WO2021156489A1 - Engineered polypeptides derived from variable domain of adenovirus penton base - Google Patents
Engineered polypeptides derived from variable domain of adenovirus penton base Download PDFInfo
- Publication number
- WO2021156489A1 WO2021156489A1 PCT/EP2021/052884 EP2021052884W WO2021156489A1 WO 2021156489 A1 WO2021156489 A1 WO 2021156489A1 EP 2021052884 W EP2021052884 W EP 2021052884W WO 2021156489 A1 WO2021156489 A1 WO 2021156489A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- amino acid
- group
- fragment
- polypeptide
- present
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
- C12N15/1034—Isolating an individual clone by screening libraries
- C12N15/1055—Protein x Protein interaction, e.g. two hybrid selection
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/20—Fusion polypeptide containing a tag with affinity for a non-protein ligand
- C07K2319/21—Fusion polypeptide containing a tag with affinity for a non-protein ligand containing a His-tag
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/10011—Adenoviridae
- C12N2710/10311—Mastadenovirus, e.g. human or simian adenoviruses
- C12N2710/10322—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/10011—Adenoviridae
- C12N2710/10311—Mastadenovirus, e.g. human or simian adenoviruses
- C12N2710/10323—Virus like particles [VLP]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/10011—Adenoviridae
- C12N2710/10311—Mastadenovirus, e.g. human or simian adenoviruses
- C12N2710/10333—Use of viral protein as therapeutic agent other than vaccine, e.g. apoptosis inducing or anti-inflammatory
Definitions
- the present invention relates to an engineered polypeptide derived from adenovirus pentane base protein.
- the polypeptide of the invention is based on theticianupper“ alpha-helical domain of the adenovirus pentane base as shown in the pentane base atomic structure, but it lacks essentially completely any amino acids of the beta-barrel sheet domain showing a jellyroll fold structure (the jellyroll fold domain).
- the polypeptide contains at least the large fragment (also referred to herein as the “big fragment”) of said alpha-helical domain of the pentane base, which fragment includes the RGD loop(s) and the VLP loop, and may contain also the second, short fragment of the alpha-helical domain of the adenovirus pentane base.
- polypeptide of the invention provides a new scaffold for optimized presentation of peptidic entities such as oligopeptides, polypeptide sequences, protein domains, proteins and protein complexes made up of two, several or many subunits, preferably as high affinity agents to target molecules.
- peptidic entities such as oligopeptides, polypeptide sequences, protein domains, proteins and protein complexes made up of two, several or many subunits, preferably as high affinity agents to target molecules.
- a prerequisite for successful protein scaffold design for presentation of peptidic entities is a compact, stable protein domain which can accommodate modalities representing exposed and flexible loop structures that can accommodate said entities.
- these displayed entities can represent any peptidic sequence which may be recognized by any binding partner for peptidic structures, e.g. a binder sequence and/or paratope sequence and/or sequences, for example, from a randomized library that can be presented to any chemical or biochemical, respectively, structure capable to be recognized by said binder sequence (such as those exemplified above), e.g.
- foreign sequences which may be inserted into one or more of the engineered polypeptide of the invention can represent antigens used for identification of specific binders, for example antibodies (Fig. 2).
- Penton base proteins (protomers) from a number of Adenovirus (Ad) serotypes contain highly variable loop regions which can be functionalized for inserting foreign sequences encoding for oligopeptides, polypeptide sequences, protein domains, proteins and protein complexes as disclosed in WO2017/167988 A1.
- Adenovirus is one of the most commonly used gene therapy vector in humans. The adenovirus shell is predominantly built by two distinct proteins: the hexon protein, and the penton base protein, with the latter forming pentameric assemblies to which attaches the fiber protein characteristic for this virus.
- Penton base proteins of certain adenovirus serotypes were shown to spontaneously self-assemble into a multimeric superstructure when expressed recombinantly in absence of other adenoviral components.
- This superstructure represents a dodecahedron, formed by a total of 60 adenovirus base proteins arranged in twelve identical copies of the pentamer.
- the technical problem underlying the invention is the provision of protein scaffolds for presentation of peptidic binding partners for target molecules.
- the adenovirus dodecahedron represents a highly versatile display scaffold, for example for immunogenic peptides that can be inserted into the loops replacing naturally occurring sequences in the adenovirus penton base. Literally hundreds of heterologous peptides can thus be displayed efficiently on a single dodecahedron, if all insertion sites are occupied (see WO 2017/167988 A1).
- the dodecahedron can be produced recombinantly in very high amounts, it is exceptionally stable and can be stored at ambient temperature for indefinite time (cf. WO 2017/167988 A1).
- synthetic dodecahedron-based particles displaying immunogenic peptides in their exposed loops can be engineered for potential use in a range of applications including (onco-)immunology and emerging infectious disease.
- the present inventor had developed adenovirus dodecahedron into a synthetic BioBrick format facilitating epitope insertion into the exposed loops, and put in place an efficient adenovirus base protein production protocol based on the MultiBac platform as disclosed in WO 2017/167988 A1.
- the present inventor recognized that the architecture represents a bona fide two-domain structure which may have arisen during evolution by gene fusion (Fig. 3). The two domains as it appeared could be easily split into two distinct compact entities: the beta-barrel domain (jellyroll fold domain) containing the multimerization information, and the alpha-helical domain resembling a crown.
- Co-pending International Patent Application PCT/EP2019/070722 describes multimerizing polypeptides derived from the jellyroll fold domain of the penton base protein. While discovering that the penton base protein of adenovirus could be split into two domains, the inventor recognized that the alpha-helical crown domain itself is of great interest for adopting various non-adenoviral sequences as disclosed in WO 2017/167988 A1, and could be produced on its own.
- the present invention provides engineered polypeptides consisting of or derived from, respectively, the adenovirus base-protein head domain (i.e. the penton base protein minus the multimerization domain), or specific fragments thereof, as an autonomous scaffold to form a separate, stable, highly versatile protein entity on its own. Because the highly variable loops in the crown domain are reminiscent of antibody complementarity determining regions (CDRs), the crown domain polypeptides according to the invention are also referred to as the protagonist complementarity determining regions (CDRs), the crown domain polypeptides according to the invention are also referred to as the motifADDobody“ hereafter.
- the ADDobody polypeptide of the invention is capable of displaying multiple copies of any peptidic structure, in particular peptides, oligopeptides, protein domains, proteins or protein complexes.
- the ADDobody contains the large and small fragments of an adenovirus penton base alpha-helical domain.
- the invention also is directed to minimal ADDobodies (or miniADDobodies) containing only the large fragment of the alpha- helical domain.
- oligopeptides, polypeptide sequences, protein domains and proteins can include: (i) naturally occurring binder sequences or paratopes, (ii) binder sequences or paratopes obtained from random library and selection evolution (phage/ribosome display), (iii) antigenic entities that stimulate the immune system to trigger an immune response, for example for vaccination purposes, or for preparing antibodies or other binder molecules in cell culture, or in vitro in a test tube.
- phage/ribosome display random library and selection evolution
- antigenic entities that stimulate the immune system to trigger an immune response, for example for vaccination purposes, or for preparing antibodies or other binder molecules in cell culture, or in vitro in a test tube.
- phage/ribosome display random library and selection evolution
- antigenic entities that stimulate the immune system to trigger an immune response, for example for vaccination purposes, or for preparing antibodies or other binder molecules in cell culture, or in vitro in a test tube.
- such protein presenting such entities will be safe, non- immunogenic, efficient
- the polypeptide contains insertion sites which are within the VL-loop (also called V loop) and/or RGD loops as disclosed in WO 2017/167988 A1.
- V loop also called V loop
- RGD loops as disclosed in WO 2017/167988 A1.
- two more sites of flexibility for heterologous modification of the naturally sequences of existing adenovirus penton base proteins are disclosed which further adds to, e.g. flexible modification of the crown domain and the adenovirus penton base for including a multitude of possible heterologous peptidic structures.
- polypeptide of the invention can be engineered as a multivalent Virus Like Particle (VLP).
- VLP Virus Like Particle
- the present invention provides the following embodiments:
- the invention provides an isolated engineered polypeptide comprising the amino acid stretches essentially corresponding to a first and a second fragment of the penton base wherein the first fragment of the polypeptide is present between the first and second amino acid stretches forming the jellyroll fold domain in the full length penton base and wherein the second fragment of the polypeptide is present between the second and third fragments forming the jellyroll fold domain in the full length penton base, respectively, wherein the isolated engineered domain lacks the amino acid stretches forming the jellyroll fold domain of the adenovirus penton base, wherein optionally the first and/or second fragments of the polypeptide contain(s) one or more heterologous modification(s).
- polypeptide having the structure of the following general formula
- A represents an amino acid stretch corresponding to the N-terminal amino acid stretch of the adenovirus penton base present between the first and the second amino acid stretch forming the jellyroll fold domain of the adenovirus penton base;
- B represents an amino acid stretch corresponding to the C-terminal amino acid stretch of the adenovirus penton base inserted between the second and the third amino acid stretch forming the jellyroll fold domain of the adenovirus penton base.
- L represents a chemical group selected from the group consisting of an amino acid, an oligopeptide and a polypeptide; N may or may not be present, and, if present, represents a chemical group such as an amino acid, an oligopeptide and a polypeptide;
- C may or may not be present, and, if present, represents a chemical group such as of an amino acid, an oligopeptide and a polypeptide; wherein, optionally, fragment A and/or B contain(s) one or more heterologous modifications.
- a preferred fragment or group, respectively, N comprises an amino acid sequence facilitating the purification of the polypeptide, e.g. a His tag.
- fragment A of the polypeptides as defined herein comprises an amino acid sequence selected from the group consisting of the amino acid sequences according to the following Table 1:
- fragment B of the polypeptides as defined herein comprises an amino acid sequence selected from the group consisting of the amino acid sequences according to the following Table 2:
- fragment B contains one or more heterologous modifications.
- fragment A and/or B contain(s) one or more heterologous modifications wherein said one or more heterologous modifications is/are contained in the following sites:
- V loop also referred to as “variable loop” of fragment A;
- X 2 is selected from the group consisting of K, Q and E, and is preferably Q;
- X 3 is P or A, and is preferably P;
- X 4 is selected from the group consisting of L, V and I, and is preferably L
- X 5 is selected from the group consisting of T, E, A, K and L, and is preferably E;
- Cb is selected from the group consisting of E, K, T and Q, and is preferably K;
- X 7 is selected from the group consisting of S, P and D, and is preferably S;
- Xs is selected from the group consisting of K, T and S, and is preferably K;
- Xg is selected from the group consisting of K, S, N, G and D, and is preferably S;
- X 10 is L or V, and is preferably V;
- X 11 is I or L, and is preferably I;
- X 12 is selected from the group consisting of S, E and P, and is preferably E;
- Xi 3 is no amino acid (i.e. not present) or is N, and is preferably no amino acid;
- Xi 4 is D or G, and is preferably D;
- Xi 5 is selected from the group consisting of S, K, Q and T, and is preferably K
- X 16 is selected from the group consisting of T, N, I, K and M, and is preferably I;
- the floor region also denoted as “floor site”
- the B loop show a flexible conformation as evidenced by X-ray chrystallography of an exemplary ADDobody of the invention.
- the one or more heterologous modification includes any insertion, deletion, replacement at any and of any, respectively, position of the residues outlined above, whereby the insertion or replacement may comprise one or more or all of the respective amino acids of the floor region and the B loop, respectively.
- a preferred heterologous modification is a replacement of amino acid residues 1 to 6 of SEQ ID NO: 22 as defined above, preferably by a heterologous oligonucleotide, polypeptide, protein or protein complex.
- the polypeptide comprises one or more heterologous modifications at least in the RGD loop (i.e. the RGD loop region as defined above), the V loop and the floor site, wherein in certain embodiments of this type, the one or more heterologous modifications are located only in said RDG loop region, said V loop and said floor site.
- the polypeptide of the invention comprises one or more heterologous modifications at least in the RGD loop region and the V loop, wherein in certain embodiments of this type, the one or more heterologous modifications are located only in said RDG loop region and said V loop.
- the polypeptide comprises one or more heterologous modifications at least in the floor region and the B loop, wherein in certain embodiments of this type, the one or more heterologous modifications are located only in said floor site and said B loop. It is understood that the one or more modifications may present in any combination of the sites for heterologous modification of fragment A and/or fragment B as defined above, including one or more heterologous modification in all of the above-defined sites.
