: NTSNLPS (SEQ ID NO: 16); and VL-CDR3: QQRSSYPLTF (SEQ ID NO: 17), with:
  • Xi 2 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a LCVR which comprises at least one, preferably at least two, more preferably the following three CDRs: VL-CDR1: RASSSVS-X12-YMH (SEQ ID NO: 18);
  • VL-CDR2 NTSNSPS (SEQ ID NO: 19); and VL-CDR3: QQRSSYPLTF (SEQ ID NO: 17), with:
  • X 12 being absent or being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a LCVR which comprises the following three CDRs:
  • VL-CDR1 RASSSVS-X12-YMH (SEQ ID NO: 18); VL-CDR2: NTSNSPS (SEQ ID NO: 19); and
  • VL-CDR3 QQRSSYPLTF (SEQ ID NO: 17), with:
  • X 12 being absent or being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a LCVR which comprises at least one, preferably at least two, more preferably the following three CDRs: VL-CDR1: RASSSVSYMH (SEQ ID NO: 18);
  • VL-CDR2 NTSNSPS (SEQ ID NO: 19); and VL-CDR3: QQRSSYPLTF (SEQ ID NO: 17).
  • the antibody or binding fragment thereof comprises a LCVR which comprises the following three CDRs:
  • VL-CDR1 RASSSVSYMH (SEQ ID NO: 18);
  • VL-CDR2 NTSNSPS (SEQ ID NO: 19); and VL-CDR3: QQRSSYPLTF (SEQ ID NO: 17).
  • the antibody or binding fragment thereof comprises a LCVR which comprises at least one, preferably at least two, more preferably the following three CDRs: VL-CDR1: RASSSVS-X12-YMH (SEQ ID NO: 18);
  • VL-CDR2 NTSNSPS (SEQ ID NO: 19); and VL-CDR3: QQRSSYPLTF (SEQ ID NO: 17), with:
  • X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a LCVR which comprises the following three CDRs: VL-CDR1: RASSSVS-X12-YMH (SEQ ID NO: 18);
  • VL-CDR2 NTSNSPS (SEQ ID NO: 19); and VL-CDR3: QQRSSYPLTF (SEQ ID NO: 17), with:
  • the antibody or binding fragment thereof comprises a LCVR which comprises at least one, preferably at least two, more preferably the following three CDRs: VL-CDR1: RASSSVS-X12-YMH (SEQ ID NO: 18);
  • VL-CDR2 ATSNLQS (SEQ ID NO: 20); and VL-CDR3: QQRSSYPLTF (SEQ ID NO: 17), with:
  • X12 being absent or being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a LCVR which comprises the following three CDRs:
  • VL-CDR1 RASSSVS-X12-YMH (SEQ ID NO: 18);
  • VL-CDR2 ATSNLQS (SEQ ID NO: 20);
  • VL-CDR3 QQRSSYPLTF (SEQ ID NO: 17), with:
  • the antibody or binding fragment thereof comprises a LCVR which comprises at least one, preferably at least two, more preferably the following three CDRs: VL-CDR1: RASSSVSYMH (SEQ ID NO: 18);
  • VL-CDR2 ATSNLQS (SEQ ID NO: 20); and VL-CDR3: QQRSSYPLTF (SEQ ID NO: 17).
  • the antibody or binding fragment thereof comprises a LCVR which comprises the following three CDRs:
  • VL-CDR1 RASSSVSYMH (SEQ ID NO: 18);
  • VL-CDR2 ATSNLQS (SEQ ID NO: 20); and VL-CDR3: QQRSSYPLTF (SEQ ID NO: 17).
  • the antibody or binding fragment thereof comprises a LCVR which comprises at least one, preferably at least two, more preferably the following three CDRs: VL-CDR1: RASSSVS-X12-YMH (SEQ ID NO: 18);
  • VL-CDR2 ATSNLQS (SEQ ID NO: 20); and VL-CDR3: QQRSSYPLTF (SEQ ID NO: 17), with:
  • X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a LCVR which comprises the following three CDRs: VL-CDR1: RASSSVS-X12-YMH (SEQ ID NO: 18);
  • VL-CDR2 ATSNLQS (SEQ ID NO: 20); and VL-CDR3: QQRSSYPLTF (SEQ ID NO: 17), with:
  • the antibody or binding fragment thereof comprises a LCVR which comprises at least one, preferably at least two, more preferably the following three CDRs: VL-CDR1: RASSSVS-X12-YMH (SEQ ID NO: 18);
  • VL-CDR2 NTSNSPS (SEQ ID NO: 19); and VL-CDR3: HQRSSYPLTF (SEQ ID NO: 21), with:
  • Xi 2 being absent or being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a LCVR which comprises the following three CDRs: VL-CDR1: RASSSVS-X12-YMH (SEQ ID NO: 18);
  • VL-CDR2 NTSNSPS (SEQ ID NO: 19); and VL-CDR3: HQRSSYPLTF (SEQ ID NO: 21), with:
  • X 12 being absent or being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a LCVR which comprises at least one, preferably at least two, more preferably the following three CDRs: VL-CDRI: RASSSVSYMH (SEQ ID NO: 18);
  • VL-CDR2 NTSNSPS (SEQ ID NO: 19); and VL-CDR3: HQRSSYPLTF (SEQ ID NO: 21).
  • the antibody or binding fragment thereof comprises a LCVR which comprises the following three CDRs:
  • VL-CDRI RASSSVSYMH (SEQ ID NO: 18);
  • VL-CDR2 NTSNSPS (SEQ ID NO: 19); and VL-CDR3: HQRSSYPLTF (SEQ ID NO: 21).
  • the antibody or binding fragment thereof comprises a LCVR which comprises at least one, preferably at least two, more preferably the following three CDRs: VL-CDRI: RASSSVS-X12-YMH (SEQ ID NO: 18);
  • VL-CDR2 NTSNSPS (SEQ ID NO: 19); and VL-CDR3: HQRSSYPLTF (SEQ ID NO: 21), with:
  • X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a LCVR which comprises the following three CDRs:
  • VL-CDRI RASSSVS-X12-YMH (SEQ ID NO: 18);
  • VL-CDR2 NTSNSPS (SEQ ID NO: 19);
  • VL-CDR3 HQRSSYPLTF (SEQ ID NO: 21), with:
  • Xi2 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a LCVR which comprises at least one, preferably at least two, more preferably the following three CDRs: VL-CDR1: RASSSVS-X12-YMH (SEQ ID NO: 18);
  • VL-CDR2 NTSNRAT (SEQ ID NO: 22); and VL-CDR3: QQRSSYPLTF (SEQ ED NO: 17), with:
  • X12 being absent or being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a LCVR which comprises the following three CDRs:
  • VL-CDR1 RASSSVS-X12-YMH (SEQ ID NO: 18);
  • VL-CDR2 NTSNRAT (SEQ ID NO: 22);
  • VL-CDR3 QQRSSYPLTF (SEQ ID NO: 17), with:
  • X12 being absent or being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a LCVR which comprises at least one, preferably at least two, more preferably the following three CDRs: VL-CDR1: RASSSVSYMH (SEQ ID NO: 18);
  • VL-CDR2 NTSNRAT (SEQ ID NO: 22); and VL-CDR3: QQRSSYPLTF (SEQ ID NO: 17).
  • the antibody or binding fragment thereof comprises a LCVR which comprises the following three CDRs:
  • VL-CDR1 RASSSVSYMH (SEQ ID NO: 18);
  • VL-CDR2 NTSNRAT (SEQ ED NO: 22); and VL-CDR3: QQRSSYPLTF (SEQ ID NO: 17).
  • the antibody or binding fragment thereof comprises a LCVR which comprises at least one, preferably at least two, more preferably the following three CDRs: VL-CDR1: RASSSVS-X 12 -YMH (SEQ ID NO: 18);
  • VL-CDR2 NTSNRAT (SEQ ID NO: 22); and VL-CDR3: QQRSSYPLTF (SEQ ID NO: 17), with:
  • X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a LCVR which comprises the following three CDRs: VL-CDR1: RASSSVS-X12-YMH (SEQ ID NO: 18);
  • VL-CDR2 NTSNRAT (SEQ ID NO: 22); and VL-CDR3: QQRSSYPLTF (SEQ ID NO: 17), with:
  • X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a LCVR which comprises at least one, preferably at least two, more preferably the following three CDRs: VL-CDR1: RASSSVS-X12-YMH (SEQ ID NO: 18);
  • VL-CDR2 ATSNLPS (SEQ ID NO: 111); and VL-CDR3: QQRSSYPLTF (SEQ ID NO: 17), with:
  • X 12 being absent or being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a LCVR which comprises the following three CDRs:
  • VL-CDR1 RASSSVS-X12-YMH (SEQ ID NO: 18); VL-CDR2: ATSNLPS (SEQ ID NO: 111); and
  • VL-CDR3 QQRSSYPLTF (SEQ ID NO: 17), with:
  • X 12 being absent or being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a LCVR which comprises at least one, preferably at least two, more preferably the following three CDRs: VL-CDR1: RASSSVSYMH (SEQ ID NO: 18);
  • VL-CDR2 ATSNLPS (SEQ ID NO: 111); and VL-CDR3: QQRSSYPLTF (SEQ ID NO: 17).
  • the antibody or binding fragment thereof comprises a LCVR which comprises the following three CDRs:
  • VL-CDR1 RASSSVSYMH (SEQ ID NO: 18);
  • VL-CDR2 ATSNLPS (SEQ ID NO: 111); and VL-CDR3: QQRSSYPLTF (SEQ ID NO: 17).
  • the antibody or binding fragment thereof comprises a LCVR which comprises at least one, preferably at least two, more preferably the following three CDRs: VL-CDR1: RASSSVS-X12-YMH (SEQ ID NO: 18);
  • VL-CDR2 ATSNLPS (SEQ ID NO: 111); and VL-CDR3: QQRSSYPLTF (SEQ ID NO: 17), with:
  • X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a LCVR which comprises the following three CDRs: VL-CDR1: RASSSVS-X12-YMH (SEQ ID NO: 18);
  • VL-CDR2 ATSNLPS (SEQ ID NO: 111); and VL-CDR3: QQRSSYPLTF (SEQ ID NO: 17), with:
  • X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a LCVR which comprises at least one, preferably at least two, more preferably the following three CDRs: VL-CDR1: SASSSVS-X12-YMH (SEQ ID NO: 15);
  • VL-CDR2 NTANLPS (SEQ ID NO: 120); and VL-CDR3: QQRSSYPLTF (SEQ ID NO: 17), with:
  • Xi2 being absent or being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a LCVR which comprises the following three CDRs: VL-CDR1: SASSSYS-X12-YMH (SEQ ED NO: 15);
  • VL-CDR2 NTANLPS (SEQ ED NO: 120); and VL-CDR3: QQRSSYPLTF (SEQ ID NO: 17), with:
  • the antibody or binding fragment thereof comprises a LCVR which comprises at least one, preferably at least two, more preferably the following three CDRs: VL-CDR1: SASSSVS-X12-YMH (SEQ ID NO: 15);
  • VL-CDR2 NTANLPS (SEQ ID NO: 120); and VL-CDR3: QQRSSYPLTF (SEQ ID NO: 17),
  • the antibody or binding fragment thereof comprises a LCVR which comprises the following three CDRs:
  • VL-CDR1 SASSSVS-X12-YMH (SEQ ID NO: 15);
  • VL-CDR2 NTANLPS (SEQ ID NO: 120); and VL-CDR3: QQRSSYPLTF (SEQ ED NO: 17),
  • the antibody or binding fragment thereof comprises a LCVR which comprises at least one, preferably at least two, more preferably the following three CDRs: VL-CDRI: SASSSVS-X12-YMH (SEQ ID NO: 15);
  • VL-CDR2 NTANLPS (SEQ ID NO: 120); and VL-CDR3: QQRSSYPLTF (SEQ ED NO: 17), with:
  • X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a LCVR which comprises the following three CDRs:
  • VL-CDRI SASSSVS-X12-YMH (SEQ ID NO: 15); VL-CDR2: NTANLPS (SEQ ID NO: 120); and VL-CDR3: QQRSSYPLTF (SEQ ID NO: 17), with:
  • Xi2 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a LCVR which comprises at least one, preferably at least two, more preferably the following three CDRs: VL-CDR1: RASSSVS-X12-YMH (SEQ ID NO: 18);
  • VL-CDR2 X O -TSNLPS (SEQ ID NO: 127); and VL-CDR3: QQRSSYPLTF (SEQ ID NO: 17), with:
  • X12 being absent or being selected from Asn (N), Ser (S) and Gly (G), and Xi 3 being any amino acid but Ala (A) or Asn (N).
  • the antibody or binding fragment thereof comprises a LCVR which comprises the following three CDRs: VL-CDR1: RASSSVS-X12-YMH (SEQ ID NO: 18);
  • VL-CDR2 X B -TSNLPS (SEQ ID NO: 127); and VL-CDR3: QQRSSYPLTF (SEQ ID NO: 17), with:
  • X12 being absent or being selected from Asn (N), Ser (S) and Gly (G), and Xi3 being any amino acid but Ala (A) or Asn (N).
  • the antibody or binding fragment thereof comprises a LCVR which comprises at least one, preferably at least two, more preferably the following three CDRs: VL-CDR1: RASSSVSYMH (SEQ ID NO: 18);
  • VL-CDR2 X 13 -TSNLPS (SEQ ID NO: 127); and VL-CDR3: QQRSSYPLTF (SEQ ID NO: 17).
  • Xi 3 being any amino acid but Ala (A) or Asn (N).
  • the antibody or binding fragment thereof comprises a LCVR which comprises the following three CDRs: VL-CDR1: RASSSYSYMH (SEQ ID NO: 18); VL-CDR2: X O -TSNLPS (SEQ ID NO: 127); and
  • VL-CDR3 QQRSSYPLTF (SEQ ID NO: 17). with: Xi 3 being any amino acid but Ala (A) or Asn (N).
  • the antibody or binding fragment thereof comprises a LCVR which comprises at least one, preferably at least two, more preferably the following three CDRs:
  • VL-CDR1 RASSSVS-X12-YMH (SEQ ID NO: 18);
  • VL-CDR2 X 13 -TSNLPS (SEQ ID NO: 127);
  • VL-CDR3 QQRSSYPLTF (SEQ ID NO: 17), with:
  • X 12 being absent or being selected from Asn (N), Ser (S) and Gly (G), and Xi 3 being any amino acid but Ala (A) or Asn (N).
  • the antibody or binding fragment thereof comprises a LCVR which comprises the following three CDRs:
  • VL-CDR1 RASSSVS-X12-YMH (SEQ ID NO: 18);
  • VL-CDR2 X 13 -TSNLPS (SEQ ID NO: 127); and VL-CDR3: QQRSSYPLTF (SEQ ID NO: 17), with: X 12 being absent or being selected from Asn (N), Ser (S) and Gly (G), and
  • Xi 3 being any amino acid but Ala (A) or Asn (N).
  • the antibody or binding fragment thereof comprises: a HCVR which comprises at least one, preferably at least two, more preferably the following three CDRs:
  • VH-CDR1 NYYIG (SEQ ID NO: 1);
  • VH-CDR2 X 1 -IF-X 2 -GG-X 3 -Y-X 4 -N-X 5 -X 6 -X 7 -X 8 -X 9 -X 10 -G
  • VH-CDR3 RNFDY (SEQ ID NO: 3); and a LCVR which comprises at least one, preferably at least two, more preferably the following three CDRs: VL-CDR1: X 11 -ASSSYS-X 12 -YMH (SEQ ID NO: 12);
  • VL-CDR2 X13-TSN-X14-X15-X1 6 (SEQ ID NO: 13);
  • VL-CDR3 Xn-QRSSYPLTF (SEQ ID NO: 14), with: Xi being selected from Asp (D), He (I) and Arg (R);
  • X 2 being selected from Pro (P) and Ser (S);
  • X 3 being selected from Asp (D), Ser (S) and Gly (G);
  • X 4 being selected from Ala (A) and Thr (T);
  • X 5 being selected from Ser (S) and Tyr (Y); Xe being selected from Asn (N), Ala (A) and Ser (S);
  • X 7 being selected from Glu (E), Asp (D), Pro (P) and Gin (Q);
  • Xs being selected from Lys (K) and Ser (S);
  • X 9 being selected from Phe (F) and Yal (V);
  • X 10 being selected from Lys (K) and Gin (Q);
  • X 11 being selected from Ser (S) and Arg (R);
  • X 12 being absent or being selected from Asn (N), Ser (S) and Gly (G);
  • Xi 3 being selected from Asn (N) and Ala (A); or X 13 being any amino acid but Ala (A) or Asn (N);
  • Xi 4 being selected from Leu (L), Ser (S) and Arg (R); Xi 5 being selected from Pro (P), Ala (A) and Gin (Q);
  • Xi 6 being selected from Ser (S) and Thr (T); and Xi 7 being selected from Gin (Q) and His (H).
  • the antibody or binding fragment thereof comprises: a HCVR which comprises the following three CDRs: VH-CDR1: NYYIG (SEQ ID NO: 1);
  • VH-CDR2 X 1 -IF-X 2 -GG-X 3 -Y-X 4 -N-X 5 -X 6 -X 7 -X 8 -X 9 -X 10 -G (SEQ ID NO: 2); and VH-CDR3: RNFDY (SEQ ID NO: 3); and a LCVR which comprises the following three CDRs: VL-CDR1: X 11 -ASSSVS-X 12 -YMH (SEQ ID NO: 12);
  • VL-CDR2 X13-TSN-X14-X15-X1 6 (SEQ ID NO: 13); and VL-CDR3: Xn-QRSSYPLTF (SEQ ID NO: 14), with:
  • Xi being selected from Asp (D), Be (I) and Arg (R);
  • X 2 being selected from Pro (P) and Ser (S);
  • X 3 being selected from Asp (D), Ser (S) and Gly (G);
  • X 4 being selected from Ala (A) and Thr (T);
  • X 5 being selected from Ser (S) and Tyr (Y);
  • Xe being selected from Asn (N), Ala (A) and Ser (S);
  • X 7 being selected from Glu (E), Asp (D), Pro (P) and Gin (Q);
  • Xs being selected from Lys (K) and Ser (S);
  • X 9 being selected from Phe (F) and Yal (Y);
  • X10 being selected from Lys (K) and Gin (Q);
  • Xu being selected from Ser (S) and Arg (R);
  • X 12 being absent or being selected from Asn (N), Ser (S) and Gly (G);
  • Xi 3 being selected from Asn (N) and Ala (A); or X 13 being any amino acid but Ala (A) or Asn (N);
  • Xi 4 being selected from Leu (L), Ser (S) and Arg (R);
  • Xi5 being selected from Pro (P), Ala (A) and Gin (Q);
  • Xi6 being selected from Ser (S) and Thr (T); and Xi 7 being selected from Gin (Q) and His (H).
  • the antibody or binding fragment thereof comprises a combination of (i) at least one, preferably at least two, more preferably three HCVR’s CDRs and (ii) at least one, preferably at least two, more preferably three LCVR’s CDRs, said combination being as defined in Table 2.
  • the antibody or binding fragment thereof comprises a combination of (i) three HCVR’s CDRs and (ii) three LCVR’s CDRs, said combination being as defined in Table 2.
  • HCVR HCVR
  • LCVR LCVR
  • SEQ ID NOs SEQ ID NOs
  • X 12 being absent or being selected from Asn (N), Ser (S) and Gly (G); and X 13 being any amino acid but Ala (A) or Asn (N)).
  • any of V H -CDR1, Y H -CDR2, V H -CDR3, V L -CDR1, V L -CDR2 and/or V L -CDR3 as defined hereinabove can be characterized as having 1, 2, 3, 4, 5 or more amino acids being substituted by a different amino acid.
  • any of V H -CDR1, Y H -CDR2, V H -CDR3, V L -CDR1, V L -CDR2 and/or V L -CDR3 as defined hereinabove can be characterized as having an amino acid sequence that shares at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the particular CDR or sets of CDRs as defined hereinabove.
  • the antibody or binding fragment thereof comprises a combination of (i) at least one, preferably at least two, more preferably three HCVR’s CDRs and (ii) at least one, preferably at least two, more preferably three LCVR’s CDRs, said combination being selected from combinations #1, #2, #7, #14, #20, #26, #49, #50, #63, #65, #72, #79, #86 and #92 as defined in Table 2.
  • the antibody or binding fragment thereof comprises a combination of (i) three HCVR’s CDRs and (ii) three LCVR’s CDRs, said combination being selected from combinations #1, #2, #7, #14, #20, #26, #49, #50, #63, #65, #72, #79, #86 and #92 as defined in Table 2.
  • the antibody or binding fragment thereof comprises: a HCVR which comprises the following three CDRs:
  • VL-CDR1 selected from the group comprising or consisting of sequences SEQ ID NOs: 15 and 18, wherein X12 is absent or is selected from Asn (N),
  • VL-CDR2 selected from the group comprising or consisting of sequences SEQ ID NOs: 16, 111 and 120; and VL-CDR3 of sequence SEQ ID NO: 17.
  • the antibody or binding fragment thereof comprises: a HCVR which comprises the following three CDRs:
  • VH-CDR2 selected from the group comprising or consisting of sequences SEQ ID NOs: 4 and 5; and VH-CDR3 of sequence SEQ ID NO: 3; and a LCVR which comprises the following three CDRs:
  • the antibody or binding fragment thereof comprises: a HCVR which comprises the following three CDRs:
  • VH-CDR2 selected from the group comprising or consisting of sequences SEQ ID Nos: 4, 5, 6 and 100;
  • VL-CDR1 selected from the group comprising or consisting of sequences SEQ ID NOs: 15 and 18, wherein X12 is absent or is selected from Asn (N), Ser (S) and Gly (G), preferably X12 is absent;
  • the antibody or binding fragment thereof comprises: a HCVR which comprises the following three CDRs: VH-CDR1 of sequence SEQ ID NO: 1;
  • VH-CDR2 selected from the group comprising or consisting of sequences SEQ ID NOs: 4, 6 and 100; and VH-CDR3 of sequence SEQ ID NO: 3; and a LCVR which comprises the following three CDRs: VL-CDR1 selected from the group comprising or consisting of sequences
  • the antibody or binding fragment thereof comprises a combination of (i) at least one, preferably at least two, more preferably three HCVR’s CDRs and (ii) at least one, preferably at least two, more preferably three LCVR’s CDRs, said combination being combination #1 as defined in Table 2. In one embodiment, the antibody or binding fragment thereof comprises a combination of (i) three HCVR’s CDRs and (ii) three LCVR’s CDRs, said combination being combination #1 as defined in Table 2.
  • the antibody or binding fragment thereof comprises a combination of (i) three HCVR’s CDRs set forth as SEQ ID NOs: 1, 4 and 3; and (ii) three LCVR’s CDRs set forth as SEQ ID NOs: 15, 16 and 17; wherein Xu in SEQ ID NOs: 15 is absent or is selected from Asn (N), Ser (S) and Gly (G), preferably X12 is absent.
  • the antibody or binding fragment thereof comprises a combination of (i) at least one, preferably at least two, more preferably three HCVR’s CDRs and (ii) at least one, preferably at least two, more preferably three LCVR’s CDRs, said combination being combination #2 as defined in Table 2.
  • the antibody or binding fragment thereof comprises a combination of (i) three HCVR’s CDRs and (ii) three LCVR’s CDRs, said combination being combination #2 as defined in Table 2.
  • the antibody or binding fragment thereof comprises a combination of (i) three HCVR’s CDRs set forth as SEQ ID NOs: 1, 4 and 3; and (ii) three LCVR’s CDRs set forth as SEQ ID NOs: 18, 16 and 17; wherein X12 in SEQ ID NOs: 18 is absent or is selected from Asn (N), Ser (S) and Gly (G), preferably X12 is absent.
  • the antibody or binding fragment thereof comprises a combination of (i) at least one, preferably at least two, more preferably three HCVR’s CDRs and (ii) at least one, preferably at least two, more preferably three LCVR’s CDRs, said combination being combination #7 as defined in Table 2.
  • the antibody or binding fragment thereof comprises a combination of (i) three HCVR’s CDRs and (ii) three LCVR’s CDRs, said combination being combination #7 as defined in Table 2.
  • the antibody or binding fragment thereof comprises a combination of (i) three HCVR’s CDRs set forth as SEQ ID NOs: 1, 5 and 3; and (ii) three LCVR’s CDRs set forth as SEQ ID NOs: 15, 16 and 17; wherein X12 in SEQ ID NOs: 15 is absent or is selected from Asn (N), Ser (S) and Gly (G), preferably X12 is absent.
