WO2021118323A1 - 텐덤 인슐린 유사 성장인자-1 및 이를 유효성분으로 함유하는 탈모방지 또는 발모촉진용 조성물 - Google Patents

텐덤 인슐린 유사 성장인자-1 및 이를 유효성분으로 함유하는 탈모방지 또는 발모촉진용 조성물 Download PDF

Info

Publication number
WO2021118323A1
WO2021118323A1 PCT/KR2020/018267 KR2020018267W WO2021118323A1 WO 2021118323 A1 WO2021118323 A1 WO 2021118323A1 KR 2020018267 W KR2020018267 W KR 2020018267W WO 2021118323 A1 WO2021118323 A1 WO 2021118323A1
Authority
WO
WIPO (PCT)
Prior art keywords
hair
insulin
tandem
growth factor
present
Prior art date
Application number
PCT/KR2020/018267
Other languages
English (en)
French (fr)
Inventor
이선교
이성란
유한봉
최태원
김태현
Original Assignee
(주)넥스젠바이오텍
이선교
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by (주)넥스젠바이오텍, 이선교 filed Critical (주)넥스젠바이오텍
Publication of WO2021118323A1 publication Critical patent/WO2021118323A1/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22—Hormones
    • A61K38/30—Insulin-like growth factors, i.e. somatomedins, e.g. IGF-1, IGF-2
    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23L—FOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
    • A23L33/00—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof
    • A23L33/10—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof using additives
    • A23L33/17—Amino acids, peptides or proteins
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K8/00—Cosmetics or similar toiletry preparations
    • A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
    • A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
    • A61K8/64—Proteins; Peptides; Derivatives or degradation products thereof
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00—Drugs for dermatological disorders
    • A61P17/14—Drugs for dermatological disorders for baldness or alopecia
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
    • A61Q7/00—Preparations for affecting hair growth
    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23V—INDEXING SCHEME RELATING TO FOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES AND LACTIC OR PROPIONIC ACID BACTERIA USED IN FOODSTUFFS OR FOOD PREPARATION
    • A23V2002/00—Food compositions, function of food ingredients or processes for food or foodstuffs
    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23V—INDEXING SCHEME RELATING TO FOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES AND LACTIC OR PROPIONIC ACID BACTERIA USED IN FOODSTUFFS OR FOOD PREPARATION
    • A23V2200/00—Function of food ingredients
    • A23V2200/30—Foods, ingredients or supplements having a functional effect on health
    • A23V2200/318—Foods, ingredients or supplements having a functional effect on health having an effect on skin health and hair or coat