- N-terminus of the RGD loop region of fragment A is defined by the following sequence (from N-terminal to C-terminal):
- X18 is selected from the group consisting of D, E and N, and is preferably D;
- X19 is selected from the group consisting of V, L, and I, and is preferably V;
- X20 is any amino acid, preferably selected from the group consisting of A, D, E, K, S, and T, and is more preferably T ;
- X21 is any amino acid, preferably selected from the group consisting of A, D, E, and K, and is more preferably A;
- X22 is selected from the group consisting of F, Y, and W, and is preferably Y;
- X23 is selected from the group consisting of A, D, E, N, and Q, is preferably E or Q, and is more preferably E;
- X24 is any amino acid, preferably selected from the group consisting of A, D, E, N, and K, and is more preferably E;
- X25 is selected from the group consisting of S or T, and is preferably S; and
- X26 is any amino acid and constitutes the N-terminal amino acid of the RGD loop region
- the C-terminus of the RGD loop region of fragment A is defined by the following sequence (from N-terminal to C-terminal):
- X27 is any amino acid and constitutes the C-terminal amino acid of the second RGD loop
- X28 is selected from the group consisting of I, L and V, and is preferably I;
- X29 is selected from the group consisting of D, E, K, N, Q, and V, is preferably Q or K, and is more preferably Q;
- X30 is selected from the group consisting of C, G and P, and is preferably P;
- X31 is selected from the group consisting of I, L and V, is preferably L or V and is more preferably L;
- X32 is selected from the group consisting of D, E, S and T, is preferably E or T and is more preferably E;
- X33 is selected from the group consisting of D, E, , S and T, is preferably E, or T, and is more preferably K;
- X34 is selected from the group consisting of D and E, and is preferably D;
- the RGD loop region as disclosed and defined herein can be sub-divided into a first and a second RDG loop, more particularly as defined on pages 31 to 33 of WO 2017/167988.
- the N-terminus of the V loop of fragment A is defined by the following sequence (from N-terminal to C-terminal):
- X35 is selected from the group consisting of F, Y, and W, and is preferably F;
- X36 is selected from the group consisting of H, K and R, and is preferably K;
- X37 is selected from the group consisting of A, V, I, and L, and is preferably A;
- X38 is selected from the group consisting of H, K, and R, and is preferably R;
- X39 is selected from the group consisting of A, V, I, and L, and is preferably V;
- X40 is selected from the group consisting of A, V, I, L and M, and is preferably M;
- X41 is selected from the group consisting of A, V, I, and L, and is preferably V; and X42 is any amino acid and constitutes the N-terminal amino acid of the V loop.
- the C-terminus of the V loop of fragment A is defined by the following sequence (from N-terminal to C-terminal):
- X43 is any amino acid and constitutes the C-terminal amino acid of the V loop
- X44 is selected from the group consisting of F, Y, and W, and is preferably Y;
- X45 is selected from the group consisting of D, E, S and T, is preferably E or T and is more preferably E;
- X46 is selected from the group consisting of F, Y, and W, and is preferably W;
- X47 is selected from the group consisting of A, F, V, Y, and W, is preferably F or V and is more preferably F;
- X48 is selected from the group consisting of D, E, S and T, is preferably D or E and is more preferably E;
- X49 is selected from the group consisting of F, Y, and W, and is preferably F.
- the present invention is also directed to a further isolated engineered polypeptide comprising the large fragment of the alpha-helical domain of an adenovirus penton base protein which polypeptide lacks the small fragment of the alpha-helical domain and the jellyroll fold domain of the adenovirus penton base protein, wherein said large fragment optionally contains one or more heterologous modifications.
- This further engineered polypeptide is referred to herein as “minimal crown domain” or “minimal ADDobody” or “miniADDobody”.
- the minimal crown domain (or minimal ADDobody) of the invention has preferably a general structure as defined according to following formula (II):
- the present invention also relates to a nucleic acid encoding a minimal ADDobody of the invention.
- the present invention further provides a vector comprising said nucleic acid encoding a minimal ADDobody, preferably said nucleic acid is contained in an expression cassette.
- a recombinant host cell containing said minimal ADDobody vector.
- the invention further provides a method for producing a minimal ADDobody of the invention comprising the step of culturing the vector containing the minimal ADDobody coding sequence in an expression cassette under conditions allowing the expression of the minimal ADDobody, and optionally purifying the minimal ADDobody from the host cells.
- heterologous modification as defined herein may be any modification of the respective site (RGD loop region, V loop, floor site, B loop) compared to the respective naturally occurring sequence, preferably as found in the adenovirus penton base proteins as further described in more detail below.
- the heterologous modification is selected from the group consisting of one or more single amino acid mutations in comparison to the wildtype sequence of fragment A and/or B, one or more replacements of wildtype amino acid stretches by one or more heterologous amino acids and/or amino acid stretches one or more insertions of heterologous amino acid stretches, one or more deletions of one or more amino acids and one or more amino acid modifications as well as any combination(s) thereof.
- adenoviral amino acid sequences of the sites as defined herein by non-adenoviral amino acid sequences preferably non-adenoviral oligonucleotides, polypeptides, proteins and/or protein complexes.
- a point mutation may, for example, the replacement of an amino acid by a coupling residue, i.e. a naturally or non-naturally occurring amino acid having a side chain capable of forming a covalent bond with a binding partner, for example another coupling residue present either on another polypeptide to be coupled to the coupling residue or in fragment A and/or B of the present invention and/or in the linker L and/or in fragment N and/or in fragment C of the polypeptide according to the invention.
- a coupling residue i.e. a naturally or non-naturally occurring amino acid having a side chain capable of forming a covalent bond with a binding partner
- another coupling residue present either on another polypeptide to be coupled to the coupling residue or in fragment A and/or B of the present invention and/or in the linker L and/or in fragment N and/or in fragment C of the polypeptide according to the invention.
- the latter may serve for stabilizing the structure of the ADDobody or minimal ADDobody, respectively, or by stabilizing dimers, decamers, pentamers and/or dodecahedrons of the polypeptides of the invention (for example, via head-to-tail, head-to-head or head-to-tail arrangement).
- Preferred coupling residues are amino acids D, E, K and C, with C being particularly preferred, since it may readily form a disulfide bond with another C under the appropriate redox conditions known in the art.
- the heterologous modification provides a target specific binding entity.
- the target specific binding entity is selected from the group consisting of antigens, epitopes, CDRs, antibodies, antibody fragments such as an antigen binding (Fab) fragment, a Fab' fragment, a F(ab')2fragment, a heavy chain antibody, a single-domain antibody (sdAb), a single-chain fragment variable (scFv), a fragment variable (Fv), a VH domain, a VL domain, a single domain antibody, a nanobody, an IgNAR (immunoglobulin new antigen receptor), a di-scFv, a bispecific T-cell engager (BITEs), a dual affinity re-targeting (DART) molecule, a triple body, a diabody, a single-chain diabody, a paratope, an alternative scaffold protein, and a fusion protein thereof.
- Fab antigen binding
- Fab' fragment fragment variable fragment
- Fv fragment variable
- Fv fragment variable
- VH domain a V
- a paratope also called an antigen-binding site of an antibody, is a part of an antibody which recognizes and binds to an antigen, more particularly an epitope of an antigen. It is typically a short amino acid stretch, usually of 5 to 10 amino acids which are part of the Fab region of an antibody.
- a specific polypeptide according to the invention has the following amino acid sequence (from N- terminal to C-terminal):
- a variant of the above polypeptide of the invention according to SEQ ID NO: 27 has the following amino acid sequence (from N- to C-terminal):
- a further specific polypeptide according to the invention has the following amino acid sequence (from N- terminal to C-terminal):
- a variant of the above polypeptide of the invention according to SEQ ID NO: 27 has the following amino acid sequence (from N- to C-terminal):
- the invention is further directed to a nucleic acid encoding a polypeptide according to the invention.
- nucleic acid of the invention which is meant synonymous to a nucleotide sequence encoding a polypeptide of the invention.
- the vector may contain the nucleic acid (or the nucleotide sequence) within an expression cassette.
- the invention also provides a recombinant host cell comprising the nucleic acid or the vector.
- the invention furthermore is directed to a method for the production of a polypeptide according to the invention comprising the step of culturing the host cell containing the vector comprising the nucleic acid with an expression cassette under conditions allowing the expression of said polypeptide.
- the production method preferably comprises the step of purifying the polypeptide from the cultured host cells.
- the invention also provides an engineered adenovirus penton base protein comprising a polypeptide of the invention (i.e. an ADDobody or a minimal ADDobody) comprising one or more heterologous modifications, preferably one or more heterologous modifications at least in the floor region and/or the B loop (with respect to engineered penton base proteins comprising an ADDobody) or preferably one or more heterologous modifications at least in the floor region (with respect to engineered penton base proteins comprising a minimal ADDobody), fused to the multimerization domain (jellyroll fold domain) of an adenovirus penton base protein.
- a polypeptide of the invention i.e. an ADDobody or a minimal ADDobody
- a multimerization domain is selected from an adenovirus selected from of human adenovirus serotype 2 (hAd2), human adenovirus serotype 3 (hAd3), human adenovirus serotype 4 (hAd4), human adenovirus serotype 5 (hAd5), human adenovirus serotype 7 (hAd7), human adenovirus serotype 11 (hAd11), human adenovirus serotype 12 (hAd12), human adenovirus serotype 17 (hAd17), human adenovirus serotype 25 (hAd25), human adenovirus serotype 35 (hAd35), human adenovirus serotype 37 (hAd37), human adenovirus serotype 41 (hAd41), gorilla adenovirus (gorAd), chimpanzee adenovirus (ChimpAd), simian adenovirus sero
- D-A-E-B-F (III) wherein A and B are the fragments of the alpha-helical crown domain as defined above, and D, E and F are the amino acid sequences of an adenovirus penton base forming the multimerization (jellyroll fold) domain, wherein one or more heterologous modifications is/are present in the floor region of fragment A and/or in the B loop of fragment B.
- Engineered penton base proteins of the invention comprising a minimal ADDobody polypeptide of the invention have typically a structure according to the following formula (IV) (from N- to C- terminal):
- D-A-E-Li-F (IV) wherein A is the large fragment of the alpha-helical crown domain as defined above and D, E and F are the amino acid sequences of an adenovirus penton base forming the multimerization (jellyroll fold) domain, wherein, optionally and preferably, one or more heterologous modifications is/are present in the floor region of fragment A, and wherein Li is a linker selected from peptides, oligopeptides, polypeptides, proteins and protein complexes.
- Preferred linkers as Li are selected from oligopeptide linkers such as oligopeptides having 4 to 10 amino acids, , i.e. 4, 5, 6, 7, 8, 9, or 10 amino acids, preferably having amino acids G and S.
- GGGS SEQ ID NO: 37
- Another example is a linker composed of G and S and having multiple GGS repeats such as 2, 3, 4, 5 or more GGS repeats.
- a particularly preferred linker of this type is GGSGGS (SEQ ID NO: 38).
- Preferred amino acid sequences forming the multimerization domain are taken from the adenovirus penton base sequences of SEQ ID Nos: 1 to 20.