  • the antibody or binding fragment thereof comprises a combination of (i) at least one, preferably at least two, more preferably three HCVR’s CDRs and (ii) at least one, preferably at least two, more preferably three LCVR’s CDRs, said combination being combination #14 as defined in Table 2.
  • the antibody or binding fragment thereof comprises a combination of (i) three HCVR’s CDRs and (ii) three LCVR’s CDRs, said combination being combination #14 as defined in Table 2.
  • the antibody or binding fragment thereof comprises a combination of (i) three HCVR’s CDRs set forth as SEQ ID NOs: 1, 6 and 3; and (ii) three LCVR’s CDRs set forth as SEQ ID NOs: 18, 16 and 17; wherein X 12 in SEQ ID NOs: 18 is absent or is selected from Asn (N), Ser (S) and Gly (G), preferably X 12 is absent.
  • the antibody or binding fragment thereof comprises a combination of (i) at least one, preferably at least two, more preferably three HCVR’s CDRs and (ii) at least one, preferably at least two, more preferably three LCVR’s CDRs, said combination being combination #20 as defined in Table 2.
  • the antibody or binding fragment thereof comprises a combination of (i) three HCVR’s CDRs and (ii) three LCVR’s CDRs, said combination being combination #20 as defined in Table 2.
  • the antibody or binding fragment thereof comprises a combination of (i) three HCVR’s CDRs set forth as SEQ ID NOs: 1, 7 and 3; and (ii) three LCVR’s CDRs set forth as SEQ ID NOs: 18, 16 and 17; wherein X 12 in SEQ ID NOs: 18 is absent or is selected from Asn (N), Ser (S) and Gly (G), preferably X 12 is absent.
  • the antibody or binding fragment thereof comprises a combination of (i) at least one, preferably at least two, more preferably three HCVR’s CDRs and (ii) at least one, preferably at least two, more preferably three LCVR’s CDRs, said combination being combination #26 as defined in Table 2.
  • the antibody or binding fragment thereof comprises a combination of (i) three HCVR’s CDRs and (ii) three LCVR’s CDRs, said combination being combination #26 as defined in Table 2.
  • the antibody or binding fragment thereof comprises a combination of (i) three HCVR’s CDRs set forth as SEQ ID NOs: 1, 8 and 3; and (ii) three LCVR’s CDRs set forth as SEQ ID NOs: 18, 16 and 17; wherein Xo in SEQ ID NOs: 18 is absent or is selected from Asn (N), Ser (S) and Gly (G), preferably Xu is absent.
  • the antibody or binding fragment thereof comprises a combination of (i) at least one, preferably at least two, more preferably three HCVR’s CDRs and (ii) at least one, preferably at least two, more preferably three LCVR’s CDRs, said combination being combination #49 as defined in Table 2.
  • the antibody or binding fragment thereof comprises a combination of (i) three HCVR’s CDRs and (ii) three LCVR’s CDRs, said combination being combination #49 as defined in Table 2.
  • the antibody or binding fragment thereof comprises a combination of (i) three HCVR’s CDRs set forth as SEQ ID NOs: 1, 100 and 3; and (ii) three LCVR’s CDRs set forth as SEQ ID NOs: 15, 16 and 17; wherein X12 in SEQ ID NOs: 15 is absent or is selected from Asn (N), Ser (S) and Gly (G), preferably X12 is absent.
  • the antibody or binding fragment thereof comprises a combination of (i) at least one, preferably at least two, more preferably three HCVR’s CDRs and (ii) at least one, preferably at least two, more preferably three LCVR’s CDRs, said combination being combination #50 as defined in Table 2.
  • the antibody or binding fragment thereof comprises a combination of (i) three HCVR’s CDRs and (ii) three LCVR’s CDRs, said combination being combination #50 as defined in Table 2.
  • the antibody or binding fragment thereof comprises a combination of (i) three HCVR’s CDRs set forth as SEQ ID NOs: 1, 100 and 3; and (ii) three LCVR’s CDRs set forth as SEQ ID NOs: 18, 16 and 17; wherein X12 in SEQ ID NOs: 18 is absent or is selected from Asn (N), Ser (S) and Gly (G), preferably Xu is absent.
  • the antibody or binding fragment thereof comprises a combination of (i) at least one, preferably at least two, more preferably three HCVR’s CDRs and (ii) at least one, preferably at least two, more preferably three LCVR’s CDRs, said combination being combination #63 as defined in Table 2.
  • the antibody or binding fragment thereof comprises a combination of (i) three HCVR’s CDRs and (ii) three LCVR’s CDRs, said combination being combination #63 as defined in Table 2.
  • the antibody or binding fragment thereof comprises a combination of (i) three HCVR’s CDRs set forth as SEQ ID NOs: 1, 100 and 3; and (ii) three LCVR’s CDRs set forth as SEQ ID NOs: 18, 111 and 17; wherein X12 in SEQ ID NOs: 18 is absent or is selected from Asn (N), Ser (S) and Gly (G), preferably X 12 is absent.
  • the antibody or binding fragment thereof comprises a combination of (i) at least one, preferably at least two, more preferably three HCVR’s CDRs and (ii) at least one, preferably at least two, more preferably three LCVR’s CDRs, said combination being combination #65 as defined in Table 2.
  • the antibody or binding fragment thereof comprises a combination of (i) three HCVR’s CDRs and (ii) three LCVR’s CDRs, said combination being combination #65 as defined in Table 2.
  • the antibody or binding fragment thereof comprises a combination of (i) three HCVR’s CDRs set forth as SEQ ID NOs: 1, 116 and 3; and (ii) three LCVR’s CDRs set forth as SEQ ID NOs: 18, 16 and 17; wherein X 12 in SEQ ID NOs: 18 is absent or is selected from Asn (N), Ser (S) and Gly (G), preferably X 12 is absent.
  • the antibody or binding fragment thereof comprises a combination of (i) at least one, preferably at least two, more preferably three HCVR’s CDRs and (ii) at least one, preferably at least two, more preferably three LCVR’s CDRs, said combination being combination #72 as defined in Table 2.
  • the antibody or binding fragment thereof comprises a combination of (i) three HCVR’s CDRs and (ii) three LCVR’s CDRs, said combination being combination #72 as defined in Table 2.
  • the antibody or binding fragment thereof comprises a combination of (i) three HCVR’s CDRs set forth as SEQ ID NOs: 1, 117 and 3; and (ii) three LCVR’s CDRs set forth as SEQ ID NOs: 18, 16 and 17; wherein X12 in SEQ ID NOs: 18 is absent or is selected from Asn (N), Ser (S) and Gly (G), preferably X12 is absent.
  • the antibody or binding fragment thereof comprises a combination of (i) at least one, preferably at least two, more preferably three HCVR’s CDRs and (ii) at least one, preferably at least two, more preferably three LCVR’s CDRs, said combination being combination #79 as defined in Table 2.
  • the antibody or binding fragment thereof comprises a combination of (i) three HCVR’s CDRs and (ii) three LCVR’s CDRs, said combination being combination #79 as defined in Table 2.
  • the antibody or binding fragment thereof comprises a combination of (i) three HCVR’s CDRs set forth as SEQ ID NOs: 1, 118 and 3; and (ii) three LCVR’s CDRs set forth as SEQ ID NOs: 18, 16 and 17; wherein Xu in SEQ ID NOs: 18 is absent or is selected from Asn (N), Ser (S) and Gly (G), preferably X12 is absent.
  • the antibody or binding fragment thereof comprises a combination of (i) at least one, preferably at least two, more preferably three HCVR’s CDRs and (ii) at least one, preferably at least two, more preferably three LCVR’s CDRs, said combination being combination #86 as defined in Table 2.
  • the antibody or binding fragment thereof comprises a combination of (i) three HCVR’s CDRs and (ii) three LCVR’s CDRs, said combination being combination #86 as defined in Table 2.
  • the antibody or binding fragment thereof comprises a combination of (i) three HCVR’s CDRs set forth as SEQ ID NOs: 1, 119 and 3; and (ii) three LCVR’s CDRs set forth as SEQ ID NOs: 18, 16 and 17; wherein X12 in SEQ ID NOs: 18 is absent or is selected from Asn (N), Ser (S) and Gly (G), preferably Xu is absent.
  • the antibody or binding fragment thereof comprises a combination of (i) at least one, preferably at least two, more preferably three HCVR’s CDRs and (ii) at least one, preferably at least two, more preferably three LCVR’s CDRs, said combination being combination #92 as defined in Table 2.
  • the antibody or binding fragment thereof comprises a combination of (i) three HCVR’s CDRs and (ii) three LCVR’s CDRs, said combination being combination #92 as defined in Table 2.
  • the antibody or binding fragment thereof comprises a combination of (i) three HCVR’s CDRs set forth as SEQ ID NOs: 1, 4 and 3; and (ii) three LCVR’s CDRs set forth as SEQ ID NOs: 15, 120 and 17; wherein X12 in SEQ ID NOs: 15 is absent or is selected from Asn (N), Ser (S) and Gly (G), preferably X12 is absent.
  • the antibody or binding fragment thereof comprises a HCVR which comprises at least one, preferably at least two, more preferably at least three, even more preferably the four following framework regions (FRs):
  • VH-FR1 QVQLQQSGAELVRPGTSVKMSCKAAGYTFT (SEQ ID NO: 25);
  • VH-FR2 WVKQRPGHGLEWIG (SEQ ID NO: 26);
  • VH-FR3 KATLTADTSSSTAYMQLSSLTSEDSAIYYCVR (SEQ ID NO: 27); VH-FR4: WGQGTTLTVSS (SEQ ID NO: 28).
  • the antibody or binding fragment thereof comprises a HCVR which comprises the four following FRs:
  • VH-FR1 QVQLQQSGAELVRPGTSVKMSCKAAGYTFT (SEQ ID NO: 25);
  • VH-FR2 WVKQRPGHGLEWIG (SEQ ID NO: 26);
  • VH-FR3 KATLTADTSSSTAYMQLSSLTSEDSAIYYCVR (SEQ ID NO: 27);
  • VH-FR4 WGQGTTLTVSS (SEQ ID NO: 28).
  • the antibody or binding fragment thereof comprises a HCVR which comprises at least one, preferably at least two, more preferably at least three, even more preferably the four following FRs:
  • VH-FR1 QVQLVQSGAEVKKPGASVKVSCKASGYTFT (SEQ ID NO: 29);
  • VH-FR2 WVRQAPGQGLEWIG (SEQ ID NO: 30);
  • VH-FR3 RVTLTADTSISTAYMELSRLRSDDTYYYYCVR (SEQ ID NO: 31);
  • VH-FR4 WGQGTLVTVSS (SEQ ID NO: 32).
  • the antibody or binding fragment thereof comprises a HCVR which comprises the four following FRs: VH-FR1: QVQLVQSGAEVKKPGASVKVSCKASGYTFT (SEQ ID NO: 29);
  • VH-FR2 WVRQAPGQGLEWIG (SEQ ID NO: 30);
  • VH-FR3 RVTLTADTSISTAYMELSRLRSDDTVVYYCVR (SEQ ID NO: 31);
  • VH-FR4 WGQGTLVTVSS (SEQ ID NO: 32).
  • the antibody or binding fragment thereof comprises a HCVR which comprises at least one, preferably at least two, more preferably at least three, even more preferably the four following FRs:
  • VH-FR1 EVQLVQSGAEVKKPGESLKISCKASGYTFT (SEQ ID NO: 33);
  • VH-FR2 WVRQMPGKGLEWIG (SEQ ID NO: 34);
  • VH-FR3 QVTLSADKSISTAYLQLSSLKASDTAMYYCVR (SEQ ID NO: 35);
  • VH-FR4 WGQGTLVTVSS (SEQ ID NO: 32).
  • the antibody or binding fragment thereof comprises a HCVR which comprises the four following FRs:
  • VH-FR1 EVQLVQSGAEVKKPGESLKISCKASGYTFT (SEQ ID NO: 33);
  • VH-FR2 WVRQMPGKGLEWIG (SEQ ID NO: 34);
  • VH-FR3 QVTLSADKSISTAYLQLSSLKASDTAMYYCVR (SEQ ID NO: 35);
  • VH-FR4 WGQGTLVTVSS (SEQ ID NO: 32).
  • the antibody or binding fragment thereof comprises a HCVR which comprises at least one, preferably at least two, more preferably at least three, even more preferably the four following FRs: VH-FR1: QYQLYESGGGLVKPGGSLRLSCAASGYTFT (SEQ ID NO: 36); VH-FR2: WIRQAPGKGLEWIG (SEQ ID NO: 37);
  • VH-FR3 RFTLSADTAKNSAYLQMNSLRAEDTAVYYCVR (SEQ ID NO: 38); VH-FR4: WGQGTLVTVSS (SEQ ID NO: 32).
  • the antibody or binding fragment thereof comprises a HCVR which comprises the four following FRs:
  • VH-FR1 QVQLVESGGGLVKPGGSLRLSCAASGYTFT (SEQ ID NO: 36);
  • VH-FR2 WIRQAPGKGLEWIG (SEQ ID NO: 37);
  • VH-FR3 RFTLSADTAKNSAYLQMNSLRAEDTAVYYCVR (SEQ ID NO: 38); VH-FR4: WGQGTLVTVSS (SEQ ID NO: 32).
  • the antibody or binding fragment thereof comprises a HCVR which comprises at least one, preferably at least two, more preferably at least three, even more preferably the four following FRs:
  • VH-FR1 EVQLVQSGAEVKKPGESLKISCKGSGYTFT (SEQ ID NO: 39);
  • VH-FR2 WVRQMPGKGLEWIG (SEQ ID NO: 34);
  • VH-FR3 QVTLSADKSISTAYLQLSSLKASDTAMYYCVR (SEQ ID NO: 35);
  • VH-FR4 WGQGTLVTVSS (SEQ ID NO: 32).
  • the antibody or binding fragment thereof comprises a HCVR which comprises the four following FRs: VH-FR1 : EVQLVQSGAEVKKPGESLKISCKGSGYTFT (SEQ ID NO: 39);
  • VH-FR2 WVRQMPGKGLEWIG (SEQ ID NO: 34);
  • VH-FR3 QVTLSADKSISTAYLQLSSLKASDTAMYYCVR (SEQ ID NO: 35);
  • VH-FR4 WGQGTLVTVSS (SEQ ID NO: 32).
  • the antibody or binding fragment thereof comprises a HCVR which comprises at least one, preferably at least two, more preferably at least three, even more preferably the four following FRs:
  • VH-FR1 QVQLVESGGGLVKPGGSLRLSCAASGFTFS (SEQ ID NO: 40);
  • VH-FR2 WIRQAPGKGLEWIG (SEQ ID NO: 37);
  • VH-FR3 RFTLSADTAKNSLYLQMNSLRAEDTAVYYCVR (SEQ ID NO: 41); VH-FR4: WGQGTLVTVSS (SEQ ID NO: 32).
  • the antibody or binding fragment thereof comprises a HCVR which comprises the four following FRs:
  • VH-FRI QVQLVESGGGLVKPGGSLRLSCAASGFTFS (SEQ ID NO: 40); VH-FR2 : WHtQ APGKGLEWIG (SEQ ID NO: 37);
  • VH-FR3 RFTLSADTAKNSLYLQMNSLRAEDTAVYYCVR (SEQ ID NO: 41); VH-FR4: WGQGTLVTVSS (SEQ ID NO: 32).
  • the antibody or binding fragment thereof comprises a HCVR which comprises at least one, preferably at least two, more preferably at least three, even more preferably the four following FRs:
  • VH-FRI EVQLVQSGAEVKKPGESLKISCKGSGYSFT (SEQ ID NO: 42); VH-FR2: WVRQMPGKGLEWIG (SEQ ID NO: 34);
  • VH-FR3 QVTLSADKSISTAYLQLSSLKASDTAMYYCVR (SEQ ED NO: 35); VH-FR4: WGQGTLVTVSS (SEQ ID NO: 32).
  • the antibody or binding fragment thereof comprises a HCVR which comprises the four following FRs:
  • VH-FRI EVQLVQSGAEVKKPGESLKISCKGSGYSFT (SEQ ID NO: 42); VH-FR2: WVRQMPGKGLEWIG (SEQ ID NO: 34);
  • VH-FR3 QVTLSADKSISTAYLQLSSLKASDTAMYYCVR (SEQ ID NO: 35);
  • VH-FR4 WGQGTLVTVSS (SEQ ID NO: 32).
  • the antibody or binding fragment thereof comprises a HCVR which comprises at least one, preferably at least two, more preferably at least three, even more preferably the four following FRs:
  • VH-FRI QVQLVESGGGLVKPGGSLRLSCAASGFTFS (SEQ ID NO: 40); VH-FR2: WIRQAPGKGLEWVG (SEQ ID NO: 43);
  • VH-FR3 RFTLSADTAKNSLYLQMNSLRAEDTAVYYCVR (SEQ ID NO: 41); VH-FR4: WGQGTLVTVSS (SEQ ID NO: 32).
  • the antibody or binding fragment thereof comprises a HCVR which comprises the four following FRs: VH-FRI QYQLYESGGGLVKPGGSLRLSCAASGFTFS (SEQ ID NO: 40); VH-FR2: WIRQAPGKGLEWVG (SEQ ID NO: 43);
  • VH-FR3 RFTLSADTAKNSLYLQMNSLRAEDTAVYYCVR (SEQ ID NO: 41); VH-FR4: WGQGTLVTVSS (SEQ ID NO: 32).
  • the antibody or binding fragment thereof comprises a LCVR which comprises at least one, preferably at least two, more preferably at least three, even more preferably the four following FRs:
  • VL-FR1 QIVLTQSPTIMSASPGEKVTITC (SEQ ID NO: 44);
  • VL-FR2 WFQQKTGTSPRLWIY (SEQ ID NO: 45);
  • VL-FR3 GVPARFSGSGSGTS-Xis-SLTISRMEAEDAATYYC
  • VL-FR4 GAGTKLELK (SEQ ID NO: 47), with:
  • Xi 8 being selected from Tyr (Y) and Phe (F), preferably Xi 8 being Tyr (Y).
  • the antibody or binding fragment thereof comprises a LCVR which comprises the four following FRs:
  • VL-FR1 QIVLTQSPTIMSASPGEKVTITC (SEQ ID NO: 44);
  • VL-FR2 WFQQKTGTSPRLWIY (SEQ ID NO: 45);
  • VL-FR3 GVPARFSGSGSGTS-Xis-SLTISRMEAEDAATYYC (SEQ ID NO: 46);
  • VL-FR4 GAGTKLELK (SEQ ID NO: 47) with:
  • Xi 8 being selected from Tyr (Y) and Phe (F), preferably Xis being Tyr (Y).
  • the antibody or binding fragment thereof comprises a LCVR which comprises at least one, preferably at least two, more preferably at least three, even more preferably the four following FRs:
  • VL-FR1 DIQLTQSPSFLSASVGDRVTITC (SEQ ID NO: 48);
  • VL-FR2 WFQQKPGKAPKLWIY (SEQ ID NO: 49);
  • VL-FR3 GVPSRFSGSGSGTE-Xis-TLTISSLQPEDFATYYC (SEQ ID NO: 50); VL-FR4: GGGTKVEIK (SEQ ID NO: 51), with:
  • Xi 8 being selected from Tyr (Y) and Phe (F), preferably Xis being Tyr (Y).
  • the antibody or binding fragment thereof comprises a LCVR which comprises the four following FRs: VL-FR1: DIQLTQSPSFLSASVGDRVTITC (SEQ ID NO: 48);
  • VL-FR2 WFQQKPGKAPKLWIY (SEQ ID NO: 49);
  • VL-FR3 GVPSRFSGSGSGTE-X IS -TLTISSLQPEDFATYYC (SEQ ID NO: 50);
  • VL-FR4 GGGTKVEIK (SEQ ID NO: 51), with: Xi 8 being selected from Tyr (Y) and Phe (F), preferably Xis being Tyr (Y).
  • the antibody or binding fragment thereof comprises a LCVR which comprises at least one, preferably at least two, more preferably at least three, even more preferably the four following FRs:
  • VL-FR1 EIVLTQSPDFQSVTPKEKVTITC (SEQ ID NO: 52);
  • VL-FR2 WFQQKPDQSPKLWIY (SEQ ID NO: 53);
  • VL-FR3 GVPSRFSGSGSGTD-X IS -TLTINSLEAEDAATYYC (SEQ ID NO: 54);
  • VL-FR4 GGGTKVEIK (SEQ ID NO: 51), with:
  • Xis being selected from Tyr (Y) and Phe (F), preferably Xis being Tyr (Y).
  • the antibody or binding fragment thereof comprises a LCVR which comprises the four following FRs:
  • VL-FR1 EIVLTQSPDFQSVTPKEKVTITC (SEQ ID NO: 52);
  • VL-FR2 WFQQKPDQSPKLWIY (SEQ ID NO: 53);
  • VL-FR3 GVPSRFSGSGSGTD-Xis-TLTINSLEAEDAATYYC (SEQ ID NO: 54);
  • VL-FR4 GGGTKVEIK (SEQ ID NO: 51), with:
  • the antibody or binding fragment thereof comprises a LCVR which comprises at least one, preferably at least two, more preferably at least three, even more preferably the four following FRs:
  • VL-FR1 EIVLTQSPATLSLSPGERATLSC (SEQ ID NO: 55);
  • VL-FR2 WFQQKPGQAPRLWIY (SEQ ID NO: 56);
  • VL-FR3 GIPARFSGSGSGTD-X IS -TLTISSLEPEDFAYYYC (SEQ ID NO: 57);
  • VL-FR4 GGGTKVEIK (SEQ ED NO: 51), with:
  • Xi 8 being selected from Tyr (Y) and Phe (F), preferably Xi 8 being Tyr (Y).
  • the antibody or binding fragment thereof comprises a LCVR which comprises the four following FRs:
  • VL-FR1 EIVLTQSPATLSLSPGERATLSC (SEQ ID NO: 55);
  • VL-FR2 WFQQKPGQAPRLWIY (SEQ ID NO: 56);
  • VL-FR3 GIPARFSGSGSGTD-X IS -TLTISSLEPEDFAVYYC (SEQ ID NO: 57);
  • VL-FR4 GGGTKVEIK (SEQ ID NO: 51), with:
  • Xi 8 being selected from Tyr (Y) and Phe (F), preferably Xis being Tyr (Y).
  • the antibody or binding fragment thereof comprises a LCVR which comprises at least one, preferably at least two, more preferably at least three, even more preferably the four following FRs:
  • VL-FR1 DIQLTQSPSFLSASVGDRVTITC (SEQ ID NO: 48);
  • VL-FR2 WYQQKPGKAPKLWIY (SEQ ID NO: 58);
  • VL-FR3 GVPSRFSGSGSGTE-X 18 -TLTISSLQPEDFATYYC (SEQ ID NO: 50);
  • VL-FR4 GGGTKVEIK (SEQ ID NO: 51), with:
  • Xi 8 being selected from Tyr (Y) and Phe (F), preferably Xi 8 being Tyr (Y).
  • the antibody or binding fragment thereof comprises a LCVR which comprises the four following FRs:
  • VL-FR1 DIQLTQSPSFLSASVGDRVTITC (SEQ ID NO: 48); VL-FR2 : WYQQKPGKAPKLWIY (SEQ ID NO: 58); VL-FR3: GVPSRFSGSGSGTE-Xis-TLTISSLQPEDFATYYC (SEQ ID NO: 50); VL-FR4: GGGTKVEIK (SEQ ID NO: 51), with:
  • Xi 8 being selected from Tyr (Y) and Phe (F), preferably Xis being Tyr (Y).
  • the antibody or binding fragment thereof comprises a LCVR which comprises at least one, preferably at least two, more preferably at least three, even more preferably the four following FRs:
  • VL-FR1 DIQLTQSPSFLSASYGDRVTITC (SEQ ID NO: 48);
  • VL-FR2 WYQQKPGKAPKLWIY (SEQ ID NO: 58);
  • VL-FR3 GVPSRFSGSGSGTE-Xis-TLTISSLQPEDFATYYC (SEQ ID NO: 50); VL-FR4: GGGTKVEIK (SEQ ID NO: 51), with:
  • Xi 8 being selected from Tyr (Y) and Phe (F), preferably Xis being Phe (F).
  • the antibody or binding fragment thereof comprises a LCVR which comprises the four following FRs:
  • VL-FR1 DIQLTQSPSFLSASVGDRVTITC (SEQ ID NO: 48);
  • VL-FR2 WYQQKPGKAPKLWIY (SEQ ID NO: 58);
  • VL-FR3 GVPSRFSGSGSGTE-X IS -TLTISSLQPEDFATYYC (SEQ ID NO: 50);
  • VL-FR4 GGGTKVEIK (SEQ ID NO: 51), with:
  • Xi 8 being selected from Tyr (Y) and Phe (F), preferably Xis being Phe (F).
  • the antibody or binding fragment thereof comprises a LCVR which comprises at least one, preferably at least two, more preferably at least three, even more preferably the four following FRs:
  • VL-FR1 EIVLTQSPDFQSVTPKEKVTITC (SEQ ID NO: 52);
  • VL-FR2 WYQQKPDQSPKLWIY (SEQ ID NO: 59);
  • VL-FR3 GVPSRFSGSGSGTD-X IS -TLTINSLEAEDAATYYC (SEQ ID NO: 54);
  • VL-FR4 GGGTKVEIK (SEQ ID NO: 51), with:
  • Xis being selected from Tyr (Y) and Phe (F), preferably Xis being Phe (F).
  • the antibody or binding fragment thereof comprises a LCVR which comprises the four following FRs:
  • VL-FR1 EIVLTQSPDFQSVTPKEKYTITC (SEQ ID NO: 52);
  • VL-FR2 WYQQKPDQSPKLWIY (SEQ ID NO: 59);
  • VL-FR3 GVPSRFSGSGSGTD-X IS -TLTINSLEAEDAATYYC (SEQ ID NO: 54);
  • VL-FR4 GGGTKVEIK (SEQ ID NO: 51), with:
  • Xi 8 being selected from Tyr (Y) and Phe (F), preferably Xis being Phe (F).
  • the antibody or binding fragment thereof comprises a LCVR which comprises at least one, preferably at least two, more preferably at least three, even more preferably the four following FRs:
  • VL-FR1 EIVLTQSPATLSLSPGERATLSC (SEQ ID NO: 55);
  • VL-FR2 WYQQKPGQAPRLWIY (SEQ ID NO: 60);
  • VL-FR3 GIPARFSGSGSGTD-X IS -TLTISSLEPEDFAVYYC (SEQ ID NO: 57);
  • VL-FR4 GGGTKVEIK (SEQ ED NO: 51), with:
  • Xi 8 being selected from Tyr (Y) and Phe (F), preferably Xis being Phe (F).
  • the antibody or binding fragment thereof comprises a LCVR which comprises the four following FRs: VL-FR1: EIVLTQSPATLSLSPGERATLSC (SEQ ID NO: 55);
  • VL-FR2 WYQQKPGQAPRLWIY (SEQ ID NO: 60);
  • VL-FR3 GIPARFSGSGSGTD-Xis-TLTISSLEPEDFAVYYC (SEQ ID NO: 57);
  • VL-FR4 GGGTKVEIK (SEQ ID NO: 51), with: Xis being selected from Tyr (Y) and Phe (F), preferably Xis being Phe (F).
  • the antibody or binding fragment thereof comprises a LCVR which comprises at least one, preferably at least two, more preferably at least three, even more preferably the four following FRs:
  • VL-FR1 DIQLTQSPSFLSASVGDRVTITC (SEQ ID NO: 48); VL-FR2: WFQQKPGKAPKLWIY (SEQ ID NO: 49); VL-FR3: GVPSRFSGSGSGTE-X18-TLTISSLQPEDFATYYC (SEQ ID NO: 50); VL-FR4: GGGTKVEIK (SEQ ID NO: 51), with:
  • Xi 8 being selected from Tyr (Y) and Phe (F), preferably Xi 8 being Phe (F).
  • the antibody or binding fragment thereof comprises a LCVR which comprises the four following FRs:
  • VL-FR1 DIQLTQSPSFLSASYGDRVTITC (SEQ ID NO: 48);
  • VL-FR2 WFQQKPGKAPKLWIY (SEQ ID NO: 49);
  • VL-FR3 GVPSRFSGSGSGTE-X18-TLTISSLQPEDFATYYC (SEQ ID NO: 50); VL-FR4 : GGGTKVEIK (SEQ ID NO: 51), with:
  • Xi 8 being selected from Tyr (Y) and Phe (F), preferably Xi 8 being Phe (F).
  • the antibody or binding fragment thereof comprises a combination of (i) at least one, preferably at least two, more preferably at least three, even more preferably four HCVR’ s FRs and (ii) at least one, preferably at least two, more preferably at least three, even more preferably four LCVR’s FRs, said combination being as defined in Table 3.
  • the antibody or binding fragment thereof comprises a combination of (i) four HCVR’s FRs and (ii) four LCVR’s FRs, said combination being as defined in Table 3
  • HCVR HCVR
  • LCVR LCVR
  • any of V H -FR1, V H -FR2, V H -FR3, V H -FR4, V L -FR1, V L -FR2, V L -FR3 and/or V L -FR4 as defined hereinabove can be characterized as having 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more amino acids being substituted by a different amino acid.
  • any of V H -FR1, V H -FR2, V H -FR3, V H -FR4, V L -FR1, V L -FR2, Y L -FR3 and/or Y L -FR4 as defined hereinabove can be characterized as having an amino acid sequence that shares at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the particular FR or sets of FRs as defined hereinabove.
  • the antibody or binding fragment thereof comprises a HCVR comprising or consisting of: a V H -FR1 as described hereinabove, a V H -CDR1 as described hereinabove, a V H -FR2 as described hereinabove, a V H -CDR2 as described hereinabove, a V H -FR3 as described hereinabove, a V H -CDR3 as described hereinabove, and a V H -FR4 as described hereinabove.
  • a HCVR comprising or consisting of: a V H -FR1 as described hereinabove, a V H -CDR1 as described hereinabove, a V H -FR2 as described hereinabove, a V H -CDR2 as described hereinabove, a V H -FR3 as described hereinabove, a V H -CDR3 as described hereinabove, and a V H -FR4 as described hereinabove.
  • the antibody or binding fragment thereof comprises a HCVR comprising or consisting of: - a V H -FR1 selected from SEQ ID NOs 25, 29, 33, 36, 39, 40 and 42; a V H -CDR1 selected from SEQ ID NO 1; a V H -FR2 selected from SEQ ID NOs 26, 30, 34, 37 and 43; a V H -CDR2 selected from SEQ ID NO 2; a V H -FR3 selected from SEQ ID NOs 27, 31, 35, 38 and 41; a V H -CDR3 selected from SEQ ID NO 3; and a V H -FR4 selected from SEQ ID NOs 28 and 32.
  • a HCVR comprising or consisting of: - a V H -FR1 selected from SEQ ID NOs 25, 29, 33, 36, 39, 40 and 42; a V H -CDR1 selected from SEQ ID NO 1; a V H -FR2 selected from SEQ ID NOs 26, 30, 34, 37 and 43; a V H -
  • the antibody or binding fragment thereof comprises a HCVR comprising or consisting of: a V H -FR1 selected from SEQ ID NOs 25, 29, 33, 36, 39, 40 and 42; a V H -CDR1 selected from SEQ ID NO 1; a V H -FR2 selected from SEQ ED NOs 26, 30, 34, 37 and 43;
  • V H -CDR2 selected from SEQ ED NOs 4, 5, 6, 7, 8, 9, 10, 11, 100, 116, 117, 118 and 119; a V H -FR3 selected from SEQ ED NOs 27, 31, 35, 38 and 41; a V H -CDR3 selected from SEQ ID NO 3; and a V H -FR4 selected from SEQ ID NOs 28 and 32.
  • the antibody or binding fragment thereof comprises a HCVR comprising or consisting of a combination of a V H -FR1, a V H -CDR1, a V H -FR2, a V H -CDR2, a V H -FR3, a V H -CDR3 and a V H -FR4, said combination being as defined in
  • the antibody or binding fragment thereof comprises a HCVR comprising or consisting of the sequence SEQ ID NO: 61; or a HCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 61.
  • the antibody or binding fragment thereof comprises a HCVR comprising or consisting of the sequence SEQ ID NO: 62; or a HCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 62.
  • the antibody or binding fragment thereof comprises a HCVR comprising or consisting of the sequence SEQ ID NO: 63; or a HCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 63.
  • the antibody or binding fragment thereof comprises a HCVR comprising or consisting of the sequence SEQ ID NO: 64; or a HCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 64.
  • the antibody or binding fragment thereof comprises a HCVR comprising or consisting of the sequence SEQ ID NO: 65; or a HCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 65.
  • the antibody or binding fragment thereof comprises a HCVR comprising or consisting of the sequence SEQ ID NO: 66; or a HCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 66.
  • the antibody or binding fragment thereof comprises a HCVR comprising or consisting of the sequence SEQ ID NO: 67; or a HCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 67.
  • the antibody or binding fragment thereof comprises a HCVR comprising or consisting of the sequence SEQ ID NO: 68; or a HCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 68.
  • the antibody or binding fragment thereof comprises a HCVR comprising or consisting of the sequence SEQ ID NO: 69; or a HCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 69.
  • the antibody or binding fragment thereof comprises a HCVR comprising or consisting of the sequence SEQ ID NO: 70; or a HCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 70.
  • the antibody or binding fragment thereof comprises a HCVR comprising or consisting of the sequence SEQ ID NO: 101; or a HCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 101.
  • the antibody or binding fragment thereof comprises a HCVR comprising or consisting of the sequence SEQ ID NO: 121; or a HCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 121.
  • the antibody or binding fragment thereof comprises a HCVR comprising or consisting of the sequence SEQ ID NO: 122; or a HCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 122.
  • the antibody or binding fragment thereof comprises a HCVR comprising or consisting of the sequence SEQ ID NO: 123; or a HCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 123.
  • the antibody or binding fragment thereof comprises a HCVR comprising or consisting of the sequence SEQ ID NO: 124; or a HCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 124.
  • the antibody or binding fragment thereof comprises a LCVR comprising or consisting of: a V L -FRI as described hereinabove, a V L -CDR1 as described hereinabove, a V L -FR2 as described hereinabove, a V L -CDR2 as described hereinabove, a V L -FR3 as described hereinabove, a V L -CDR3 as described hereinabove, and a V L -FR4 as described hereinabove.
  • the antibody or binding fragment thereof comprises a HCVR comprising or consisting of: a V L -FRI selected from SEQ ID NOs 44, 48, 52 and 55; a V L -CDR1 selected from SEQ ID NO 12; a V L -FR2 selected from SEQ ID NOs 45, 49, 53, 56, 58, 59 and 60; a V L -CDR2 selected from SEQ ID NO 13; a V L -FR3 selected from SEQ ID NOs 46, 50, 54 and 57; a V L -CDR3 selected from SEQ ID NO 14; and a V L -FR4 selected from SEQ ID NOs 47 and 51.
  • the antibody or binding fragment thereof comprises a HCVR comprising or consisting of: a V L -FRI selected from SEQ ID NOs 44, 48, 52 and 55; a V L -CDRI selected from SEQ ID NOs 15 and 18; a V L -FR2 selected from SEQ ID NOs 45, 49, 53, 56, 58, 59 and 60;
  • V L -CDR2 selected from SEQ ID NOs 16, 19, 20, 22, 111 and 120; a V L -FR3 selected from SEQ ID NOs 46, 50, 54 and 57; a V L -CDR3 selected from SEQ ID NOs 17 and 21; and a V L -FR4 selected from SEQ ID NOs 47 and 51.
  • the antibody or binding fragment thereof comprises a LCVR comprising or consisting of a combination of a V L -FRI, a V L -CDRI, a V L -FR2, a Y L -CDR2, a V L -FR3, a Y L -CDR3 and a V L -FR4, said combination being as defined in
  • the CDRs and FRs are defined by their SEQ ID NOs.
  • the penultimate column refers to the SEQ ID NOs of the whole LCVR (with a first sequence number with X12 being absent or being selected from Asn (N), Ser (S) and Gly (G); and Xi 8 being selected from Tyr (Y) and Phe (F); and a second sequence number where preferred X12 and Xi8 are defined).
  • the antibody or binding fragment thereof comprises a LCVR comprising or consisting of a combination of a V L -FR1, a V L -CDR1, a V L -FR2, a V L -CDR2, a V L -FR3, a V L -CDR3 and a V L -FR4 as defined hereinabove, wherein Xis is Phe (F) if X12 is not absent ( i.e ., if X12 is any of Asn (N), Ser (S) or Gly (G)).
  • the antibody or binding fragment thereof comprises a LCVR comprising or consisting of a combination of a V L -FR1, a V L -CDR1, a V L -FR2, a V L -CDR2, a V L -FR3, a V L -CDR3 and a V L -FR4 as defined hereinabove, wherein Xis is selected from Tyr (Y) and Phe (F) if X12 is absent.
  • the antibody or binding fragment thereof comprises a LCVR comprising or consisting of the sequence SEQ ID NO: 71, with Xu being selected from Asn (N), Ser (S) and Gly (G); or a LCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 71.
  • the antibody or binding fragment thereof comprises a LCVR comprising or consisting of the sequence SEQ ID NO: 72, with X 12 being selected from Asn (N), Ser (S) and Gly (G) ; or a LCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 72.
  • the antibody or binding fragment thereof comprises a LCVR comprising or consisting of the sequence SEQ ID NO: 73, with X12 being selected from Asn (N), Ser (S) and Gly (G) ; or a LCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 73.
  • the antibody or binding fragment thereof comprises a LCVR comprising or consisting of the sequence SEQ ID NO: 74, with X12 being selected from Asn (N), Ser (S) and Gly (G) ; or a LCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 74.
  • the antibody or binding fragment thereof comprises a LCVR comprising or consisting of the sequence SEQ ID NO: 75, with X12 being selected from Asn (N), Ser (S) and Gly (G) ; or a LCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 75.
  • the antibody or binding fragment thereof comprises a LCVR comprising or consisting of the sequence SEQ ID NO: 76, with Xu being selected from
  • LCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 76.
  • the antibody or binding fragment thereof comprises a LCVR comprising or consisting of the sequence SEQ ID NO: 77, with X12 being selected from Asn (N), Ser (S) and Gly (G) ; or a LCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 77.
  • the antibody or binding fragment thereof comprises a LCVR comprising or consisting of the sequence SEQ ID NO: 78, with X12 being selected from Asn (N), Ser (S) and Gly (G) ; or a LCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 78.
  • the antibody or binding fragment thereof comprises a LCVR comprising or consisting of the sequence SEQ ID NO: 79, with X12 being selected from Asn (N), Ser (S) and Gly (G) ; or a LCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 79.
  • the antibody or binding fragment thereof comprises a LCVR comprising or consisting of the sequence SEQ ID NO: 80, with X12 being selected from Asn (N), Ser (S) and Gly (G) ; or a LCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 80.
  • the antibody or binding fragment thereof comprises a LCVR comprising or consisting of the sequence SEQ ID NO: 102, with X12 being selected from Asn (N), Ser (S) and Gly (G) ; or a LCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 102.
  • the antibody or binding fragment thereof comprises a LCVR comprising or consisting of the sequence SEQ ID NO: 112, with X12 being selected from Asn (N), Ser (S) and Gly (G) ; or a LCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 112.
  • the antibody or binding fragment thereof comprises a LCVR comprising or consisting of the sequence SEQ ID NO: 125, with X12 being selected from Asn (N), Ser (S) and Gly (G) ; or a LCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 125.
  • the antibody or binding fragment thereof comprises a LCVR comprising or consisting of the sequence SEQ ID NO: 128, with X 12 being selected from Asn (N), Ser (S) and Gly (G); and X 13 being any amino acid but Ala (A) or Asn (N); or a LCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 128.
  • the antibody or binding fragment thereof comprises a LCVR comprising or consisting of sequences SEQ ID NO: 71-80, 102, 112, 125 or 128, wherein Xi2 is absent.
  • the antibody or binding fragment thereof comprises a LCVR comprising or consisting of the sequence SEQ ID NO: 81; or a LCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 81.
  • the antibody or binding fragment thereof comprises a LCVR comprising or consisting of the sequence SEQ ID NO: 82; or a LCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%,
  • the antibody or binding fragment thereof comprises a LCVR comprising or consisting of the sequence SEQ ID NO: 83; or a LCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 83.
  • the antibody or binding fragment thereof comprises a LCVR comprising or consisting of the sequence SEQ ID NO: 84; or a LCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 84.
  • the antibody or binding fragment thereof comprises a LCVR comprising or consisting of the sequence SEQ ID NO: 85; or a LCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 85.
  • the antibody or binding fragment thereof comprises a LCVR comprising or consisting of the sequence SEQ ID NO: 86; or a LCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%,
  • the antibody or binding fragment thereof comprises a LCVR comprising or consisting of the sequence SEQ ID NO: 87; or a LCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 87.
  • the antibody or binding fragment thereof comprises a LCVR comprising or consisting of the sequence SEQ ID NO: 88; or a LCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 88.
  • the antibody or binding fragment thereof comprises a LCVR comprising or consisting of the sequence SEQ ID NO: 89; or a LCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 89.
  • the antibody or binding fragment thereof comprises a LCVR comprising or consisting of the sequence SEQ ID NO: 90; or a LCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 90.
  • the antibody or binding fragment thereof comprises a LCVR comprising or consisting of the sequence SEQ ID NO: 103; or a LCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 103.
  • the antibody or binding fragment thereof comprises a LCVR comprising or consisting of the sequence SEQ ID NO: 113; or a LCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 113.
  • the antibody or binding fragment thereof comprises a LCVR comprising or consisting of the sequence SEQ ID NO: 126; or a LCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 126.
  • the antibody or binding fragment thereof comprises a LCVR comprising or consisting of the sequence SEQ ID NO: 129, with X13 being any amino acid but Ala (A) or Asn (N); or a LCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NO: 129.
  • the antibody or binding fragment thereof comprises: a HCVR as defined hereinabove; and a LCVR as defined hereinabove.
  • the antibody or binding fragment thereof comprises:
  • a HCVR selected from SEQ ID NOs: 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 101, 121, 122, 123 and 124; or a HCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%,
  • LCVR selected from SEQ ED NOs: 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 102, 112, 125 and 128, with X12 being selected from Asn (N), Ser (S) and Gly (G), and
  • Xi 3 being any amino acid but Ala (A) or Asn (N); or a LCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NOs: 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 102,
  • the antibody or binding fragment thereof comprises:
  • - a HCVR selected from SEQ ID NOs: 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 101, 121, 122, 123 and 124; or a HCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NOs: 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 101, 121, 122, 123 or 124; and - a LCVR selected from SEQ ID NOs: 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 103,
  • Xu being any amino acid but Ala (A) or Asn (N); or a LCVR comprising or consisting of a sequence of the non-CDR regions sharing at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of identity with the sequence of the non-CDR regions of SEQ ID NOs: 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 103, 113, 126 or 129.
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 61 and a LCVR of SEQ ID NO: 71, with Xn being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 61 and a LCVR of SEQ ID NO: 72, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 61 and a LCVR of SEQ ID NO: 73, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 61 and a LCVR of SEQ ID NO: 74, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 61 and a LCVR of SEQ ID NO: 75, with Xn being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 61 and a LCVR of SEQ ID NO: 76, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 61 and a LCVR of SEQ ID NO: 77, with X12 being selected from Asn (N), Ser (S) and Gly (G). In one embodiment, the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 61 and a LCVR of SEQ ID NO: 78, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 61 and a LCVR of SEQ ID NO: 79, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 61 and a LCVR of SEQ ID NO: 80, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 61 and a LCVR of SEQ ID NO: 102, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 61 and a LCVR of SEQ ID NO: 112, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 61 and a LCVR of SEQ ID NO: 125, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 62 and a LCVR of SEQ ID NO: 71, with Xn being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 62 and a LCVR of SEQ ID NO: 72, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 62 and a LCVR of SEQ ID NO: 73, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 62 and a LCVR of SEQ ID NO: 74, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 62 and a LCVR of SEQ ID NO: 75, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 62 and a LCVR of SEQ ID NO: 76, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 62 and a LCVR of SEQ ID NO: 77, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 62 and a LCVR of SEQ ID NO: 78, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 62 and a LCVR of SEQ ID NO: 79, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 62 and a LCVR of SEQ ID NO: 80, with Xn being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 62 and a LCVR of SEQ ID NO: 102, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 62 and a LCVR of SEQ ID NO: 112, with X12 being selected from Asn (N), Ser (S) and Gly (G). In one embodiment, the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 62 and a LCVR of SEQ ID NO: 125, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 63 and a LCVR of SEQ ID NO: 71, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 63 and a LCVR of SEQ ID NO: 72, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 63 and a LCVR of SEQ ID NO: 73, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 63 and a LCVR of SEQ ID NO: 74, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 63 and a LCVR of SEQ ID NO: 75, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 63 and a LCVR of SEQ ID NO: 76, with Xn being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 63 and a LCVR of SEQ ID NO: 77, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 63 and a LCVR of SEQ ID NO: 78, with Xu being selected from Asn (N), Ser (S) and Gly (G). In one embodiment, the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 63 and a LCVR of SEQ ID NO: 79, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 63 and a LCVR of SEQ ID NO: 80, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 63 and a LCVR of SEQ ID NO: 102, with Xn being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 63 and a LCVR of SEQ ID NO: 112, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 63 and a LCVR of SEQ ID NO: 125, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 64 and a LCVR of SEQ ID NO: 71, with Xu being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 64 and a LCVR of SEQ ID NO: 72, with Xn being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 64 and a LCVR of SEQ ID NO: 73, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 64 and a LCVR of SEQ ID NO: 74, with X12 being selected from Asn (N), Ser (S) and Gly (G). In one embodiment, the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 64 and a LCVR of SEQ ID NO: 75, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 64 and a LCVR of SEQ ID NO: 76, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 64 and a LCVR of SEQ ID NO: 77, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 64 and a LCVR of SEQ ID NO: 78, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 64 and a LCVR of SEQ ID NO: 79, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 64 and a LCVR of SEQ ID NO: 80, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 64 and a LCVR of SEQ ID NO: 102, with Xu being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 64 and a LCVR of SEQ ID NO: 112, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 64 and a LCVR of SEQ ID NO: 125, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 65 and a LCVR of SEQ ID NO: 71, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 65 and a LCVR of SEQ ID NO: 72, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 65 and a LCVR of SEQ ID NO: 73, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 65 and a LCVR of SEQ ID NO: 74, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 65 and a LCVR of SEQ ID NO: 75, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 65 and a LCVR of SEQ ID NO: 76, withXu being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 65 and a LCVR of SEQ ID NO: 77, with Xn being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 65 and a LCVR of SEQ ID NO: 78, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 65 and a LCVR of SEQ ID NO: 79, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 65 and a LCVR of SEQ ID NO: 80, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 65 and a LCVR of SEQ ID NO: 102, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 65 and a LCVR of SEQ ID NO: 112, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 65 and a LCVR of SEQ ID NO: 125, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 66 and a LCVR of SEQ ID NO: 71, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 66 and a LCVR of SEQ ID NO: 72, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 66 and a LCVR of SEQ ID NO: 73, with Xn being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 66 and a LCVR of SEQ ID NO: 74, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 66 and a LCVR of SEQ ID NO: 75, with X12 being selected from Asn (N), Ser (S) and Gly (G). In one embodiment, the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 66 and a LCVR of SEQ ID NO: 76, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 66 and a LCVR of SEQ ID NO: 77, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 66 and a LCVR of SEQ ID NO: 78, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 66 and a LCVR of SEQ ID NO: 79, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 66 and a LCVR of SEQ ID NO: 80, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 66 and a LCVR of SEQ ID NO: 102, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 66 and a LCVR of SEQ ID NO: 112, with Xu being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 66 and a LCVR of SEQ ID NO: 125, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 67 and a LCVR of SEQ ID NO: 71, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 67 and a LCVR of SEQ ID NO: 72, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 67 and a LCVR of SEQ ID NO: 73, with Xu being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 67 and a LCVR of SEQ ID NO: 74, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 67 and a LCVR of SEQ ID NO: 75, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 67 and a LCVR of SEQ ID NO: 76, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 67 and a LCVR of SEQ ID NO: 77, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 67 and a LCVR of SEQ ID NO: 78, with Xn being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 67 and a LCVR of SEQ ID NO: 79, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 67 and a LCVR of SEQ ID NO: 80, with X12 being selected from Asn (N), Ser (S) and Gly (G). In one embodiment, the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 67 and a LCVR of SEQ ID NO: 102, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 67 and a LCVR of SEQ ID NO: 112, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 67 and a LCVR of SEQ ID NO: 125, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 68 and a LCVR of SEQ ID NO: 71, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 68 and a LCVR of SEQ ID NO: 72, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 68 and a LCVR of SEQ ID NO: 73, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 68 and a LCVR of SEQ ID NO: 74, with Xn being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 68 and a LCVR of SEQ ID NO: 75, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 68 and a LCVR of SEQ ID NO: 76, with X12 being selected from Asn (N), Ser (S) and Gly (G). In one embodiment, the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 68 and a LCVR of SEQ ID NO: 77, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 68 and a LCVR of SEQ ID NO: 78, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 68 and a LCVR of SEQ ID NO: 79, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 68 and a LCVR of SEQ ID NO: 80, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 68 and a LCVR of SEQ ID NO: 102, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 68 and a LCVR of SEQ ID NO: 112, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 68 and a LCVR of SEQ ID NO: 125, with Xu being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 69 and a LCVR of SEQ ID NO: 71, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 69 and a LCVR of SEQ ID NO: 72, with X12 being selected from Asn (N), Ser (S) and Gly (G). In one embodiment, the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 69 and a LCVR of SEQ ID NO: 73, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 69 and a LCVR of SEQ ID NO: 74, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 69 and a LCVR of SEQ ID NO: 75, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 69 and a LCVR of SEQ ID NO: 76, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 69 and a LCVR of SEQ ID NO: 77, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 69 and a LCVR of SEQ ID NO: 78, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 69 and a LCVR of SEQ ID NO: 79, with Xn being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 69 and a LCVR of SEQ ID NO: 80, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 69 and a LCVR of SEQ ID NO: 102, with X12 being selected from Asn (N), Ser (S) and Gly (G). In one embodiment, the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 69 and a LCVR of SEQ ID NO: 112, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 69 and a LCVR of SEQ ID NO: 125, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 70 and a LCVR of SEQ ID NO: 71, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 70 and a LCVR of SEQ ID NO: 72, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 70 and a LCVR of SEQ ID NO: 73, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 70 and a LCVR of SEQ ID NO: 74, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 70 and a LCVR of SEQ ID NO: 75, with Xn being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 70 and a LCVR of SEQ ID NO: 76, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 70 and a LCVR of SEQ ID NO: 77, with X12 being selected from Asn (N), Ser (S) and Gly (G). In one embodiment, the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 70 and a LCVR of SEQ ID NO: 78, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 70 and a LCVR of SEQ ID NO: 79, with Xu being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 70 and a LCVR of SEQ ID NO: 80, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 70 and a LCVR of SEQ ID NO: 102, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 70 and a LCVR of SEQ ID NO: 112, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 70 and a LCVR of SEQ ID NO: 125, with Xu being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 101 and a LCVR of SEQ ID NO: 71, with Xu being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 101 and a LCVR of SEQ ID NO: 72, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 101 and a LCVR of SEQ ID NO: 73, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 101 and a LCVR of SEQ ID NO: 74, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 101 and a LCVR of SEQ ID NO: 75, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 101 and a LCVR of SEQ ID NO: 76, with Xu being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 101 and a LCVR of SEQ ID NO: 77, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 101 and a LCVR of SEQ ID NO: 78, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 101 and a LCVR of SEQ ID NO: 79, with Xu being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 101 and a LCVR of SEQ ID NO: 80, with Xu being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 101 and a LCVR of SEQ ID NO: 102, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 101 and a LCVR of SEQ ID NO: 112, with X12 being selected from Asn (N), Ser (S) and Gly (G). In one embodiment, the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 101 and a LCVR of SEQ ID NO: 125, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 121 and a LCVR of SEQ ID NO: 71, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 121 and a LCVR of SEQ ID NO: 72, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 121 and a LCVR of SEQ ID NO: 73, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 121 and a LCVR of SEQ ID NO: 74, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 121 and a LCVR of SEQ ID NO: 75, with Xu being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 121 and a LCVR of SEQ ID NO: 76, with Xu being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 121 and a LCVR of SEQ ID NO: 77, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 121 and a LCVR of SEQ ID NO: 78, with X12 being selected from Asn (N), Ser (S) and Gly (G). In one embodiment, the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 121 and a LCVR of SEQ ID NO: 79, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 121 and a LCVR of SEQ ID NO: 80, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 121 and a LCVR of SEQ ID NO: 102, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 121 and a LCVR of SEQ ID NO: 112, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 121 and a LCVR of SEQ ID NO: 125, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 122 and a LCVR of SEQ ID NO: 71, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 122 and a LCVR of SEQ ID NO: 72, with Xu being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 122 and a LCVR of SEQ ID NO: 73, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 122 and a LCVR of SEQ ID NO: 74, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 122 and a LCVR of SEQ ID NO: 75, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 122 and a LCVR of SEQ ID NO: 76, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 122 and a LCVR of SEQ ID NO: 77, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 122 and a LCVR of SEQ ID NO: 78, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 122 and a LCVR of SEQ ID NO: 79, with Xu being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 122 and a LCVR of SEQ ID NO: 80, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 122 and a LCVR of SEQ ID NO: 102, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 122 and a LCVR of SEQ ID NO: 112, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 122 and a LCVR of SEQ ID NO: 125, with X 12 being selected from Asn (N), Ser (S) and Gly (G). In one embodiment, the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 123 and a LCVR of SEQ ID NO: 71, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 123 and a LCVR of SEQ ID NO: 72, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 123 and a LCVR of SEQ ID NO: 73, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 123 and a LCVR of SEQ ID NO: 74, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 123 and a LCVR of SEQ ID NO: 75, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 123 and a LCVR of SEQ ID NO: 76, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 123 and a LCVR of SEQ ID NO: 77, with Xu being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 123 and a LCVR of SEQ ID NO: 78, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 123 and a LCVR of SEQ ID NO: 79, with X12 being selected from Asn (N), Ser (S) and Gly (G). In one embodiment, the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 123 and a LCVR of SEQ ID NO: 80, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 123 and a LCVR of SEQ ID NO: 102, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 123 and a LCVR of SEQ ID NO: 112, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 123 and a LCVR of SEQ ID NO: 125, with Xu being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 124 and a LCVR of SEQ ID NO: 71, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 124 and a LCVR of SEQ ID NO: 72, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 124 and a LCVR of SEQ ID NO: 73, with Xu being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 124 and a LCVR of SEQ ID NO: 74, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 124 and a LCVR of SEQ ID NO: 75, with X12 being selected from Asn (N), Ser (S) and Gly (G). In one embodiment, the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 124 and a LCVR of SEQ ID NO: 76, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 124 and a LCVR of SEQ ID NO: 77, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 124 and a LCVR of SEQ ID NO: 78, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 124 and a LCVR of SEQ ID NO: 79, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 124 and a LCVR of SEQ ID NO: 80, with X 12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 124 and a LCVR of SEQ ID NO: 102, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 124 and a LCVR of SEQ ID NO: 112, with X12 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 124 and a LCVR of SEQ ID NO: 125, with X i2 being selected from Asn (N), Ser (S) and Gly (G).
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 61 and a LCVR of SEQ ID NO: 81.
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 61 and a LCVR of SEQ ID NO: 82.
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 61 and a LCVR of SEQ ID NO: 83.
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 61 and a LCVR of SEQ ID NO: 84. In one embodiment, the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 61 and a LCVR of SEQ ID NO: 85.
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 61 and a LCVR of SEQ ID NO: 86.
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 61 and a LCVR of SEQ ID NO: 87.
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 61 and a LCVR of SEQ ID NO: 88.
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 61 and a LCVR of SEQ ID NO: 89. In one embodiment, the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 61 and a LCVR of SEQ ID NO: 90.
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 61 and a LCVR of SEQ ID NO: 103. In one embodiment, the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 61 and a LCVR of SEQ ID NO: 113.
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 61 and a LCVR of SEQ ID NO: 126.
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 62 and a LCVR of SEQ ID NO: 81.
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 62 and a LCVR of SEQ ID NO: 82.
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 62 and a LCVR of SEQ ID NO: 83. In one embodiment, the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 62 and a LCVR of SEQ ID NO: 84.
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 62 and a LCVR of SEQ ID NO: 85.
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 62 and a LCVR of SEQ ID NO: 86.
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 62 and a LCVR of SEQ ID NO: 87.
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 62 and a LCVR of SEQ ID NO: 88. In one embodiment, the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 62 and a LCVR of SEQ ID NO: 89.
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 62 and a LCVR of SEQ ID NO: 90. In one embodiment, the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 62 and a LCVR of SEQ ID NO: 103.
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 62 and a LCVR of SEQ ID NO: 113.
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 62 and a LCVR of SEQ ID NO: 126.
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 63 and a LCVR of SEQ ID NO: 81.
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 63 and a LCVR of SEQ ID NO: 82. In one embodiment, the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 63 and a LCVR of SEQ ID NO: 83.
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 63 and a LCVR of SEQ ID NO: 84.
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 63 and a LCVR of SEQ ID NO: 85.
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 63 and a LCVR of SEQ ID NO: 86.
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 63 and a LCVR of SEQ ID NO: 87. In one embodiment, the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 63 and a LCVR of SEQ ID NO: 88.
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 63 and a LCVR of SEQ ID NO: 89. In one embodiment, the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 63 and a LCVR of SEQ ID NO: 90.
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 63 and a LCVR of SEQ ID NO: 103.
  • the antibody or binding fragment thereof comprises a HCVR of SEQ ID NO: 63 and a LCVR of SEQ ID NO: 113.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Medicinal Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Epidemiology (AREA)
  • Engineering & Computer Science (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Zoology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Cell Biology (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Transplantation (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • Wood Science & Technology (AREA)
  • Microbiology (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicinal Preparation (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
PCT/EP2021/057132 2020-03-20 2021-03-19 Chimeric antigen receptor specific for human cd45rc and uses thereof Ceased WO2021186056A1 (en)