- More preferred amino acid sequences for fragments D, A and F are characterized as follows:
- amino acid stretch D of general formulae (III) and/or (IV) has the following consensus sequence (SEQ ID NO: 34):
- J2 is E or S
- J3 is L or V
- J4 is A or S
- J5 is L or Q
- J6 is Y or E
- J7 is R or K
- Jg V or I
- J10 is F or Y
- J11 is T or S
- J12 is A or T or I or G
- J 13 is S or G
- J 14 is F or L
- J 15 is E or D
- J16 is A or G
- J 17 is D or Q
- J18 is L or M
- Z 5 if present, is V or I
- Z 7 if present, is E or D
- Zs if present, is Y or F
- Z 10 if present, is F or S or Y
- Z11 if present, is T or S
- Z12 if present, is S or N
- amino acid stretch E of above general formulae (III) and/or (IV) has the following sequence (SEQ ID NO: 35): wherein: amino acid stretch E begins on the N-terminal side at an amino acid from Z17 to Z27 or at amino acid Q after Z27; amino acid stretch B ends on the C-terminal side before Z28 at amino acid L or at an amino acid from Z28 to Z30;
- Zi7 if present, is L or S
- Z18 if present, is T or P or C
- Zi9 if present, is T or P
- Z20 if present, is P or S or A or R
- Z21 if present, is N or D
- Z22 if present, is G or V
- Z23 if present, is H or T
- Z26 if present, is A or V or S
- Z27 if present, is E or Q
- J20 is L or M
- J21 is Q or K
- J22 is Q or R or S
- J23 is V or I
- J24 is S or N
- J 25 is Y or F
- J26 is A or V
- Z28 if present, is M or L
- Z30 if present, is V or F
- fragment F of above general formulae (III) and/or (IV) has the following sequence (SEQ ID NO: 36): Z 31 Z 32 Z 33 ALTDHGT LPLRSSI J 27 GV QRVTJ 28 TDARR RTCPYVYKA LGIVJ 30 P J 31 VLS SRTF wherein: amino acid stretch F begins on the N-terminal side at an amino acid from Z31 to Z33 or at amino acid A after Z33;
- J27 is R or S or G
- J28 is V or I
- J29 is Y or H
- J30 is A or S
- J31 is R or K
- start and end amino acids of each of fragments A, B, D, E and F of the engineered adenovirus penton base of the invention according to general formula (III) are preferably selected such that there is preferably no overlap of the residues forming the transition from one fragment to the following fragment when compared to the sequences as shown in SEQ ID NOs: 1 to 20.
- each of fragments A, D, E and F of the engineered adenovirus penton base of the invention according to general formula (IV) are preferably selected such that there is preferably no overlap of the residues forming the transition from one fragment to the following fragment when compared to the sequences as shown in SEQ ID NOs: 1 to 20.
- the fragments A, B, D, E and F of engineered penton base proteins of the invention according to formula (III) are preferably comprised of amino acid sequences of the same adenovirus serotype, but chimeras are contemplated as well.
- fragments A, D, E and F of engineered penton base proteins of the invention according to formula (IV) are preferably comprised of amino acid sequences of the same adenovirus serotype, but chimeras are contemplated as well.
- the invention also provides pentameric complexes of an engineered adenovirus penton base protein of the invention, preferably a penton base protein of formula (III) or (IV), most preferably a penton base protein of formula (III).
- the invention is further directed to virus-like particles (VLP) comprising 12 pentameric complexes of an engineered adenovirus penton base protein of the invention.
- VLP virus-like particles
- the invention also provides the use of polypeptides as defined herein having one or more heterologous modifications as outlined herein and/or of VLPs containing such polypeptides having one or more heterologous modifications as defined herein as a medicament.
- compositions comprising a polypeptide as defined herein having one or more heterologous modifications as outlined herein and/or a VLP containing such polypeptides having one or more heterologous modifications as defined herein, optionally together with at least one pharmaceutically acceptable carrier, excipient and/or diluent.
- the invention further provides a method for producing a VLP as disclosed herein, preferably a VLP composed of polypeptides containing one or more heterologous modifications as defined herein, comprising the step of incubating a solution of a polypeptide according the invention, preferably a polypeptide comprising one or more heterologous modifications as defined herein under conditions allowing the assembly of the polypeptide into a VLP.
- the invention also provides the use of polypeptides as defined herein having one or more heterologous modifications as outlined herein and/or of VLPs containing such polypeptides having one or more heterologous modifications as defined herein in the treatment and/or prevention of an infectious disease, an immune disease, tumour or cancer.
- the invention is also directed to a method of identifying a binding sequence to a target molecule comprising the steps of:
- step (iii) contacting the polypeptides expressed in step (ii), optionally after purification from the host cells or the cell-free system, with the target molecule;
- step (i) may be one of the following steps (ia) and (ib):
- the method preferably further comprises the step of determining the dissociation constant(s) (Kd) of the polypeptide(s) bound to the target molecule.
- binding moiety e.g. an antibody
- Kd dissociation constant
- Targets can be recognized by their ligands which bind with a certain affinity to their targets and thus, the ligand binding to its respective target results in a biological effect.
- the binding is both specific and occurs with a high affinity, preferably with a Kd of less than 10 7 , 10 8 , 10 9 , 10 10 M or less.
- affinity is preferably measured at 37°C
- Suitable assays include surface plasmon resonance measurements (e.g. Biacore), quartz crystal microbalance measurements (e.g. Attana), and competition assays.
- Kd (usually measured in “mol/L”, sometimes abbreviated as “M”) is intended to refer to the dissociation equilibrium constant of the particular interaction between a binding moiety (e.g. an antibody or fragment thereof) and a target molecule (e.g. an antigen or epitope thereof).
- Methods for determining Kd include, without limitation, ELISA and surface plasmon resonance assays.
- the above identification method can also be provided as an evolutionary process wherein the identified sequences binding to the target are further optimized in subsequent rounds of library preparation (wherein the candidate sequences of each previous rounds are modified so as to provide improved binding to the target molecule), expression, and contacting with the target, optionally followed by determination of the dissociation constants so that improved binding candidates are selected in each subsequent rounds until a predetermined minimal dissociation constant is achieved, e.g. preferably a dissociation constant indicating a specific binding of the candidate sequence to the target, or until the dissociation constants are not further improved, typically not further lowered, in comparison to the previous round.
- a predetermined minimal dissociation constant e.g. preferably a dissociation constant indicating a specific binding of the candidate sequence to the target, or until the dissociation constants are not further improved, typically not further lowered, in comparison to the previous round.
- ADDobody (or minimal ADDobody) containing a, preferably the finally optimized, binding sequence can then genetically fused to the nucleic acid encoding a multimerization domain of the same or different, preferably the same, adenovirus penton base, for example by using appropriate restriction enzyme sites in the fragment encoding the optimized ADDobody or minimal ADDobody, respectively, and a vector containing the nucleotide sequence in an expression cassette.
- the nucleic acid encoding the, preferably optimized, ADDobody or minimal ADDobody, respectively, is than inserted in line with the nucleotide sequence encoding a multimerization domain so that a complete ADDobody-multimerization domain (or minimal ADDobody-multimerization domain) construct (i.e. an engineered penton base protein according to the invention) is generated within the expression cassette.
- the vector can then be introduced into appropriate host cells and the construct, also named an engineered adenovirus penton base, can be mass expressed and purified.
- VLPs can then be prepared from the purified engineered adenovirus penton bases which include multiple copies (up to 60 copies, if the binding sequence is present as a single copy per penton base in the VLP) of the selected/optimized binding sequence which leads, in terms of, for example, binding sequences directed to an antigen (or epitope thereof) to improved recognition of the target molecule.
- the system could be used, of course, for any binding partners, e.g. antigens or antibodies or fragments of such entities as further detailed herein.
- the present invention also provides pentamers of the ADDobody of the invention.
- the present furthermore provides decamers of the ADDobody of the invention composed of two ADDobody pentamers.
- an engineered penton base protein wherein said protein comprises a heterologous modification in the following sequence: (from N- to C-terminal)
- X2 is selected from the group consisting of K, Q and E, and is preferably Q;
- X3 is P or A, and is preferably P;
- X4 is selected from the group consisting of L, V and I, and is preferably L
- X5 is selected from the group consisting of T, E, A, K and L, and is preferably E;
- Cb is selected from the group consisting of E, K, T and Q, and is preferably K;
- X7 is selected from the group consisting of S, P and D, and is preferably S;
- Xs is selected from the group consisting of K, T and S, and is preferably K;
- Xg is selected from the group consisting of K, S, N, G and D, and is preferably S;
- X10 is L or V, and is preferably V;
- X11 is I or L, and is preferably I;
- Xi 2 is selected from the group consisting of S, E and P, and is preferably E;
- Xi 3 is no amino acid (i.e. not present) or is N, and is preferably no amino acid;
- Xu is D or G, and is preferably D;
- Xi 5 is selected from the group consisting of S, K, Q and T, and is preferably K; and Xi 6 is selected from the group consisting of T, N, I, K and M, and is preferably I; and/or in the following sequence (from N- to C-terminal) T-H-V-F-X 17 -R-F-P (SEQ ID NO: 22) of fragment B (also referred to as “B loop) wherein X 17 is D or N, and is preferably N.
- the linker L (formula (I)) according to the invention may be selected from oligopeptide linkers such as oligopeptides having 4 to 10 amino acids, i.e. 4, 5, 6, 7, 8, 9, or 10 amino acids. Larger oligopeptides of more than 10 amino acids, typically from 11 to 50 amino acids, are also contemplated.
- the linker L may also be a polypeptide, protein or protein complex provided that the linker L does not interfere with the proper folding and stability of the ADDobody. The same holds true for fragments N and C as defined herein.
- the linker L as defined herein may be selected from the amino acid sequences (from N- to C-terminal) GAMGSGIQ (SEQ ID NO: 29) and GANGDSGN (SEQ ID NO: 20).
- the fragments A and/or B as well as the engineered adenonvirus penton base proteins of the invention are preferably based on an amino acid sequence which is each independently derived from penton base sequences selected from the group consisting of penton bases of human adenovirus serotype 2 (hAd2), human adenovirus serotype 3 (hAd3), human adenovirus serotype 4 (hAd4), human adenovirus serotype 5 (hAd5), human adenovirus serotype 7 (hAd7), human adenovirus serotype 11 (hAd11), human adenovirus serotype 12 (hAd12), human adenovirus serotype 17 (hAd17), human adenovirus serotype 25 (hAd25), human adenovirus serotype 35 (hAd35), human adenovirus serotype 37 (hAd37), human
- Preferred amino acid sequences of the above-indicated adenovirus penton bases are laid down in generally accessible databases such as UniProt and UniProtE, and especially preferred sequences referred to herein for the above-mentioned adenovirus subtypes are laid down in UniProt Acc. No. Q2Y0H9 (human adenovirus serotype 3; SEQ ID NO: 1), UniProt Acc. No. P03276 (human adenovirus serotype 2; SEQ ID NO: 2), UniProt Acc. No. Q2KSF3 (human adenovirus serotype 4; SEQ ID NO: 3), UniProt Acc. No.
- P12538 human adenovirus serotype 5; SEQ ID NO: 4
- UniProt Acc. No. Q9JFT6 human adenovirus serotype 7; SEQ ID NO: 5
- UniProt Acc. No. D2DM93 human adenovirus serotype 11; SEQ ID NO: 6
- UniProt Acc. No. P36716 human adenovirus serotype 12; SEQ ID NO: 7
- E5L3Q9 gorilla adenovirus; SEQ ID NO: 13), UniProt Acc. No. G9G849 (chimpanzee adenovirus; SEQ ID NO: 14), UniProt Acc. No. H8PFZ9 (simian adenovirus serotype 18; SEQ ID NO: 15), UniProt Acc. No. F6KSU4 (simian adenovirus serotype 20; SEQ ID NO: 16), UniProt Acc. No. F2WTK5 (simian adenovirus serotype 49; SEQ ID NO: 17), UniProt Acc. No.
- A0A0A1EWW1 (rhesus adenovirus serotype 51; SEQ ID NO: 18), UniProt Acc. No. A0A0A1EWX7 (rhesus adenovirus serotype 52; SEQ ID NO: 19), and UniProt Acc. No. A0A0A1EWZ7 (rhesus adenovirus serotype 53; SEQ ID NO: 20).
- amino acid sequences of the above penton bases are as follows (the respective UniProt Acc. No. is indicated in brackets):
- Cimpanzee Adenovirus Penton Base chimpAd (G9G849); SEQ ID NO: 14:
- MRRAVAIPSA AVALGPPPSY ESVMASANLQ APLENPYVPP RYLEPTGGRN SIRYSELTPL YDTTRLYLVD NKSADIATLN YQNDHSNFLT SVVQNSDYTP AEASTQTINL DDRSRWGGDL KTILHTNMPN VNEFMFTNSF RAKLMVAHET NKDPVYKWVE LTLPEGNFSE TMTIDLMNNA IVDHYLAVGR QNGVKESEIG VKFDTRNFRL GWDPQTELVM PGVYTNEAFH PDVVLLPGCG VDFTYSRLSN LLGIRKRMPF QEGFQIMYED LVGGNIPALL DVPAYEASIT TVAAKEVRGD NFEAAAAAAA TGAQPQAAPV VRPVTQDSKG RSYNIITGTN NTAYRSWYLA YNYGDPEKGV RSWTLLTTPD VTCGSEQVYW SMPDMYVDPV TFRSSQQVSS YPV
- MRRAVRVTPA AYEGPPPSYE SVMGSANVPA TLEAPYVPPR YLGPTEGRNS IRYSELAPLY DTTKVYLVDN KSADIASLNY QNDHSNFLTT VVQNNDFTPT EAGTQTINFD ERSRWGGQLK TILHTNMPNI NEFMSTNKFR ARLMVKKVEN QPPEYEWFEF TIPEGNYSET MTIDLMNNAI VDNYLQVGRQ NGVLESDIGV KFDTRNFRLG WDPVTKLVMP GVYTNEAFHP DIVLLPGCGV DFTQSRLSNL LGIRKRRPFQ EGFQIMYEDL EGGNIPALLD VTKYEQSVQR AKAEGREIRG DTFAVSPQDL VIEPLEHDSK NRSYNLLPNK TDTAYRSWFL AYNYGDPEKG VRSWTILTTT DVTCGSQQVY WSLPDMMQDP VTFRPSTQVS NFPVVGTELL PVHAKSFYNE Q
- VKFDTRNFRL GWDPVTKLVM PGVYTNEAFH PDIVLLPGCG VDFTQSRLSN LLGIRKRRPF QEGFQIMYED LEGGNIPGLL DVPAYEQSLQ QAQEEGRVTR
- polypeptides of the present invention are not confined to those known specific sequences for amino acid stretches A (minimal ADDobody) or A and B (ADDobody), respectively, forming the alpha-helical domain of the above-referenced adenovirus sub- und serotypes, respectively.
- Amino acid fragments A and B can also have similar amino acid sequences to the sequences of known adenovirus penton base protomers as long as the sequences of A and B are such that the resulting polypeptide adopts a conformationally stable crown or minimal crown domain under appropriate conditions as further outlined below.
- such similar sequences of fragments A and B share an amino acid sequence identity of at least 85 %, more preferred at least 90 %, even more preferred 95 %, particularly preferred at least 98 %, most preferred at least 99 %, with the respective amino acid sequence of a known adenovirus penton base, preferably those of SEQ ID NOs: 1 to 20, more preferably amino acid stretches A and B as provided in Tables 1 and 2, with the proviso that, in embodiments of the invention where one or more heterologous modifications are present in the RGD region and/or the V loop and/or the floor segment and/or the B loop, said sequence identities as outlined above are to be understood as referring to the adenovirus penton base fragments A and B, preferably of the sequences as outlined above, excluding said RGD loop region and/or said V loop and/or said floor segment and/or said B loop.
- fragments D, E and F can each have an amino acid sequence similar to the respective parts of the known adenovirus penton base sequences, and preferred sequence identity values given above for fragment A and B also apply to fragments D, E and F.
- amino acid sequences are stated from N to C terminal using the single letter code of lUPAC, if not otherwise specifically indicated.
- a particularly preferred ADDobody of the invention is based on the penton base protein of human adenovirus serotype 3 (hAd3).
- hAd3 human adenovirus serotype 3
- Table 1 large fragment or fragment A, respectively
- Table 2 small fragment or fragment B, respectively. The same holds for the minimal ADDobody with respect to the large fragment or fragment A, respectively.
- a particularly preferred ADDobody of the invention is based on the penton base protein of chimpanzee adenovirus (ChimpAd).
- ChompAd penton base protein of chimpanzee adenovirus
- Table 1 large fragment or fragment A, respectively
- Table 2 small fragment or fragment B, respectively. The same holds for the minimal ADDobody with respect to the large fragment or fragment A, respectively.
- the term "antigen" or “epitope of an antigen” refers to a structure recognized by molecules of the immune response, e.g. antibodies, T cell receptors (TCRs) etc.
- heterologous modification(s) present in the polypeptides or engineered adeonovirus base protomers may also be mimotopes of corresponding naturally occurring epitopes.
- Antigens or epitopes thereof, respectively, of infectious agents include, but are not limited to, e.g. viral infectious agents, such as HIV, hepatitis viruses such as hepatitis A virus, hepatitis B virus or hepatitis C virus, herpes virus, varicella zoster virus, rubella virus, yellow fever virus, dengue fever virus, flaviviruses (e.g. Zika virus), influenza viruses, Marburg disease virus, Ebola viruses and arboviruses such as Chikungunya virus.
- Antigens of bacterial infectious agents include, but are not limited to, antigens of e.g. Legionella, Helicobacter, Vibrio, infectious E.
- Antigens of infectious protozoan pathogens include, but are not limited to, antigens of Plasmodium, Trypanosoma, Leishmania and Toxoplasma. Further examples of antigens of pathogenic agents include antigens of fungal pathogens such as antigens of Cryptococcus neoformans, Histoplasma capsulatum, Coccidioides immitis, Blastomyces dermatitidis and Candida albicans.
- tumor antigens or epitopes thereof which can be used according to the invention include, but not limited to 707-AP, AFP, ART-4, BAGE, beta-catenin/m, Bcr-abl, CAMEL, CAP-1, CASP-8, CDC27/m, CDK4/m, CEA, CT, Cyp-B, DAM, ELF2M, ETV6-AML1, G250, GAGE, GnT-V, Gp100, HAGE, HER-2/neu, HLA-A*0201-R170I, HPV-E7, HSP70-2M, HAST-2, hTERT (or hTRT), iCE, KIAA0205, LAGE, LDLR/FUT, MAGE, MART-1/Melan-A, MC1R, myosin/m, MUC1, MUM-1, -2, -3, NA88-A, NY-ESO-1, p190 minor bcr-abl,
- a further embodiment of polypeptides of the invention relates to polypeptides wherein at last one of the sites of fragments A and/or B for heterologous modification as defined herein contains antibody sequences or parts of antibodies such as antibody fragments.
- antibody is an immunoglobulin specifically binding to an antigen.
- antibody fragment refers to a part of an antibody which retains the ability of the complete antibody to specifically bind to an antigen.
- antibody fragments include, but are not limited to, paratopes, Fab fragments, Fab' fragments, F(ab')2 fragments, heavy chain antibodys, single-domain antibodies (sdAb), scFv fragments, fragment variables (Fv), VH domains, VL domains, nanobodies, IgNARs (immunoglobulin new antigen receptors), di- scFv, bispecific T-cell engagers (BITEs), dual affinity re-targeting (DART) molecules, triple bodies, diabodis, a single-chain diabody and the like.
- a “diabody” is a fusion protein or a bivalent antibody which can bind different antigens.
- a diabody is composed of two single protein chains (typically two scFv fragments) each comprising variable fragments of an antibody. Diabodies therefore comprise two antigen binding sites and can, thus, target the same (monospecific diabody) or different antigens (bispecific diabody).
- single domain antibody refers to antibody fragments consisting of a single, monomeric variable domain of an antibody.
- VHH or VNAR variable new antigen receptor
- single-domain antibodies can be obtained by monomerization of variable domains of conventional mouse or human antibodies by the use of genetic engineering. They show a molecular mass of approximately 12-15 kDa and thus, are the smallest antibody fragments capable of antigen recognition. Further examples include nanobodies or nanoantibodies.
- Antigen-binding entities useful in the context of the invention also include “antibody mimetic" which expression as used herein refers to compounds which specifically bind antigens similar to an antibody, but which compounds are structurally unrelated to antibodies.
- antibody mimetics are artificial peptides or proteins with a molar mass of about 3 to 20 kDa which comprise one, two or more exposed domains specifically binding to an antigen.
- LACI-D1 lipoprotein-associated coagulation inhibitor
- affilins e.g. human-y B crystalline or human ubiquitin
- cystatin Sac7D from Sulfolobus acidocaldarius
- lipocalin and anticalins derived from lipocalins DARPins (designed ankyrin repeat domains); SH3 domain of Fyn; Kunits domain of protease inhibitors; monobodies, e.g.
- fibronectin the 10thtype III domain of fibronectin; adnectins: knottins (cysteine knot miniproteins); atrimers; evibodies, e.g. CTLA4-based binders, affibodies, e.g. three-helix bundle from Z- domain of protein A from Staphylococcus aureus; Trans-bodies, e.g. human transferrin; tetranectins, e.g. monomeric or trimeric human C-type lectin domain; microbodies, e.g. trypsin-inhibitor-ll; affilins; armadillo repeat proteins.
- adnectins knottins (cysteine knot miniproteins); atrimers
- evibodies e.g. CTLA4-based binders
- affibodies e.g. three-helix bundle from Z- domain of protein A from Staphylococcus aureus
- Nucleic acids and small molecules are sometimes considered antibody mimetics as well (aptamers), but not artificial antibodies, antibody fragments and fusion proteins composed from these. Common advantages over antibodies are better solubility, tissue penetration, stability towards heat and enzymes, and comparatively low production costs.
- any protein-protein interaction such as receptor-ligand binding
- a preferred selection/optimization process in the context of the invention is ribosome display as outlined in detail in Schaffitzel et al. (2001) in: Protein-Protein Interactions, A Molecular Cloning Manual: In vitro selection and evolution of protein-ligand interaction by ribosome display (Golemis E., ed.), pages 535-567, Cold Spring Harbor Laboratory Press, New York.
- the ribosome display protocol has the advantage of being carried out completely in vitro at all steps of the selection process.
- Further possible selection processes are also known in the art and include phage display (Smith (1985) Science 228, 1315-1317; Winter et al. (1994) Annu. Rev. Immunol.
- yeast two-hybrid systems yeast two-hybrid systems
- cell surface display methods yeast two-hybrid systems
- yeast two-hybrid systems yeast two-hybrid systems
- cell surface display methods yeast two-hybrid systems
- yeast two-hybrid systems yeast two-hybrid systems
- cell surface display methods yeast two-hybrid systems
- yeast display, and/or baculovirus capsid display cell surface display methods
- the ribosome display process can basically be used in two ways for optimization of antigens or other amino acid sequences involved in targeting a specific molecule by use of the polypeptides of the invention.
- the amino acid sequence for selection and/or optimization to bind to a target molecule can be selected first from an initial library of polypeptides sequences that can be as large as 10 14 individual sequences, more typically 10 9 to 10 10 sequences, optionally employing evolutionary procedures as described in detail in Schaffitzel et al. (2001), supra.
- the nucleotide sequence encoding it/them is/are cloned into an appropriate vector of the invention such that a polypeptide is expressed where the optimized amino acid is included in one or more sites as defined above (RDG region and/or V loop and/or floor region and/or B loop).
- a library of potential candidate binding sequences is directly cloned into a nucleic acid of the invention such that each sequence encodes a polypeptide containing a candidate binding sequence which included in one or more sites as defined above (RDG region and/or V loop and/or floor region and/or B loop).
- the inventive polypeptides comprising an initial library of candidate binding sequences are than typically expressed in vitro and selection of optimized binding sequences is carried out according to the ribosome display methodology as outlined in detail in Schaffitzel et al. (2001), supra, or any other suitable selection/evolution methodology for candidate amino acid sequence binding to the targeted molecule known in the art such as phage display, mRNA display, yeast display and/or baculovirus capsid display.
- the engineered adenovirus penton base proteins of the invention assemble into pentameric complexes, 12 of which in turn assemble into virus-like particles (VLPs) in a buffer solution of preferably pH about 5.0 to about 8.0.
- Preferred examples are buffer conditions at or near physiological conditions such as PBS, pH 7.4, or TBS or TBS-T pH 7.2 to 7.6. Under such conditions, the polypeptides of the invention form VLPs at a temperature of about from about 20 to about 42 °C.
- the present invention is also directed to such pentameric complexes and VLPs.
- Further subject matter of the invention is a nucleic acid coding for an ADDobody, minimal ADDobody or engineered adenovirus protein as defined herein.
- nucleic acid and “polynucleotide” are used interchangeably and refer to DNA, RNA or species containing one or more nucleotide analogues.
- Preferred nucleic acids or polynucleotides according to the present invention are DNA, most preferred double-stranded (ds) DNA.
- Nucleotide sequences of the present disclosure are shown from 5’ to 3’, and the lUPAC single letter code for bases is used, if not otherwise used as indicated.