Priority Applications (10)

Application Number Priority Date Filing Date Title
CA3172120A CA3172120A1 (en) 2020-03-20 2021-03-19 Chimeric antigen receptor specific for human cd45rc and uses thereof
CN202180036571.9A CN115916823A (zh) 2020-03-20 2021-03-19 人cd45rc特异的嵌合抗原受体及其用途
IL296546A IL296546A (en) 2020-03-20 2021-03-19 Chimeric receptor for human cd45rc-specific antigen and its uses
JP2022555951A JP7796034B2 (ja) 2020-03-20 2021-03-19 ヒトcd45rcに特異的なキメラ抗原受容体およびその使用
AU2021237790A AU2021237790A1 (en) 2020-03-20 2021-03-19 Chimeric antigen receptor specific for human CD45RC and uses thereof
EP21712190.4A EP4121457A1 (en) 2020-03-20 2021-03-19 Chimeric antigen receptor specific for human cd45rc and uses thereof
KR1020227036234A KR20230004510A (ko) 2020-03-20 2021-03-19 인간 cd45rc에 특이적인 키메라 항원 수용체 및 이의 용도
MX2022011683A MX2022011683A (es) 2020-03-20 2021-03-19 Receptor de antigeno quimerico especifico para cd45rc humano y usos del mismo.
US17/912,726 US20230147657A1 (en) 2020-03-20 2021-03-19 Chimeric antigen receptor specific for human cd45rc and uses thereof
BR112022018795A BR112022018795A2 (pt) 2020-03-20 2021-03-19 Receptor de antígeno quimérico específico para cd45rc humano e usos dos mesmos