- Embodiments of nucleic acids and vectors, respectively of the invention are also provided for insertion of the versatile heterologous modifications (as, for example, embodied by oligopeptides, polypeptides, proteins etc.as defined herein).
- An insertion site in the context of this embodiment of the invention is preferably a recognition sequence of a restriction enzyme or of a homing endonuclease.
- Restriction enzyme sites are generally well-known to the skilled person. Preferred examples are as defined above, but restriction sites can be selected from a wide variety and guidance can be found at the various manufacturers of restriction enzymes such as New England Biolabs, Inc., Ipswich, MA, USA.
- homing endonuclease (HE) sites include, but are not limited to, recognition sequences of Pl-Scel, l-Ceul, l-Ppol, l-Hmul l-Crel, l-Dmol, Pl-Pful and l-Msol, Pl-Pspl, I- Scel, other LAGLIDAG group members and variants thereof, SegH and Hef or other GIY-YIG homing endonucleases, l-Apell, 1-Anil, Cytochrome b mRNA maturase bl3, RI-T// ⁇ and Pl- TfuW, P ⁇ -Thyl and others; see Stoddard B.L. (2005) Q. Rev. Biophys. 38, 49-95. Corresponding enzymes are commercially available, e. g. from New England Biolabs Inc., Ipswich, MA, USA.
- the above-defined nucleic acid additionally comprises at least one site for integration of the nucleic acid into a vector or host cell.
- the integration site may allow for a transient or genomic incorporation.
- the integration site is preferably compatible for integration of the nucleic acid into an adenovirus, adeno-associated virus (AAV), autonomous parvovirus, herpes simplex virus (HSV), retrovirus, rhadinovirus, Epstein-Barr virus, lentivirus, semliki forest virus or baculovirus.
- AAV adeno-associated virus
- HSV herpes simplex virus
- retrovirus rhadinovirus
- Epstein-Barr virus Epstein-Barr virus
- lentivirus Epstein-Barr virus
- semliki forest virus semliki forest virus or baculovirus.
- Particularly preferred integration sites that may be incorporated into the nucleic acid of the present invention can be selected from the transposon element of Tn7, l-integrase specific attachment sites and site-specific recombinases (SSRs), in particular LoxP site or FLP recombinase specific recombination (FRT) site.
- SSRs site-specific recombinases
- FRT FLP recombinase specific recombination
- Further preferred mechanisms for integration of the nucleic acid according to the invention are specific homologous recombination sequences such as Ief2-603/Orf1629.
- the nucleic acid as described herein additionally contains one or more resistance markers for selecting against otherwise toxic substances.
- resistance markers useful in the context of the present invention include, but are not limited to, antibiotics such as ampicillin, chloramphenicol, gentamycin, spectinomycin, and kanamycin resistance markers.
- the nucleic acid of the present invention may also contain one or more ribosome binding site(s) (RBS)
- Further subject-matter of the present invention relates to a vector comprising a nucleic acid as defined above.
- Preferred vectors of the present invention are plasmids, expression vectors, transfer vectors, more preferred eukaryotic gene transfer vectors, transient or viral vector-mediated gene transfer vectors.
- Other vectors according to the invention are viruses such as adenovirus vectors, adeno-associated virus (AAV) vectors, autonomous parvovirus vectors, herpes simplex virus (HSV) vectors, retrovirus vectors, rhadinovirus vectors, Epstein-Barr virus vectors, lentivirus vectors, semliki forest virus vectors and baculovirus vectors.
- viruses such as adenovirus vectors, adeno-associated virus (AAV) vectors, autonomous parvovirus vectors, herpes simplex virus (HSV) vectors, retrovirus vectors, rhadinovirus vectors, Epstein-Barr virus vectors, lentivirus vectors, semliki forest virus vectors and baculovirus vectors.
- Baculovirus vectors suitable for integrating a nucleic acid according to the invention are also subject matter of the present invention and preferably contain site-specific integration sites such as a Tn7 attachment site (which may be embedded in a lacZ gene for blue/white screening of productive integration) and/or a LoxP site.
- site-specific integration sites such as a Tn7 attachment site (which may be embedded in a lacZ gene for blue/white screening of productive integration) and/or a LoxP site.
- Further preferred baculovirus according to the invention contain (alternative to or in addition to the above-described integration sites) a gene for expressing a substance toxic for host flanked by sequences for homologous recombination.
- An example for a gene for expressing a toxic substance is the diphtheria toxin A gene.
- a preferred pair of sequences for homologous recombination is e.g. Isf2- 603/Orf1629.
- the baculovirus can also contain further marker gene(s) as described above, including also fluorescent markers such as GFP, YFP and so on. Specific examples of corresponding baculovirus are, for example disclosed in WO 2010/100278 A1.
- Vectors useful in prokaryotic host cells comprise, preferably besides the above-exemplified marker genes (one or more thereof), an origin of replication (ori).
- an origin of replication ori
- examples are BR322, ColE1, and conditional origins of replication such as OriV and R6Ky, the latter being a preferred conditional origin of replication which makes the propagation of the vector of the present application dependent on the pir gene in a prokaryotic host.
- OriV makes the propagation of the vector of the present application dependent on the trfA gene in a prokaryotic host.
- the present invention is directed to a (recombinant) host cell containing a nucleic acid of the invention and/or a vector of the present invention.
- the host cells may be prokaryotic or eukaryotic.
- Eukaryotic host cells may for example be mammalian cells, preferably human cells.
- human host cells include, but are not limited to, HeLa, Huh7, HEK293, HepG2, KATO-III, IMR32,
- MT-2 pancreatic b-cells, keratinocytes, bone-marrow fibroblasts, CHP212, primary neural cells, W12, SK-N-MC, Saos-2, WI38, primary hepatocytes, FLC4, 143TK, DLD-1, embryonic lung fibroblasts, primery foreskin fibroblasts, MRC5, and MG63 cells.
- Further preferred host cells of the present invention are porcine cells, preferably CPK, FS-13, PK-15 cells, bovine cells, preferably MDB, BT cells, bovine cells, such as FLL-YFT cells.
- Other eukaryotic cells useful in the context of the present invention are C. elegans cells. Further eukaryotic cells include yeast cells such as S. cerevisiae, S. pombe, C. albicans and P. pastoris.
- the present invention is directed to insect cells as host cells which include cells from S. frugiperda, more preferably Sf9, Sf21, Express Sf+, High Five H5 cells, and cells from D. melanogaster, particularly S2 Schneider cells.
- Further host cells include Dictyostelium discoideum cells and cells from parasites such as Leishmania spec.
- Prokaryotic hosts according to the present invention include bacteria, in particular E. coli such as commercially available strains like TOP10, DH5a, HB101. BL21(DE3) etc.
- the vector as defined above additionally comprises a site for site specific recombinases (SSRs), preferably one or more LoxP sites for Cre-lox specific recombination.
- SSRs site specific recombinases
- the vector according to the present invention comprises a transposon element, preferably a Tn7 attachment site.
- attachment site as defined above is located within a marker gene.
- a marker gene is selected from luciferase, b-GAL, CAT, fluorescent encoding protein genes, preferably GFP, BFP, YFP, CFP and their variants, and the lacZa gene.
- the present invention also provides the polypeptide, the nucleic acid encoding such a polypeptide, the vector containing a polypeptide-encoding nucleic acid, the host cell comprising such a vector as well as the VLP as defined above for use as a medicament, in particular for use in the treatment and/or prevention of an infectious disease, an immune disease, tumour or cancer.
- the present invention is also directed to pharmaceutical compositions comprising a polypeptide as defined herein, a nucleic acid encoding such a polypeptide, a vector containing a polypeptide-encoding nucleic, a host cell comprising such a vector or a VLP as described above, optionally together with at least one pharmaceutically acceptable carrier, excipient and/or diluent.
- compositions in the context of the present invention their dosages and their routes of administration are known to the skilled person, and guidance can be found in the latest edition of Remington’s Pharmaceutical Sciences (Mack publishing Co., Eastern, PA, USA).
- the pharmaceutical compositions of the invention contain a therapeutically effective amount of the active ingredient as outlined above.
- the therapeutically effective amount depends on the active ingredient and in particular on the route of administration.
- the pharmaceutical composition according to the invention will preferably be applied by parenteral administration, in particular by infusion such as intravenous, intraarterial or intraosseous infusion, or by injection, e.g. intravenous, intraarterial, intraperitoneal, intramuscular, intradermal, subcutaneous or intrathecal injection.
- the pharmaceutical composition such as a pharmaceutical composition containing VLPs according to the invention, can also be administered by intra-tumoral injection.
- Inventive solutions for injection or infusion typically contain VLPs of the invention in water or an aqueous buffer solution, preferably an isotonic buffer at physiological pH.
- Liquid pharmaceutical compositions of the invention may contain further ingredients such as pharmaceutically acceptable stabilizers, suspending aids, emulsifyers and the likes. Further ingredients of the pharmaceutical composition of the invention are adjuvants, in particular in the context of application of the constructs of the invention for vaccination purposes.
- the invention provides a method for the prevention and/or treatment of an infectious disease comprising the step of administering to a subject, preferably a human, a therapeutically effective amount of the pharmaceutical composition as defined above, wherein the pharmaceutical composition comprises VLPs of the invention containing antigens or epitopes thereof, of the infective agent causing the infectious disease.
- Another embodiment is a method for preventing and/or treating a tumor or cancer disease the step of administering a therapeutically effective amount of the pharmaceutical composition as defined above to a subject, preferably a human, wherein the pharmaceutical composition comprises VLPs of the invention containing one or more tumour antigens or epitopes thereof.
- the invention provides a method for the prevention and/or treatment of an infectious disease comprising the step of administering to a subject, preferably a human, a therapeutically effective amount of the pharmaceutical composition as defined above, wherein the pharmaceutical composition comprises VLPs of the invention containing one or more antibodies or antibody fragments such as a paratope thereof, recognizing an antigen, in particular an epitope, of the infective agent causing the infectious disease.
- Another embodiment is a method for preventing and/or treating a tumor or cancer disease the step of administering a therapeutically effective amount of the pharmaceutical composition as defined above to a subject, preferably a human, wherein the pharmaceutical composition comprises VLPs of the invention one or more antibodies or antibody fragments such as a paratope thereof, recognizing a tumour or cancer antigen, in particular an epitope thereof.
- the present invention is further directed to a method for producing the polypeptide as described herein comprising the step of cultivating the recombinant host cell in a suitable medium, wherein the host cell comprises a vector which comprises a nucleic encoding the polypeptide, under conditions allowing the expression of said polypeptide.
- the method for producing the polypeptide of the invention further comprises the step of recovering the expressed polypeptide from the host cells and/or the medium. Even more preferred, the method also comprises the step of purifying the recovered polypeptide by purification means known in the art such as centrifugation, gel chromatography, ion exchange chromatography, affinity chromatography etc.
- the invention also provides a method for producing a VLP as defined herein comprising the step of incubating a solution of the polypeptide under conditions allowing the assembly of the polypeptide into a VLP as outlined before.
- the proper formation of VLPs can be tested by inspecting a sample solution with an electron microscope.
- Fig. 1 shows a schematic representation illustrating the use of the adenovirus penton base protein crown domain of the invention (the “ADDobody”) to generate high affinity mono- and/or multivalent binder molecules by selection/evolution from a randomized ADDobody library.
- An ADDobody library can be generated by randomizing a selection or all of the loops. From this ADDobody library, specific binders can be identified that can bind to any antigen by applying selection/evolution techniques, such as phage display, mRNA display, yeast display, baculovirus capsid display or ribosome display or others.
- Fig. 2 shows a schematic representation illustrating the use of the adenovirus penton base protein crown domain of the invention (the “ADDobody”) to generate multivalent vaccines by reverse vaccinology.
- the crown is shown schematically on the extreme left.
- the crown domain is colored in green.
- Four distinct sites have been identified for insertion of heterologous peptide and polypeptide sequences in ADDobody (abbreviated here schematically as ‘loops’). Randomization of these loops yields an ADDobody library that can be utilized to identify loop sequences specifically bound by antibodies prevalent in sera of infected patients or iummunized animals. Identification of such epitopic sequences can be used to generate mono- or multivalent ADDOmer superantigens for therapeutic purposes.
- FIG. 3 shows (A) Dodecahedra formed by base proteins of certain Adenovirus serotypes represent a versatile scaffold.