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
EP20305298.0 2020-03-20
EP20305298 2020-03-20

Publications (1)

Publication Number Publication Date
WO2021186056A1 true WO2021186056A1 (en) 2021-09-23

Family

ID=71465223

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2021/057132 Ceased WO2021186056A1 (en) 2020-03-20 2021-03-19 Chimeric antigen receptor specific for human cd45rc and uses thereof

Country Status (11)

Country Link
US (1) US20230147657A1 (https=)
EP (1) EP4121457A1 (https=)
JP (1) JP7796034B2 (https=)
KR (1) KR20230004510A (https=)
CN (1) CN115916823A (https=)
AU (1) AU2021237790A1 (https=)
BR (1) BR112022018795A2 (https=)
CA (1) CA3172120A1 (https=)
IL (1) IL296546A (https=)
MX (1) MX2022011683A (https=)
WO (1) WO2021186056A1 (https=)

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2024249954A1 (en) 2023-05-31 2024-12-05 Capstan Therapeutics, Inc. Lipid nanoparticle formulations and compositions
WO2025076127A1 (en) 2023-10-05 2025-04-10 Capstan Therapeutics, Inc. Constrained ionizable cationic lipids and lipid nanoparticles
WO2025076113A1 (en) 2023-10-05 2025-04-10 Capstan Therapeutics, Inc. Ionizable cationic lipids with conserved spacing and lipid nanoparticles
WO2025179294A2 (en) 2024-02-22 2025-08-28 Capstan Therapeutics, Inc. Immune engineering amplification
WO2025217454A2 (en) 2024-04-11 2025-10-16 Capstan Therapeutics, Inc. Ionizable cationic lipids and lipid nanoparticles
WO2025217452A1 (en) 2024-04-11 2025-10-16 Capstan Therapeutics, Inc. Constrained ionizable cationic lipids and lipid nanoparticles