- the high resolution cryo-EM structure (6HCR) is shown. The view is down a central penton axis. Each color stands for a different penton base protein (B)
- the ADDomer comprises 60 copies of the adenovirus penton base protein.
- the penton base protein has a two-domain architecture; a crown domain (top) and a multimerization domain (below).
- the multimerization domain adopts a jellyroll fold.
- the crown domain comprises exposed highly variable loops.
- the domains can be separated into two independent protein entities.
- the crown domain itself can be produced and purified in large quantity.
- crown domain can be engineered to allow display of heterologous peptide sequences (see Fig. 1 and Fig. 2).
- C The crown domain is represented in this schematic view in Figures 1 and 2. Removal of the multimerization domain yields an autonomous protein domain according to the invention (the “ADDobody”) which can be produced in large quantity, purified and crystallized.
- Fig. 4 shows a schematic representation of the construct pPROEX HTb ADDomer2_Head for expression of an ADDobody of the invention based on human Adenovirus serotype 3 (Adh3).
- Fig. 5 shows a MonoQ elution profile of the ADDobody construct ADDomer2_Head
- Fig. 6 shows a size exclusion chromatogram of the MonoQ-eluted ADDobody construct ADDomer2_Head
- Fig. 7 shows a SDS polyacrylamide gel analysis of the peak fractions of the size exclusion chromatography according to Fig. 6.
- Fig. 8 shows a SDS polyacryl amide gel analysis of a sample of the pooled peak fractions of the size exclusion chromatography according to Fig. 6 before and after freeze drying.
- Fig. 9 shows an exemplary single crystal of the ADDobody construct ADDomer2_Head.
- Fig. 10 shows top views of the X-ray solution structure of the ADDobody construct ADDomer2_Head.
- Fig. 11 shows top views of the X-ray solution structure of the ADDobody construct ADDomer2 Head without unit cell.
- Fig. 12 shows side views of the X-ray solution structure of the ADDobody construct ADDomer2 Head.
- Fig. 13 Fig. 11 shows side views of the X-ray solution structure of the ADDobody construct ADDomer2 Head without unit cell.
- nucleotide sequence coding for an ADDobody of the invention (named ADDomer2_Head ) equipped with a His-Tag sequence
- the resulting vector has the following sequence (ORF start and stop shown in bold, coding sequence in lower characters):
- the polypeptide was produced and purified as follows:
- IPTG stock 2.4 g IPTG is dissolved in 10 ml dhhO and filtered through a 0.2pm filter.
- the expression and purification protocol is described per 1L culture. It should be upscaled accordingly if more expression cultures are required. Normally, 3-5L expression culture for one big prep should be made, and the purified protein stored frozen.
- BL21 (DE3) bacteria transformation pProEX_HTB_ AD3Head plasmid encoding for the ADDomer head or ‘crown’ domain (the ADDobody) is transformed into BL21(DE3) competent cells and plated onto LB agarose plate containing ampicillin as selection marker 1.1. Plate preparation:
- Bottle is chilled under running tap water • 1000x Ampicillin stock is added (100 mI to 100 ml LB agarose)
- High salt wash buffer pH 7.4 (set on ice at 4 °C)
- Resin is resuspended in 1 mL 1x PBS and transferred to a 1.5 ml Eppendorf tube. Centrifuged at 1000 rpm for 5 min, and supernatant is discarded.
- Tube is centrifuged at 13.000 rpm for 5 min, supernatant is collected to fresh tube (E1).
- Tube is centrifuged at 13000 rpm for 5 min, supernatant is collected to fresh tube (E2).
- Tube is centrifuged at 13000 rpm for 5 min, supernatant is collected to fresh tube (E3).
- Resin is resuspended in 1 ml elution buffer (‘Resin’). 12 ul taken.
- Protein concentration is measured with Nanodrop (A280) prior to dialysis and TEV cleavage (use Elution Buffer as blank to correct for imidazol).
- Recover sample comprising ADDobody, measure concentration of protein against dialysis buffer as blank, determine volume of sample and insert in Table I (see Annex).
- Ion exchange chromatography is performed with AKTA Pure system using Mono Q 5/50 GL column.
- Buffer A 1 X PBS (freshly made and filtered)
- Buffer B 1 X PBS with 1 M NaCI
- ADDobody elutes in FT 1-10 ml elution volume (and a minor peak around 20 ml elution volume.)
- FIG. 5 An exemplary elution profile is shown in Fig. 5.
- Buffer A 1X PBS (freshly made and filtered)
- Size exclusion chromatography is performed of 500ul aliquots of concentrated sample with AKTA Pure system using HiLoad 16/600 Superdex 200 pg column.
- Protein is flash-frozen in 100 pi aliquots in low protein binding tubes and stored at -20 °C.
- FIG. 8 A SDS polyacrylamide gel analysis of the pooled fractions before and after freezing is shown in Fig. 8 (before freezing: Cone. In; after freezing: Cone out) shows that the ADDobody construct ADDomer2_Head is stable.
- the truncated (i.e. maturated) polypeptide ADDomer2_Head (the amino acid sequence according to SEQ ID NO: 27 lacking the His tag-containing sequence
- Crystallization conditions sitting drop, PEG3350 20 % (w/v), 0.1 M citrate pH 5.5, protein concentration: 5 mg/ml, drop size: 0.5 ul protein and 0.5 ul reservoir.
- the unit cell contains 20 ADDobodies present in 2 decamers.
- the floor region of fragment A and the B loop of fragment B of the ADDobody forms a flexible structure in the isolated ADDobody
- nucleotide sequence coding for a further ADDobody of the invention (named ChimpCrown ) equipped with a His-Tag sequence
- MSYYHHHHHHDYDIPTTENLYFQGTIMHTNMPNVNEFMYSNKFKARVMVSRKAPEGV TVNDTYDHKEDILEYEWVEFELPEGNFSVTMTIDLMNNAIIDNYLAVGRQNGVLESDIGVKFDTRNFR LGWDPVTELVMPGVYTNEAFHPDIVLLPGCGVDFTESRLSNLLGIRKRQPFQEGFQIMYEDLEGGNIP ALLDVDAYEKSKKDTTTETTTKKELKIQPVEKDSKDRSYNVLPDKINTAYRSWYLAYNYGDPEKGVRS WTLLTTSDVTCGVEQAELLPVYSKSFFNEQAVYSQQLRAFTSLTHVFNRFPENQILVRPPAPTITTVS ENVP
- nucleotide sequence coding for a modified ADDobody of the invention containing the major neutralizing epitope from Chikungunya virus STKDNFNVYKATRPYLAH (SEQ ID NO: 40) in the B looop of fragment B and replacing the seqeuence HVFNRF (SEQ ID NO: 41) in the wild-type fragment B of hAd3 penton base (equipped with a His-Tag sequence) MSYYHHHHHHDYDIPTTENLYFQGAMGSGIQPNVNEYMFSNKFKARVMVSRKAPEGVTVNDTYDHKED
- the present invention is particularly directed to the following items:
- An isolated engineered polypeptide comprising the amino acid stretches essentially corresponding to a first and a second fragment of the penton base wherein the first fragment of the polypeptide is present between the first and second amino acid stretches forming the jellyroll fold domain in the full length penton base and wherein the second fragment of the polypeptide is present between the second and third fragments forming the jellyroll fold domain in the full length penton base, respectively, wherein the isolated engineered domain lacks the amino acid stretches forming the jellyroll fold domain of the adenovirus penton base, wherein optionally the first and/or second fragments of the polypeptide contain(s) one or more heterologous modification(s).
- A represents an amino acid stretch corresponding to the N-terminal amino acid stretch of the adenovirus penton base present between the first and the second amino acid stretch forming the jellyroll fold domain of the adenovirus penton base;
- B represents an amino acid stretch corresponding to the C-terminal amino acid stretch of the adenovirus penton base inserted between the second and the third amino acid stretch forming the jellyroll fold domain of the adenovirus penton base;
- L represents a chemical group selected from the group consisting of an amino acid, an oligopeptide and a polypeptide
- N may or may not be present, and, if present, represents a chemical group consisting of an amino acid, an oligopeptide and a polypeptide
- C may or may not be present, and, if present, represents a chemical group consisting of an amino acid, an oligopeptide and a polypeptide; wherein, optionally, fragment A and/or B contain(s) one or more heterologous modifications.
- fragment A comprises an amino acid sequence selected from the group consisting of the amino acid sequences according to the following table and amino acid sequences having an identity of at least 85 %, more preferred at least 90 %, even more preferred 95 %, particularly preferred at least 98 %, most preferred at least 99 %, with the respective amino acid sequence shown in the following table: wherein, optionally, fragment A contains one or more heterologous modifications. 4.
- fragment B comprises an amino acid sequence selected from the group consisting of the amino acid sequences according to the following table and amino acid sequences having an identity of at least 85 %, more preferred at least 90 %, even more preferred 95 %, particularly preferred at least 98 %, most preferred at least 99 %, with the respective amino acid sequence shown in the following table: wherein, optionally, fragment B contains one or more heterologous modifications.
- fragment A and/or B contain(s) one or more heterologous modifications wherein said one or more heterologous modifications is/are contained in the following sites:
- Xi is I or L, and is preferably I;
- X 2 is selected from the group consisting of K, Q and E, and is preferably Q;
- X 3 is P or A, and is preferably P;
- X 4 is selected from the group consisting of L, V and I, and is preferably L
- X 5 is selected from the group consisting of T, E, A, K and L, and is preferably E;
- Cb is selected from the group consisting of E, K, T and Q, and is preferably K;
- X 7 is selected from the group consisting of S, P and D, and is preferably S;
- Xs is selected from the group consisting of K, T and S, and is preferably K;
- Xg is selected from the group consisting of K, S, N, G and D, and is preferably S;
- X 10 is L or V, and is preferably V;
- X 11 is I or L, and is preferably I;
- X 12 is selected from the group consisting of S, E and P, and is preferably E;
- Xi 3 is no amino acid (i.e. not present) or is N, and is preferably no amino acid;
- Xi 4 is D or G, and is preferably D;
- Xi 5 is selected from the group consisting of S, K, Q and T, and is preferably K;
- X 16 is selected from the group consisting of T, N, I, K and M, and is preferably I; and/or
- X 18 is selected from the group consisting of D, E and N, and is preferably D;
- Xi 9 is selected from the group consisting of V, L, and I, and is preferably V;
- X 20 is any amino acid, preferably selected from the group consisting of A, D, E, K, S, and T, and is more preferably T ;
- X 21 is any amino acid, preferably selected from the group consisting of A, D, E, and K, and is more preferably A;
- X 22 is selected from the group consisting of F, Y, and W, and is preferably Y;
- X 23 is selected from the group consisting of A, D, E, N, and Q, is preferably E or Q, and is more preferably E;
- X 24 is any amino acid, preferably selected from the group consisting of A, D, E, N, and K, and is more preferably E;
- X 25 is selected from the group consisting of S or T, and is preferably S; and
- X 26 is any amino acid and constitutes the N-terminal amino acid of the RGD loop region
- X 27 is any amino acid and constitutes the C-terminal amino acid of the second RGD loop
- X 28 is selected from the group consisting of I, L and V, and is preferably I;
- X 29 is selected from the group consisting of D, E, K, N, Q, and V, is preferably Q or K, and is more preferably Q;
- X 30 is selected from the group consisting of C, G and P, and is preferably P;
- X 31 is selected from the group consisting of I, L and V, is preferably L or V and is more preferably L;
- X 32 is selected from the group consisting of D, E, S and T, is preferably E or T and is more preferably E;
- X 33 is selected from the group consisting of D, E, , S and T, is preferably E, or T, and is more preferably K;
- X 34 is selected from the group consisting of D and E, and is preferably D;
- X 35 is selected from the group consisting of F, Y, and W, and is preferably F;
- X 36 is selected from the group consisting of H, K and R, and is preferably K;
- X 37 is selected from the group consisting of A, V, I, and L, and is preferably A;
- X 38 is selected from the group consisting of H, K, and R, and is preferably R;
- X 39 is selected from the group consisting of A, V, I, and L, and is preferably V;
- X 40 is selected from the group consisting of A, V, I, L and M, and is preferably M;
- X 41 is selected from the group consisting of A, V, I, and L, and is preferably V; and X 42 is any amino acid and constitutes the N-terminal amino acid of the V loop.