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20230032871A1 (en) * 2021-07-14 2023-02-02 Innovative Cellular Therapeutics Holdings, Ltd. Recombinant Viral Particle for Gene and/or Cellular Therapy

Citations (40)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
EP0404097A2 (de) 1989-06-22 1990-12-27 BEHRINGWERKE Aktiengesellschaft Bispezifische und oligospezifische, mono- und oligovalente Rezeptoren, ihre Herstellung und Verwendung
WO1993011161A1 (en) 1991-11-25 1993-06-10 Enzon, Inc. Multivalent antigen-binding proteins
US5350674A (en) 1992-09-04 1994-09-27 Becton, Dickinson And Company Intrinsic factor - horse peroxidase conjugates and a method for increasing the stability thereof
US5585362A (en) 1989-08-22 1996-12-17 The Regents Of The University Of Michigan Adenovirus vectors for gene therapy
US5831012A (en) 1994-01-14 1998-11-03 Pharmacia & Upjohn Aktiebolag Bacterial receptor structures
US5858358A (en) 1992-04-07 1999-01-12 The United States Of America As Represented By The Secretary Of The Navy Methods for selectively stimulating proliferation of T cells
WO2001029058A1 (en) 1999-10-15 2001-04-26 University Of Massachusetts Rna interference pathway genes as tools for targeted genetic interference
US6326193B1 (en) 1999-11-05 2001-12-04 Cambria Biosciences, Llc Insect control agent
WO2001096584A2 (en) 2000-06-12 2001-12-20 Akkadix Corporation Materials and methods for the control of nematodes
US6352694B1 (en) 1994-06-03 2002-03-05 Genetics Institute, Inc. Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells
US6534055B1 (en) 1988-11-23 2003-03-18 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
US6692964B1 (en) 1995-05-04 2004-02-17 The United States Of America As Represented By The Secretary Of The Navy Methods for transfecting T cells
US6703199B1 (en) 1997-06-12 2004-03-09 Research Corporation Technologies, Inc. Artificial antibody polypeptides
US20040101519A1 (en) 2002-01-03 2004-05-27 The Trustees Of The University Of Pennsylvania Activation and expansion of T-cells using an engineered multivalent signaling platform as a research tool
US6797514B2 (en) 2000-02-24 2004-09-28 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US6867041B2 (en) 2000-02-24 2005-03-15 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US6905874B2 (en) 2000-02-24 2005-06-14 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US6905680B2 (en) 1988-11-23 2005-06-14 Genetics Institute, Inc. Methods of treating HIV infected subjects
US20060034810A1 (en) 2004-05-27 2006-02-16 The Trustees Of The University Of Pennsylvania Novel artificial antigen presenting cells and uses therefor
US20060121005A1 (en) 2000-02-24 2006-06-08 Xcyte Therapies, Inc. Activation and expansion of cells
US7067318B2 (en) 1995-06-07 2006-06-27 The Regents Of The University Of Michigan Methods for transfecting T cells
US20060200869A1 (en) 2003-04-24 2006-09-07 Luigi Naldini Lentiviral vectors carrying synthetic bi-directional promoters and uses thereof
US7175843B2 (en) 1994-06-03 2007-02-13 Genetics Institute, Llc Methods for selectively stimulating proliferation of T cells
US20070036773A1 (en) 2005-08-09 2007-02-15 City Of Hope Generation and application of universal T cells for B-ALL
US20070191272A1 (en) 2005-09-27 2007-08-16 Stemmer Willem P Proteinaceous pharmaceuticals and uses thereof
WO2007110785A2 (en) 2006-02-15 2007-10-04 Invitrogen Dynal As Methods and materials for the generation of regulatory t cells
US20110158957A1 (en) 2009-11-10 2011-06-30 Sangamo Biosciences, Inc. Targeted disruption of T cell receptor genes using engineered zinc finger protein nucleases
US20120060230A1 (en) 2010-07-21 2012-03-08 Trevor Collingwood Methods and compositions for modification of a hla locus
WO2012138475A1 (en) 2011-04-08 2012-10-11 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Anti-epidermal growth factor receptor variant iii chimeric antigen receptors and use of same for the treatment of cancer
US20120321667A1 (en) 2009-10-29 2012-12-20 Sentman Charles L T cell receptor-deficient t cell compositions
US20140068797A1 (en) 2012-05-25 2014-03-06 University Of Vienna Methods and compositions for rna-directed target dna modification and for rna-directed modulation of transcription
US8697359B1 (en) 2012-12-12 2014-04-15 The Broad Institute, Inc. CRISPR-Cas systems and methods for altering expression of gene products
US8795965B2 (en) 2012-12-12 2014-08-05 The Broad Institute, Inc. CRISPR-Cas component systems, methods and compositions for sequence manipulation
US8865406B2 (en) 2012-12-12 2014-10-21 The Broad Institute Inc. Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation
WO2016016442A1 (en) 2014-08-01 2016-02-04 INSERM (Institut National de la Santé et de la Recherche Médicale) An anti-cd45rc antibody for use as drug
WO2017149515A1 (en) * 2016-03-04 2017-09-08 Novartis Ag Cells expressing multiple chimeric antigen receptor (car) molecules and uses therefore
WO2019012024A1 (en) * 2017-07-13 2019-01-17 INSERM (Institut National de la Santé et de la Recherche Médicale) METHODS FOR INCREASING EXPANSION AND IMMUNOSUPPRESSIVE CAPACITY OF A CD8 + CD45RCBAS TREGS POPULATION / -
WO2019115791A1 (en) 2017-12-15 2019-06-20 INSERM (Institut National de la Santé et de la Recherche Médicale) Treatment of monogenic diseases with an anti-cd45rc antibody
EP3626265A1 (en) * 2018-09-21 2020-03-25 INSERM (Institut National de la Santé et de la Recherche Médicale) Anti-human cd45rc antibodies and uses thereof

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20180334490A1 (en) * 2014-12-03 2018-11-22 Qilong H. Wu Methods for b cell preconditioning in car therapy

Patent Citations (49)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US6534055B1 (en) 1988-11-23 2003-03-18 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
US6887466B2 (en) 1988-11-23 2005-05-03 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
US6905680B2 (en) 1988-11-23 2005-06-14 Genetics Institute, Inc. Methods of treating HIV infected subjects
US7144575B2 (en) 1988-11-23 2006-12-05 The Regents Of The University Of Michigan Methods for selectively stimulating proliferation of T cells
US5883223A (en) 1988-11-23 1999-03-16 Gray; Gary S. CD9 antigen peptides and antibodies thereto
US7232566B2 (en) 1988-11-23 2007-06-19 The United States As Represented By The Secretary Of The Navy Methods for treating HIV infected subjects
EP0404097A2 (de) 1989-06-22 1990-12-27 BEHRINGWERKE Aktiengesellschaft Bispezifische und oligospezifische, mono- und oligovalente Rezeptoren, ihre Herstellung und Verwendung
US5585362A (en) 1989-08-22 1996-12-17 The Regents Of The University Of Michigan Adenovirus vectors for gene therapy
WO1993011161A1 (en) 1991-11-25 1993-06-10 Enzon, Inc. Multivalent antigen-binding proteins
US5858358A (en) 1992-04-07 1999-01-12 The United States Of America As Represented By The Secretary Of The Navy Methods for selectively stimulating proliferation of T cells
US5350674A (en) 1992-09-04 1994-09-27 Becton, Dickinson And Company Intrinsic factor - horse peroxidase conjugates and a method for increasing the stability thereof
US5831012A (en) 1994-01-14 1998-11-03 Pharmacia & Upjohn Aktiebolag Bacterial receptor structures
US7175843B2 (en) 1994-06-03 2007-02-13 Genetics Institute, Llc Methods for selectively stimulating proliferation of T cells
US6352694B1 (en) 1994-06-03 2002-03-05 Genetics Institute, Inc. Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells
US6905681B1 (en) 1994-06-03 2005-06-14 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
US7172869B2 (en) 1995-05-04 2007-02-06 The United States Of America As Represented By The Secretary Of The Navy Methods for transfecting T cells
US6692964B1 (en) 1995-05-04 2004-02-17 The United States Of America As Represented By The Secretary Of The Navy Methods for transfecting T cells
US7067318B2 (en) 1995-06-07 2006-06-27 The Regents Of The University Of Michigan Methods for transfecting T cells
US6703199B1 (en) 1997-06-12 2004-03-09 Research Corporation Technologies, Inc. Artificial antibody polypeptides
WO2001029058A1 (en) 1999-10-15 2001-04-26 University Of Massachusetts Rna interference pathway genes as tools for targeted genetic interference
US6326193B1 (en) 1999-11-05 2001-12-04 Cambria Biosciences, Llc Insect control agent
US6867041B2 (en) 2000-02-24 2005-03-15 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US6797514B2 (en) 2000-02-24 2004-09-28 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US6905874B2 (en) 2000-02-24 2005-06-14 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US20060121005A1 (en) 2000-02-24 2006-06-08 Xcyte Therapies, Inc. Activation and expansion of cells
WO2001096584A2 (en) 2000-06-12 2001-12-20 Akkadix Corporation Materials and methods for the control of nematodes
US20040101519A1 (en) 2002-01-03 2004-05-27 The Trustees Of The University Of Pennsylvania Activation and expansion of T-cells using an engineered multivalent signaling platform as a research tool
US20060200869A1 (en) 2003-04-24 2006-09-07 Luigi Naldini Lentiviral vectors carrying synthetic bi-directional promoters and uses thereof
US20060034810A1 (en) 2004-05-27 2006-02-16 The Trustees Of The University Of Pennsylvania Novel artificial antigen presenting cells and uses therefor
US20070036773A1 (en) 2005-08-09 2007-02-15 City Of Hope Generation and application of universal T cells for B-ALL
US20070191272A1 (en) 2005-09-27 2007-08-16 Stemmer Willem P Proteinaceous pharmaceuticals and uses thereof
WO2007110785A2 (en) 2006-02-15 2007-10-04 Invitrogen Dynal As Methods and materials for the generation of regulatory t cells
US20160024470A1 (en) 2006-02-15 2016-01-28 Life Technologies As Methods and materials for the generation of regulatory t cells
US20120321667A1 (en) 2009-10-29 2012-12-20 Sentman Charles L T cell receptor-deficient t cell compositions
US20110158957A1 (en) 2009-11-10 2011-06-30 Sangamo Biosciences, Inc. Targeted disruption of T cell receptor genes using engineered zinc finger protein nucleases
US20120060230A1 (en) 2010-07-21 2012-03-08 Trevor Collingwood Methods and compositions for modification of a hla locus
WO2012138475A1 (en) 2011-04-08 2012-10-11 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Anti-epidermal growth factor receptor variant iii chimeric antigen receptors and use of same for the treatment of cancer
US20140068797A1 (en) 2012-05-25 2014-03-06 University Of Vienna Methods and compositions for rna-directed target dna modification and for rna-directed modulation of transcription
US8871445B2 (en) 2012-12-12 2014-10-28 The Broad Institute Inc. CRISPR-Cas component systems, methods and compositions for sequence manipulation
US8795965B2 (en) 2012-12-12 2014-08-05 The Broad Institute, Inc. CRISPR-Cas component systems, methods and compositions for sequence manipulation
US8865406B2 (en) 2012-12-12 2014-10-21 The Broad Institute Inc. Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation
US8771945B1 (en) 2012-12-12 2014-07-08 The Broad Institute, Inc. CRISPR-Cas systems and methods for altering expression of gene products
US8697359B1 (en) 2012-12-12 2014-04-15 The Broad Institute, Inc. CRISPR-Cas systems and methods for altering expression of gene products
WO2016016442A1 (en) 2014-08-01 2016-02-04 INSERM (Institut National de la Santé et de la Recherche Médicale) An anti-cd45rc antibody for use as drug
WO2017149515A1 (en) * 2016-03-04 2017-09-08 Novartis Ag Cells expressing multiple chimeric antigen receptor (car) molecules and uses therefore
WO2019012024A1 (en) * 2017-07-13 2019-01-17 INSERM (Institut National de la Santé et de la Recherche Médicale) METHODS FOR INCREASING EXPANSION AND IMMUNOSUPPRESSIVE CAPACITY OF A CD8 + CD45RCBAS TREGS POPULATION / -
WO2019115791A1 (en) 2017-12-15 2019-06-20 INSERM (Institut National de la Santé et de la Recherche Médicale) Treatment of monogenic diseases with an anti-cd45rc antibody
EP3626265A1 (en) * 2018-09-21 2020-03-25 INSERM (Institut National de la Santé et de la Recherche Médicale) Anti-human cd45rc antibodies and uses thereof

Non-Patent Citations (111)