- X43 is any amino acid and constitutes the C-terminal amino acid of the V loop
- X44 is selected from the group consisting of F, Y, and W, and is preferably Y;
- X45 is selected from the group consisting of D, E, S and T, is preferably E or T and is more preferably E;
- X46 is selected from the group consisting of F, Y, and W, and is preferably W;
- X47 is selected from the group consisting of A, F, V, Y, and W, is preferably F or V and is more preferably F;
- X48 is selected from the group consisting of D, E, S and T, is preferably D or E and is more preferably E;
- X49 is selected from the group consisting of F, Y, and W, and is preferably F.
- heterologous modification is selected from the group consisting of one or more single amino acid mutations in comparison to the wildtype sequence of fragment A and/or B, one or more replacements of wildtype amino acid stretches by one or more heterologous amino acids and/or amino acid stretches one or more insertions of heterologous amino acid stretches, one or more deletions of one or more amino acids and one or more amino acid modifications as well as any combination(s) thereof.
- A represents an amino acid stretch corresponding to the N-terminal amino acid stretch of the adenovirus penton base present between the first and the second amino acid stretch forming the jellyroll fold domain of the adenovirus penton base;
- N may or may not be present, and, if present, represents a chemical group consisting of an amino acid, an oligopeptide and a polypeptide;
- fragment A may or may not be present, and, if present, represents a chemical group consisting of an amino acid, an oligopeptide and a polypeptide; wherein, optionally, fragment A contain one or more heterologous modifications.
- fragment A contains one or more heterologous modifications wherein said one or more heterologous modifications is/are contained in the following sites:
- Xi is I or L, and is preferably I;
- X2IS selected from the group consisting of K, Q and E, and is preferably Q;
- X 3 is P or A, and is preferably P;
- X4 is selected from the group consisting of L, V and I, and is preferably L X5 is selected from the group consisting of T, E, A, K and L, and is preferably E;
- Cb is selected from the group consisting of E, K, T and Q, and is preferably K;
- X7 is selected from the group consisting of S, P and D, and is preferably S;
- Xs is selected from the group consisting of K, T and S, and is preferably K;
- Xg is selected from the group consisting of K, S, N, G and D, and is preferably S;
- X10 is L or V, and is preferably V;
- X11 is I or L, and is preferably I;
- X12 is selected from the group consisting of S, E and P, and is preferably E;
- Xi3 is no amino acid (i.e. not present) or is N, and is preferably no amino acid;
- Xi4 is D or G, and is preferably D;
- Xi5 is selected from the group consisting of S, K, Q and T, and is preferably K;
- X16 is selected from the group consisting of T, N, I, K and M, and is preferably I; and/or
- X18 is selected from the group consisting of D, E and N, and is preferably D;
- Xi 9 is selected from the group consisting of V, L, and I, and is preferably V;
- X20 is any amino acid, preferably selected from the group consisting of A, D, E, K, S, and T, and is more preferably T ;
- X21 is any amino acid, preferably selected from the group consisting of A, D, E, and K, and is more preferably A;
- X22 is selected from the group consisting of F, Y, and W, and is preferably Y;
- X23 is selected from the group consisting of A, D, E, N, and Q, is preferably E or Q, and is more preferably E;
- X24 is any amino acid, preferably selected from the group consisting of A, D, E, N, and K, and is more preferably E;
- X25 is selected from the group consisting of S or T, and is preferably S; and X26 is any amino acid and constitutes the N-terminal amino acid of the RGD loop region
- the polypeptide of item 17 or 18 wherein the C-terminus of the RGD loop region of fragment A is defined by the following sequence (from N-terminal to C-terminal): X27-X28-X29-X30-X31 -X32-X33-X34 (SEQ ID NO: 24)
- X27 is any amino acid and constitutes the C-terminal amino acid of the second RGD loop
- X28 is selected from the group consisting of I, L and V, and is preferably I;
- X29 is selected from the group consisting of D, E, K, N, Q, and V, is preferably Q or K, and is more preferably Q;
- X30 is selected from the group consisting of C, G and P, and is preferably P;
- X31 is selected from the group consisting of I, L and V, is preferably L or V and is more preferably L;
- X32 is selected from the group consisting of D, E, S and T, is preferably E or T and is more preferably E;
- X33 is selected from the group consisting of D, E, , S and T, is preferably E, or T, and is more preferably K;
- X34 is selected from the group consisting of D and E, and is preferably D;
- X35 is selected from the group consisting of F, Y, and W, and is preferably F;
- X36 is selected from the group consisting of H, K and R, and is preferably K;
- X37 is selected from the group consisting of A, V, I, and L, and is preferably A;
- X38 is selected from the group consisting of H, K, and R, and is preferably R;
- X39 is selected from the group consisting of A, V, I, and L, and is preferably V;
- X40 is selected from the group consisting of A, V, I, L and M, and is preferably M;
- X41 is selected from the group consisting of A, V, I, and L, and is preferably V; and X42 is any amino acid and constitutes the N-terminal amino acid of the V loop.
- X43 is any amino acid and constitutes the C-terminal amino acid of the V loop
- X44 is selected from the group consisting of F, Y, and W, and is preferably Y;
- X45 is selected from the group consisting of D, E, S and T, is preferably E or T and is more preferably E;
- X46 is selected from the group consisting of F, Y, and W, and is preferably W;
- X47 is selected from the group consisting of A, F, V, Y, and W, is preferably F or V and is more preferably F;
- X48 is selected from the group consisting of D, E, S and T, is preferably D or E and is more preferably E;
- X49 is selected from the group consisting of F, Y, and W, and is preferably F.
- heterologous modification is selected from the group consisting of one or more single amino acid mutations in comparison to the wildtype sequence of fragment A, one or more replacements of wildtype amino acid stretches by one or more heterologous amino acids and/or amino acid stretches one or more insertions of heterologous amino acid stretches, one or more deletions of one or more amino acids and one or more amino acid modifications as well as any combination(s) thereof.
- the target specific binding entity is selected from the group consisting of antigens, epitopes, CDRs, antibodies, antibody fragments such as an antigen binding (Fab) fragment, a Fab' fragment, a F(ab')2fragment, a heavy chain antibody, a single-domain antibody (sdAb), a single-chain fragment variable (scFv), a fragment variable (Fv), a VH domain, a VL domain, a single domain antibody, a nanobody, an IgNAR (immunoglobulin new antigen receptor), a di-scFv, a bispecific T-cell engager (BITEs), a dual affinity re-targeting (DART) molecule, a triple body, a diabody, a single-chain diabody, a paratope, an alternative scaffold protein, and a fusion protein thereof, a toxin and a venom.
- Fab antigen binding
- Fab' fragment fragment antigen binding
- a nucleic acid encoding a polypeptide according to any one of the preceding items A vector comprising the nucleic acid of item 25.
- the vector of item 26 containing the nucleic acid of item 15 within an expression cassette.
- a recombinant host cell comprising the nucleic acid of item 24 or the vector of item 26 or 27.
- a method for the production of a polypeptide according to any one of items 1 to 24 comprising the step of culturing the host cell of item 28 containing the vector of item 28 under conditions allowing the expression of said polypeptide.
- the method of item 29 further comprising the step of purifying the polypeptide from the cultured host cells.
- An engineered adenovirus penton base protein comprising the polypeptide according to any one of items 5 to 12 fused to the multimerization domain (jellyroll fold domain) of an adenovirus penton base protein.
- the penton base protein of item 31 having, from N- to C-terminal, the structure of the following general formula III:
- D-A-E-B-F (III) wherein A and B are the fragments of the alpha-helical crown domain as defined in any one of items 2 to 4, and D, E and F are the amino acid sequences of an adenovirus penton base forming the multimerization (jellyroll fold) domain, wherein one or more heterologous modifications is/are present in the floor region of fragment A and/or in the B loop of fragment B.
- An engineered adenovirus penton base protein comprising the polypeptide according to any one of item 15 to 24 fused to the multimerization domain (jellyroll fold domain) of an adenovirus penton base protein.
- D-A-E-Li-F (IV) wherein A is the large fragment of the alpha-helical crown domain as defined in any one of items 15 or 16, and D, E and F are the amino acid sequences of an adenovirus penton base forming the multimerization (jellyroll fold) domain, wherein, optionally and preferably, one or more heterologous modifications is/are present in the floor region of fragment A, and wherein Li is a linker selected from peptides, oligopeptides, polypeptides, proteins and protein complexes.
- J2 is E or S
- J 3 is L or V
- J4 is A or S
- J 5 is L or Q
- J 6 is Y or E
- J7 is R or K
- Jg V or I
- J 10 is F or Y Jii is T or S
- J 12 is A or T or I or G
- J 13 is S or G
- J 1 s is E or D
- J 16 is A or G
- J 17 is D or Q
- J 1 8 is L or M
- Z5 if present, is V or I
- Zs if present, is Y or F
- Z10 if present, is F or S or Y
- Z11 if present, is T or S
- Z12 if present, is S or N
- Z16 if present, is K. 6.
- (III) or (IV) has the following sequence (SEQ ID NO: 35): wherein: fragment E begins on the N-terminal side at an amino acid from Z17 to Z27 or at amino acid Q after Z27; amino acid stretch B ends on the C-terminal side before Z28 at amino acid L or at an amino acid from Z28 to Z30;
- Zi7 if present, is L or S
- Z18 if present, is T or P or C
- Zi9 if present, is T or P
- Z20 if present, is P or S or A or R
- Z21 if present, is N or D
- Z22 if present, is G or V
- Z23 if present, is H or T
- Z26 if present, is A or V or S Z27 , if present, is E or Q
- J20 is L or M
- J21 is Q or K
- J22 is Q or R or S J23 is V or I
- J24 is S or N J25 is Y or F J26 is A or V Z28 , if present, is M or L Z 29 , if present, is P
- Z30 if present, is V or F.
- the fragment E comprises an amino acid sequence selected from the group consisting of the amino acid sequences of the following table and amino acid sequences having and identity of at least 85 %, more preferred at least 90 %, even more preferred 95 %, particularly preferred at least 98 %, most preferred at least 99 %, with the respective amino acid sequence shown in the following table:
- fragment F begins on the N-terminal side at an amino acid from Z31 to Z33 or at amino acid A after Z33;
- J27 is R or S or G
- J28 is V or I
- J29 is Y or H
- J30 is A or S
- J31 is R or K
- fragment F comprises an amino acid sequence selected from the group consisting of the amino acid sequences of the following table and amino acid sequences having and identity of at least 85 %, more preferred at least 90 %, even more preferred 95 %, particularly preferred at least 98 %, most preferred at least 99 %, with the respective amino acid sequence shown in the following table:
- VLP virus-like particle
- a pharmaceutical composition comprising a polypeptide according to any one of items 1 to 24 or the engineered adenovirus penton base protein according to any one of items 32 to 40 or the VLP of item 42, optionally together with at least one pharmaceutically acceptable carrier, excipient and/or diluent.
- a method for producing the VLP of item 42 comprising the step of incubating a solution of a penton base according to any one of items 32 to 40 under conditions allowing the assembly of the polypeptide into a VLP.
- polypeptide according to any one of items 1 to 24 or the VLP of item 42 for use in the treatment and/or prevention of an infectious disease, an immune disease, tumour or cancer.
- a method of identifying a binding sequence to a target molecule comprising the steps of: (ia) preparing a library of vectors each containing a nucleotide sequence encoding a polypeptide having a candidate binding sequence in an expression cassette, each polypeptide encoded by said nucleotide sequence comprising a candidate binding sequence as a heterologous modification in one or more of RGD loop region and/or V loop and/or floor region and/or B loop as defined in any one of items 5 to 9, wherein the candidate binding sequence encoded by the nucleotide sequence in each vector is different such that the vectors contain a randomized library of nucleotide sequences encoding randomized candidate binding sequences; or
- step (ii) expressing the polypeptides encoded by the nucleotide sequences from the library of vectors of step (ia) or ib) in a host cell or a cell-free system, preferably cell free system;
- step (iii) contacting the polypeptides expressed in step (ii), optionally after purification from the host cells or the cell-free system, preferably cell free system, with the target molecule;
Landscapes
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Zoology (AREA)
- Biomedical Technology (AREA)
- Wood Science & Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- Virology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Medicinal Chemistry (AREA)
- Gastroenterology & Hepatology (AREA)
- Plant Pathology (AREA)
- Bioinformatics & Computational Biology (AREA)
- Microbiology (AREA)
- Crystallography & Structural Chemistry (AREA)
- Physics & Mathematics (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicinal Preparation (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US17/797,941 US20230101439A1 (en) | 2020-02-05 | 2021-02-05 | Engineered Polypeptides Derived From Variable Domain of Adenovirus Penton Base |
| EP21703917.1A EP4100421A1 (en) | 2020-02-05 | 2021-02-05 | Engineered polypeptides derived from variable domain of adenovirus penton base |
| JP2022547688A JP2023513512A (ja) | 2020-02-05 | 2021-02-05 | アデノウイルス ペントンベースの可変ドメイン由来の操作されたポリペプチド |
| BR112022015461A BR112022015461A2 (pt) | 2020-02-05 | 2021-02-05 | Polipeptídeos, ácido nucleico, vetor, célula hospedeira, proteínas de base do penton de adenovírus, complexo pentamérico, partícula semelhante a vírus (vlp), composição farmacêutica, métodos para produzir a vlp e para a produção de um polipeptídeo e método de identificação de uma sequência de ligação |
| AU2021216124A AU2021216124A1 (en) | 2020-02-05 | 2021-02-05 | Engineered polypeptides derived from variable domain of adenovirus penton base |
| MX2022009574A MX2022009574A (es) | 2020-02-05 | 2021-02-05 | Polipéptidos modificados derivados de dominio variable de la base pentona de adenovirus. |
| CA3166852A CA3166852A1 (en) | 2020-02-05 | 2021-02-05 | Engineered polypeptides derived from variable domain of adenovirus penton base |
| CN202180024156.1A CN115427431A (zh) | 2020-02-05 | 2021-02-05 | 衍生自腺病毒五邻体基座的可变结构域的工程化多肽 |
| ZA2022/09759A ZA202209759B (en) | 2020-02-05 | 2022-08-31 | Engineered polypeptides derived from variable domain of adenovirus penton base |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP20155742.8 | 2020-02-05 | ||
| EP20155742 | 2020-02-05 | ||
| EP20155982.0 | 2020-02-06 | ||
| EP20155982 | 2020-02-06 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2021156489A1 true WO2021156489A1 (en) | 2021-08-12 |
Family
ID=74561908
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2021/052884 Ceased WO2021156489A1 (en) | 2020-02-05 | 2021-02-05 | Engineered polypeptides derived from variable domain of adenovirus penton base |
Country Status (10)
| Country | Link |
|---|---|
| US (1) | US20230101439A1 (https=) |
| EP (1) | EP4100421A1 (https=) |
| JP (1) | JP2023513512A (https=) |
| CN (1) | CN115427431A (https=) |
| AU (1) | AU2021216124A1 (https=) |
| BR (1) | BR112022015461A2 (https=) |
| CA (1) | CA3166852A1 (https=) |
| MX (1) | MX2022009574A (https=) |
| WO (1) | WO2021156489A1 (https=) |
| ZA (1) | ZA202209759B (https=) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2024042100A1 (en) | 2022-08-22 | 2024-02-29 | Imophoron Limited | Adenovirus penton-based virus-like particles |
Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2005085456A1 (en) | 2004-03-09 | 2005-09-15 | Eidgenoessische Technische Hochschule Zurich | New expression tools for multiprotein applications |
| WO2010100278A2 (en) | 2009-03-06 | 2010-09-10 | Europäisches Laboratorium für Molekularbiologie (EMBL) | Nucleic acids for cloning and expressing multiprotein complexes |
| WO2010151159A2 (en) * | 2009-06-26 | 2010-12-29 | Instytut Biochemii I Biofizyki | Virus-like particle vector as a polyvalent platform for intracellular delivery of high-molecular-weight therapeutic substances, method for generating a virus like particle vector and use of a virus-like particle vector and a pharmaceutical composition containing said virus-like particle vector |
| WO2017167988A1 (en) | 2016-03-31 | 2017-10-05 | The European Molecular Biology Laboratory | Adenoviral coat protein derived delivery vehicles |
| WO2019016756A1 (en) * | 2017-07-21 | 2019-01-24 | Glaxosmithkline Biologicals Sa | ANTIGEN CONSTRUCTS OF CHIKUNGUNYA VIRUSES |
| WO2020025724A1 (en) * | 2018-07-31 | 2020-02-06 | Imophoron Ltd. | Multimerizing polypeptides derived from jelly roll fold domain of adenovirus penton base |
-
2021
- 2021-02-05 WO PCT/EP2021/052884 patent/WO2021156489A1/en not_active Ceased
- 2021-02-05 BR BR112022015461A patent/BR112022015461A2/pt not_active IP Right Cessation
- 2021-02-05 CN CN202180024156.1A patent/CN115427431A/zh active Pending
- 2021-02-05 JP JP2022547688A patent/JP2023513512A/ja active Pending
- 2021-02-05 MX MX2022009574A patent/MX2022009574A/es unknown
- 2021-02-05 US US17/797,941 patent/US20230101439A1/en active Pending
- 2021-02-05 AU AU2021216124A patent/AU2021216124A1/en not_active Abandoned
- 2021-02-05 EP EP21703917.1A patent/EP4100421A1/en not_active Withdrawn
- 2021-02-05 CA CA3166852A patent/CA3166852A1/en active Pending
-
2022
- 2022-08-31 ZA ZA2022/09759A patent/ZA202209759B/en unknown
Patent Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2005085456A1 (en) | 2004-03-09 | 2005-09-15 | Eidgenoessische Technische Hochschule Zurich | New expression tools for multiprotein applications |
| WO2010100278A2 (en) | 2009-03-06 | 2010-09-10 | Europäisches Laboratorium für Molekularbiologie (EMBL) | Nucleic acids for cloning and expressing multiprotein complexes |
| WO2010151159A2 (en) * | 2009-06-26 | 2010-12-29 | Instytut Biochemii I Biofizyki | Virus-like particle vector as a polyvalent platform for intracellular delivery of high-molecular-weight therapeutic substances, method for generating a virus like particle vector and use of a virus-like particle vector and a pharmaceutical composition containing said virus-like particle vector |
| WO2017167988A1 (en) | 2016-03-31 | 2017-10-05 | The European Molecular Biology Laboratory | Adenoviral coat protein derived delivery vehicles |
| WO2019016756A1 (en) * | 2017-07-21 | 2019-01-24 | Glaxosmithkline Biologicals Sa | ANTIGEN CONSTRUCTS OF CHIKUNGUNYA VIRUSES |
| WO2020025724A1 (en) * | 2018-07-31 | 2020-02-06 | Imophoron Ltd. | Multimerizing polypeptides derived from jelly roll fold domain of adenovirus penton base |
Non-Patent Citations (13)
| Title |
|---|
| "Current Protocols In Molecular Biology", MACK PUBLISHING CO. |
| "UniProt", Database accession no. AOAOA1 EWW1 |
| BODERWITTRUP, NAT. BIOTECHNOL., vol. 15, 1997, pages 553 - 557 |
| CHARLES VRAGNIAU ET AL: "Synthetic self-assembling ADDomer platform for highly efficient vaccination by genetically encoded multiepitope display", SCI. ADV, 25 September 2019 (2019-09-25), pages eaaw2853, XP055633089, Retrieved from the Internet <URL:https://advances.sciencemag.org/content/5/9/eaaw2853> [retrieved on 20191016], DOI: 10.1126/sciadv.aaw2853 * |
| CHIEN ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 88, 1983, pages 9578 - 9582 |
| EWA SZOLAJSKA ET AL: "The Structural Basis for the Integrity of Adenovirus Ad3 Dodecahedron", PLOS ONE, vol. 7, no. 9, 25 September 2012 (2012-09-25), pages e46075, XP055634098, DOI: 10.1371/journal.pone.0046075 * |
| FIELDSSONG, NATURE, vol. 340, 1989, pages 245 - 246 |
| GEORGIU ET AL., TRENDS BIOTECHNOL, vol. 11, 1993, pages 6 - 10 |
| SCHAFFITZEL ET AL.: "Protein-Protein Interactions, A Molecular Cloning Manual", 2001, COLD SPRING HARBOR LABORATORY PRESS, article "In vitro selection and evolution of protein-ligand interaction by ribosome display", pages: 535 - 567 |
| SMITH, SCIENCE, vol. 228, 1985, pages 1315 - 1317 |
| STODDARD B.L., Q. REV. BIOPHYS., vol. 38, 2005, pages 49 - 95 |
| SZURGOT INGA ET AL: "Self-adjuvanting influenza candidate vaccine presenting epitopes for cell-mediated immunity on a proteinaceous multivalent nanoplatform", VACCINE, vol. 31, no. 40, 20 July 2013 (2013-07-20), pages 4338 - 4346, XP028697958, ISSN: 0264-410X, DOI: 10.1016/J.VACCINE.2013.07.021 * |
| WINTER ET AL., ANNU. REV. IMMUNOL., vol. 12, 1994, pages 433 - 455 |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2024042100A1 (en) | 2022-08-22 | 2024-02-29 | Imophoron Limited | Adenovirus penton-based virus-like particles |
Also Published As
| Publication number | Publication date |
|---|---|
| BR112022015461A2 (pt) | 2022-10-11 |
| AU2021216124A1 (en) | 2022-09-29 |
| JP2023513512A (ja) | 2023-03-31 |
| ZA202209759B (en) | 2023-07-26 |
| US20230101439A1 (en) | 2023-03-30 |
| CN115427431A (zh) | 2022-12-02 |
| MX2022009574A (es) | 2022-11-16 |
| EP4100421A1 (en) | 2022-12-14 |
| CA3166852A1 (en) | 2021-08-12 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12122806B2 (en) | Adenoviral coat protein derived delivery vehicles | |
| CN1859923B (zh) | Hpv 45 l1在酵母中的优化表达 | |
| CN106255699B (zh) | 细胞穿透肽和使用其输送生物活性物质的方法 | |
| US20210332088A1 (en) | Multimerizing Polypeptides Derived From Jelly Roll Fold Domain of Adenovirus Penton Base | |
| KR20180049238A (ko) | 단백질 발현 증진 폴리펩타이드 | |
| CN115427558A (zh) | 用于高效且特异性基因组编辑的位点-特异性重组酶的融合物 | |
| JP7229169B2 (ja) | 生体高分子の精製のための超分子高アフィニティタンパク質結合系 | |
| KR102038876B1 (ko) | 목적 단백질의 수용성 발현을 증진시키기 위한 신규한 펩타이드 | |
| CN112279921B (zh) | 用于胞内递送分子的复合物 | |
| JP7062595B2 (ja) | 複合ポリペプチド単量体、細胞浸透機能を有する当該複合ポリペプチドの単量体の会合体、及び、当該会合体を有効成分とする皮下、皮内、経皮又は筋肉内投与用ノロウイルスコンポーネントワクチン | |
| WO2021156489A1 (en) | Engineered polypeptides derived from variable domain of adenovirus penton base | |
| Walker et al. | Internal core protein cleavage leaves the hepatitis B virus capsid intact and enhances its capacity for surface display of heterologous whole chain proteins | |
| WO2005077976A2 (en) | Coiled-coil domains from c4b-binding protein | |
| RU2820522C2 (ru) | Мультимеризующиеся полипептиды, происходящие от домена с укладкой типа рулет основания пентона аденовируса | |
| JP2005514957A5 (https=) | ||
| Mirecka | Generation of novel intracellular binding reagents based on the human γB-crystallin scaffold | |
| LV15007B (lv) | Kartupeļu vīrusam PVM līdzīgo daļiņu iegūšana |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 21703917 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3166852 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2022547688 Country of ref document: JP Kind code of ref document: A |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112022015461 Country of ref document: BR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202217050197 Country of ref document: IN |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2021703917 Country of ref document: EP Effective date: 20220905 |
|
| ENP | Entry into the national phase |
Ref document number: 2021216124 Country of ref document: AU Date of ref document: 20210205 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 112022015461 Country of ref document: BR Kind code of ref document: A2 Effective date: 20220804 |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: 791980 Country of ref document: NZ |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: 2021703917 Country of ref document: EP |