* Cited by examiner, † Cited by third party
Title
"UniProt", Database accession no. P08575-10
ABHINANDANMARTIN, PROTEIN ENGDES SEL., vol. 23, no. 9, 2010, pages 689 - 97
AL-LAZIKANI ET AL., JMB, vol. 273, 1997, pages 927 - 948
ALTSCHUL ET AL., J MOLBIOL., vol. 215, no. 3, 1990, pages 403 - 10
BARRANGOU ET AL., SCIENCE, vol. 315, 2007, pages 1709 - 1712
BATZER ET AL., NUCLEIC ACID RES., vol. 19, 1991, pages 5081
BERG ET AL., TRANSPLANT PROC., vol. 30, no. 8, 1998, pages 3975 - 3977
BEZIE ET AL., FRONT IMMUNOL., vol. 8, 2018, pages 2014
BINZ ET AL., JMOL BIOL., vol. 332, no. 2, 2003, pages 489 - 503
BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426
BIRKELAND ET AL., PROC NATL ACAD SCI US A., vol. 86, no. 17, 1989, pages 6734 - 8
BITINAITE ET AL., PROC. NATL. ACAD. SCI. USA, vol. 95, 1998, pages 10570 - 5
BOISSEL ET AL., NUCLEIC ACIDS RES., vol. 42, no. 4, 2014, pages 2591 - 601
CARILLO ET AL., SIAM JAPPLMATH., vol. 48, no. 5, 1988, pages 1073 - 82
CARROLL ET AL., GENETICS SOCIETY OF AMERICA, vol. 188, 2011, pages 773 - 782
CATHOMEN ET AL., MOL. THER., vol. 16, 2008, pages 1200 - 7
CERMAK ET AL., NUCL. ACIDS RES., vol. 39, 2011, pages e82
CHEVALIER ET AL., J MOL BIOL, vol. 329, no. 2, 2003, pages 253 - 269
CHEVALIER ET AL.: "Homing Endonucleases and Inteins", NUCLEIC ACIDS AND MOLECULAR BIOLOGY, vol. 16, 2005
CHOTHIALESK, J MOL BIOL., vol. 196, no. 4, 1987, pages 901 - 17
CLACKSON ET AL., NATURE, vol. 352, no. 6336, 1991, pages 624 - 8
COUGOT ET AL., TRENDS IN BIOCHEM. SCI., vol. 29, 2001, pages 436 - 444
DALGAARD ET AL., NUCLEIC ACIDS RES., vol. 25, no. 22, 1997, pages 4626 - 38
DELGADO ET AL., BR J CANCER, vol. 73, no. 2, 1996, pages 175 - 82
DESAI ET AL., EMBO J., vol. 13, no. 17, 1994, pages 4002 - 10
DEVEREUX ET AL., NUCLEIC ACIDS RES., vol. 12, no. 1, 1984, pages 387 - 95
DOYON ET AL., NATURE METHODS, vol. 8, 2010, pages 74 - 79
ELANGO ET AL., BIOCHIM. BIOPHYS. RES. COMMUN., vol. 330, 2005, pages 958 - 966
ELODIE PICARDA ET AL: "Transient antibody targeting of CD45RC induces transplant tolerance and potent antigen-specific regulatory T cells", JCI INSIGHT, vol. 2, no. 3, 9 February 2017 (2017-02-09), XP055601701, DOI: 10.1172/jci.insight.90088 *
FLICK ET AL., NATURE, vol. 394, no. 6688, 1998, pages 96 - 101
FREJDKIM, EXP MOL MED., vol. 49, no. 3, 2017, pages e306
GARLAND ET AL., J. IMMUNOL METH., vol. 227, no. 1-2, 1999, pages 53 - 63
GARNETT ET AL., THER ADV HEMATOL., vol. 4, no. 6, 2013, pages 366 - 378
GEIBLER ET AL., PLOS ONE, vol. 6, 2011, pages e19509
GHOSH ET AL., GLYCOBIOLOGY, vol. 5, 1991, pages 505 - 10
GRISSA ET AL., BMC BIOINFORMATICS, vol. 8, 2007, pages 172
GUILLONNEAU ET AL., J CLIN INVEST., vol. 117, no. 4, 2007, pages 1096 - 106
HAANEN ET AL., J. EXP. MED., vol. 190, no. 9, 1999, pages 1319 - 1328
HALL ET AL., J IMMUNOL., vol. 141, no. 8, 1988, pages 2781 - 7
HARLOW ET AL.: "Antibodies: A Laboratory Manual", 1989, COLD SPRING HARBOR
HERMISTON ET AL., ANNU REV IMMUNOL., vol. 21, 2003, pages 107 - 37
HOCKEMEYER ET AL., NATURE BIOTECH., vol. 29, 2011, pages 149 - 734
HOLLIGER ET AL., PROC NATL A CAD SCI USA, vol. 90, no. 14, 1993, pages 6444 - 8
HOLLINGERHUDSON, NATURE BIOTECHNOLOGY, vol. 23, 2005, pages 1126 - 1136
HOLMES, IMMUNOLOGY, vol. 117, no. 2, 2006, pages 145 - 55
HONEGGERPLIICKTHUN, J MOL BIOL., vol. 309, no. 3, 2001, pages 687 - 99
HORVATH ET AL., SCIENCE, vol. 327, 2010, pages 167 - 170
HOUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883
JONES ET AL., FRONTIERS IN PHARMACOLOGY, vol. 5, 2014, pages 254
JUNE, JOURNAL OF CLINICAL INVESTIGATION, vol. 117, 2007, pages 1466 - 1476
JURICA ET AL., MOL. CELL, vol. 2, no. 4, 1998, pages 469 - 76
KIM ET AL., PROC. NATL. ACAD. SCI. USA, vol. 93, 1996, pages 1156 - 1160
KLEGER ET AL., DTSCH ARZTEBLINT., vol. 112, no. 8, 2015, pages 128 - 135
KOCH ET AL., IMMUN AGEING, vol. 5, 2008, pages 6
KOHLER ET AL., NATURE, vol. 256, no. 5517, 1975, pages 495 - 7
KURODA ET AL., PROTEINS, vol. 73, no. 3, 2008, pages 608 - 20
LEONG ET AL., CYTOKINE, vol. 16, no. 3, 2001, pages 106 - 19
LOWELL, MOL IMMUNOL., vol. 41, no. 6-7, 2004, pages 631 - 43
LYNCH, NAT REV IMMUNOL., vol. 4, no. 12, 2004, pages 931 - 40
MAKAROVA ET AL., BIOLOGY DIRECT, vol. 1, 2006, pages 7
MARKS ET AL., JMOL BIOL., vol. 222, no. 3, 1991, pages 581 - 97
MARRAGINI ET AL., SCIENCE, vol. 322, 2008, pages 1843 - 1845
MILONE ET AL., MOL. THER., vol. 17, no. 8, 2009, pages 1453 - 1464
MOREA ET AL., METHODS, vol. 20, no. 3, 2000, pages 267 - 79
MOSCOU ET AL., SCIENCE, vol. 326, 2009, pages 3501 - 12
MUYLDERMANS, ANNU REV BIOCHEM., vol. 82, 2013, pages 775 - 97
NACHEVABERZAL-HERRANZ, EUR. J. BIOCHEM., vol. 270, 2003, pages 1485 - 65
NAYAKHERZOG, GENE THER., vol. 17, no. 3, 2010, pages 295 - 304
NISHIKAWA ET AL., HUM GENE THER., vol. 12, no. 8, 2001, pages 861 - 70
OHTSUKA ET AL., J. BIOL.CHEM., vol. 260, 1985, pages 2605 - 2608
ORDONEZ ET AL., PLOS ONE, vol. 8, no. 7, 2013, pages e69791
OUISSE ET AL., FRONT IMMUNOL., vol. 9, no. 10, 2019, pages 2131
PALACIOSWEISS, ONCOGENE, vol. 23, no. 48, 2004, pages 7990 - 8000
PENNISI, SCIENCE, vol. 339, 2013, pages 819 - 823
PICARDA ET AL., JCI INSIGHT, vol. 2, no. 3, 2017, pages e90088
PICARDA ET AL., JCIINSIGHT, vol. 2, no. 3, 2017, pages e90088
PLTICHTHUN, ANNU REV PHARMACOL TOXICOL., vol. 55, 2015, pages 489 - 511
PLUCKTHUN: "Handbook of Experimental Pharmacology", vol. 113, 1994, SPRINGER, article "The pharmacology of monoclonal antibodies", pages: 269 - 315
POWRIEMASON, J EXP MED., vol. 172, no. 6, 1990, pages 1701 - 8
PROVASI, NATURE MED., vol. 18, 2011, pages 807 - 815
QUO ET AL., J. MOL. BIOL., vol. 400, 2010, pages 96
RAMOS, METHODS MOL BIOL., vol. 907, 2012, pages 39 - 55
ROSENBERG ET AL., SCI TRANSL MED., vol. 7, no. 299, 2015, pages 299rv4
ROSSOLINI ET AL., MOL. CELL. PROBES, vol. 8, 1994, pages 91 - 98
ROUX ET AL., J IMMUNOL., vol. 161, no. 8, 1998, pages 4083 - 90
ROYBAL ET AL., CELL, 2006
SCALLEY-KIM ET AL., J MOL BIOL., vol. 372, no. 5, 2007, pages 1305 - 19
SCATCHARD, ANN NYACAD SCI., vol. 51, 1949, pages 660 - 672
SCHENBORNMIERENDORF, NUC ACIDS RES., vol. 13, 1985, pages 6223 - 36
SCHLEHUBERSKERRA, BIOL CHEM., vol. 382, no. 9, 2001, pages 1335 - 42
SCOTT ET AL., J PHYS CHEM A, vol. 103, no. 19, 1999, pages 3596 - 3607
SCOTT WILKIE ET AL: "Dual Targeting of ErbB2 and MUC1 in Breast Cancer Using Chimeric Antigen Receptors Engineered to Provide Complementary Signaling", JOURNAL OF CLINICAL IMMUNOLOGY, KLUWER ACADEMIC PUBLISHERS-PLENUM PUBLISHERS, NE, vol. 32, no. 5, 17 April 2012 (2012-04-17), pages 1059 - 1070, XP035113362, ISSN: 1573-2592, DOI: 10.1007/S10875-012-9689-9 *
SETHURAMAN ET AL., MOL BIOL EVOL., vol. 26, no. 10, 2009, pages 2299 - 315
SILVERMAN ET AL., NAT BIOTECHNOL., vol. 23, no. 12, 2005, pages 1556 - 61
SKERRA, FEBS J., vol. 275, no. 11, 2008, pages 2677 - 83
SPICKETT ET AL., J EXP MED., vol. 158, no. 3, 1983, pages 795 - 810
STEPINSKI ET AL., RNA, vol. 7, 2001, pages 1468 - 95
STODDARD, STRUCTURE, vol. 19, no. 1, 2011, pages 7 - 15
SZCZEPEK ET AL., NATURE BIOTECH., vol. 25, 2007, pages 786 - 793
TAKEUCHI ET AL., METHODS MOL BIOL., vol. 1239, 2015, pages 105 - 32
TORIKAI, BLOOD, vol. 122, 2013, pages 1341 - 1349
TROWBRIDGETHOMAS, ANNU REV IMMUNOL., vol. 12, 1994, pages 85 - 116
TSAI, NATURE BIOTECHNOL., vol. 32, 2014, pages 6569 - 576
UI-TEI ET AL., FEBS LETTERS, vol. 479, 2000, pages 79 - 82
VAN DER SPOEL ET AL., J COMPUT CHEM., vol. 26, no. 16, 2005, pages 1701 - 18
VILLALTA ET AL., SCI TRANSL MED., vol. 6, no. 258, 2014, pages 258ral42
VON HEIJNE G.: "Sequence analysis in molecular biology: treasure trove or trivial pursuit", 1987, ACADEMIC PRESS
WIEDENHEFT ET AL., NATURE, vol. 482, 2012, pages 331 - 8
WOOD ET AL., SCIENCE, vol. 333, 2011, pages 307
XYSTRAKIS ET AL., BLOOD, vol. 104, no. 10, 2004, pages 3294 - 30
XYSTRAKIS ET AL., EUR J IMMUNOL., vol. 34, no. 2, 2004, pages 408 - 17

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2024249954A1 (en) 2023-05-31 2024-12-05 Capstan Therapeutics, Inc. Lipid nanoparticle formulations and compositions
WO2025076127A1 (en) 2023-10-05 2025-04-10 Capstan Therapeutics, Inc. Constrained ionizable cationic lipids and lipid nanoparticles
WO2025076113A1 (en) 2023-10-05 2025-04-10 Capstan Therapeutics, Inc. Ionizable cationic lipids with conserved spacing and lipid nanoparticles
WO2025179294A2 (en) 2024-02-22 2025-08-28 Capstan Therapeutics, Inc. Immune engineering amplification
WO2025217454A2 (en) 2024-04-11 2025-10-16 Capstan Therapeutics, Inc. Ionizable cationic lipids and lipid nanoparticles
WO2025217452A1 (en) 2024-04-11 2025-10-16 Capstan Therapeutics, Inc. Constrained ionizable cationic lipids and lipid nanoparticles

Also Published As

Publication number Publication date
CN115916823A (zh) 2023-04-04
IL296546A (en) 2022-11-01
CA3172120A1 (en) 2021-09-23
JP7796034B2 (ja) 2026-01-08
MX2022011683A (es) 2022-12-08
AU2021237790A1 (en) 2022-10-13
JP2023518538A (ja) 2023-05-02
KR20230004510A (ko) 2023-01-06
EP4121457A1 (en) 2023-01-25
BR112022018795A2 (pt) 2023-01-10
US20230147657A1 (en) 2023-05-11

Similar Documents

Publication Publication Date Title
JP7673272B2 (ja) キメラ受容体及びその使用方法
US12180292B2 (en) CD70 binding molecules and methods of use thereof
JP7578939B2 (ja) 抗hla-a2抗体及びその使用方法
JP7796034B2 (ja) ヒトcd45rcに特異的なキメラ抗原受容体およびその使用
JP7219376B2 (ja) キメラ抗原受容体をキナーゼ阻害薬と併用して使用したサイトカイン放出症候群の治療及び予防
US20210079059A1 (en) Treatment of cancer using gfr alpha-4 chimeric antigen receptor
US20200215171A1 (en) Treatment of cancer using a cll-1 chimeric antigen receptor
US20240067732A1 (en) Anti-hla-a2 antibodies and uses thereof
TW202021981A (zh) G蛋白偶合受體c類第5群成員d(gprc5d)特異性嵌合抗原受體
JP2021501606A (ja) B細胞成熟抗原(bcma)に特異的なキメラ抗原受容体
KR20170037626A (ko) 인간화 항-bcma 키메라 항원 수용체를 사용한 암의 치료
JP2016514462A (ja) ヒト化抗cd19キメラ抗原受容体を使用するがんの処置
CN107847592B (zh) 用于在淋巴瘤或白血病中诱导淋巴细胞增多的针对人csf-1r的抗体
RU2857378C2 (ru) Рецептор химерного антигена, специфичного к CD45RC человека, нуклеиновая кислота, вектор экспрессии, популяция иммунных клеток и её применение, композиция
RU2782276C2 (ru) Анти-hla-a2 антитела и способы их применения
RU2808254C2 (ru) Новые конструкции химерного антигенного рецептора, содержащие домены tnfr2
HK40074543A (en) Cd70 binding molecules and methods of use thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21712190

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2022555951

Country of ref document: JP

Kind code of ref document: A

Ref document number: 3172120

Country of ref document: CA

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112022018795

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: 202217058306

Country of ref document: IN

ENP Entry into the national phase

Ref document number: 2021237790

Country of ref document: AU

Date of ref document: 20210319

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2021712190

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2021712190

Country of ref document: EP

Effective date: 20221020

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01E

Ref document number: 112022018795

Country of ref document: BR

Free format text: APRESENTAR A COMPLEMENTACAO DO PEDIDO (RELATORIO DESCRITIVO TRADUZIDO E DESENHOS, SE HOUVER), CONFORME PUBLICACAO INTERNACIONAL.

ENP Entry into the national phase

Ref document number: 112022018795

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20220919