Definitions

  • the present invention relates to a tandem insulin-like growth factor-1 and a composition for preventing hair loss or promoting hair growth containing the same as an active ingredient.
  • telogen and degenerative phases there are about 100,000 to 150,000 hairs in the human body, and each hair has a different hair cycle and repeats the anagen, catagen, and telogen phases to generate, grow, and fall out. About 15% of the total hair is in the telogen and degenerative phases, so an average of 50 to 100 hairs per day are normally shed and reproduced. This hair growth cycle repeats as a cycle of about 3 to 6 years.
  • alopecia means that the period corresponding to the anagen of the hair cycle is shortened due to various reasons, and the ratio of anagen and telogen hairs is relatively increased, so that the number of hair loss is higher than the average value.
  • the dermal papilla is the most important part in the development of hair, and there are blood vessels or nerves in the dermal papilla, and it promotes hair growth by supplying nutrients to the hair cells on it.
  • the number of these dermal papillaes is determined at birth, and as the number of dermal papillaes disappears, the number of hairs decreases.
  • telogen effluvium a general hair loss phenomenon
  • telogen effluvium a general hair loss phenomenon
  • anagen effluvium an abnormal hair loss phenomenon
  • alopecia refers to the latter.
  • Types of alopecia include alopecia areata, premature alopecia, androgen alopecia in women, syphilitic alopecia, and male pattern baldness.
  • finasteride which is a drug that inhibits the activity of 5- ⁇ reductase that produces dihydrotestosterone, a substance that directly causes hair loss.
  • finasteride preparations may cause fetal malformations in pregnant women, and side effects such as decreased libido, erectile dysfunction, and ejaculation disorders have been reported when administered for a long period of time.
  • minoxidil-containing hair growth agent which is widely used, is also approved as an over-the-counter drug by the FDA, but it cannot be administered to women and has side effects such as skin irritation, itching, and flushing. Therefore, there is a need to develop a product that is safe for both men and women and has effects of preventing hair loss and hair growth without side effects.
  • Korean Patent Application Laid-Open No. 2016-0121122 discloses a nucleotide encoding Sirt2 protein; A composition for preventing hair loss or promoting hair growth is disclosed, comprising a fusion protein of the Sirt2 protein and a protein transduction domain as an active ingredient, and Korean Patent No. 1558222 discloses a composition for preventing hair loss and improving hair growth containing cyclophilin A Although disclosed, the tandem insulin-like growth factor-1 of the present invention and a composition for preventing hair loss or promoting hair growth containing the same as an active ingredient has not been disclosed.
  • the present invention has been derived from the above needs, and the present invention provides a tandem insulin-like growth factor-1 and a composition for preventing hair loss or promoting hair growth containing the same as an active ingredient, and the tandem insulin-like growth factor of the present invention- By treatment with 1 (Tandem IGF-1), it was confirmed that the concentration-dependent increase of hair follicle dermal papilla cells, the tandem insulin-like growth factor-1 of the present invention is insulin growth factor-1 (IGF- By confirming that there is a significant hair follicle dermal papilla cell proliferation effect compared to 1), the present invention was completed.
  • IGF-1 insulin growth factor-1
  • the present invention provides a tandem insulin-like growth factor-1 protein consisting of the amino acid sequence of SEQ ID NO: 1.
  • the present invention provides a cosmetic composition for preventing hair loss or promoting hair growth comprising the tandem insulin-like growth factor-1 protein consisting of the amino acid sequence of SEQ ID NO: 1 as an active ingredient.
  • the present invention provides a skin external preparation for preventing hair loss or promoting hair growth comprising the tandem insulin-like growth factor-1 protein consisting of the amino acid sequence of SEQ ID NO: 1 as an active ingredient.
  • the present invention provides a health functional food composition for preventing hair loss or promoting hair growth comprising the tandem insulin-like growth factor-1 protein consisting of the amino acid sequence of SEQ ID NO: 1 as an active ingredient.
  • the present invention relates to a tandem insulin-like growth factor-1 and a composition for preventing hair loss or promoting hair growth containing the same as an active ingredient, and by treating the tandem insulin-like growth factor-1 (Tandem IGF-1) of the present invention, hair follicle dermal papilla It was confirmed that the cells (Hair follicle dermal papilla cells) increased in a concentration-dependent manner, and the tandem insulin-like growth factor-1 of the present invention was significantly higher than the insulin growth factor-1 (IGF-1) hair follicle dermal papilla cells (Hair follicle dermal papilla). cell) has a proliferation effect.
  • IGF-1 insulin growth factor-1
  • tandem IGF-1 tandem IGF-1
  • A is the Ni resin step result
  • B is the final separation and purification result
  • tandem IGF-1 tandem insulin-like growth factor-1
  • the present invention relates to a tandem insulin-like growth factor-1 protein comprising the amino acid sequence of SEQ ID NO: 1.
  • the tandem insulin-like growth factor-1 protein can increase the size of human dermal papilla cells.
  • the present invention relates to a cosmetic composition for preventing hair loss or promoting hair growth comprising the tandem insulin-like growth factor-1 protein consisting of the amino acid sequence of SEQ ID NO: 1 as an active ingredient.
  • the cosmetic composition of the present invention includes ingredients commonly used in cosmetic compositions in addition to the active ingredients, for example, fatty substances, organic solvents, solubilizers, thickeners and gelling agents, emollients, antioxidants, suspending agents, stabilizers, foaming agents ( foaming agents), fragrances, surfactants, water, ionic or nonionic emulsifiers, fillers, sequestering and chelating agents, preservatives, vitamins, blocking agents, wetting agents, essential oils, dyes, pigments, hydrophilic or lipophilic active agents , conventional adjuvants such as lipid vesicles, and carriers.
  • ingredients commonly used in cosmetic compositions in addition to the active ingredients for example, fatty substances, organic solvents, solubilizers, thickeners and gelling agents, emollients, antioxidants, suspending agents, stabilizers, foaming agents ( foaming agents), fragrances, surfactants, water, ionic or nonionic emulsifiers, fillers, se
  • composition of the present invention may be prepared in any formulation conventionally prepared in the art, for example, solution, suspension, emulsion, paste, gel, cream, lotion, powder, oil, powder foundation, emulsion foundation , wax foundation, spray, and the like. More specifically, the composition of the present invention is a skin, skin softener, skin toner, astringent, lotion, milk lotion, moisture lotion, nourishing lotion, massage cream, nourishing cream, eye cream, moisture cream, hand cream, essence, nutrition Essence, pack, cleansing foam, cleansing water, cleansing lotion, cleansing cream, body lotion, body cleanser, soap, powder, hair tonic, hair conditioner, hair essence, hair lotion, hair nourishing lotion, hair shampoo, hair conditioner, hair treatment ment, hair cream, hair nutrition cream, hair moisture cream, hair massage cream, hair wax, hair aerosol, hair pack, hair nutrition pack, hair soap, hair cleansing foam, hair drying agent, hair preservative, hair dye, wave agent for hair, hair It may be prepared in cosmetic formulations of bleach, hair gel, hair glaze, hair dresser, hair lac
  • the formulation of the cosmetic composition of the present invention is a paste, cream or gel, animal oil, vegetable oil, wax, paraffin, starch, tracanth, cellulose derivative, polyethylene glycol, silicone, bentonite, silica, talc or zinc oxide, etc. This can be used.
  • lactose, talc, silica, aluminum hydroxide, calcium silicate or polyamide powder may be used as a carrier component, and in particular, in the case of a spray, additional chlorofluorohydro It may contain a propellant such as carbon, propane/butane or dimethyl ether.
  • a solvent, solubilizer or emulsifier is used as a carrier component, for example, water, ethanol, isopropanol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene fatty acid esters of glycol, 1,3-butylglycol oil, glycerol fatty esters, polyethylene glycol or sorbitan.
  • the formulation of the cosmetic composition of the present invention is a suspension
  • a liquid diluent such as water, ethanol or propylene glycol, ethoxylated isostearyl alcohol, a suspending agent such as polyoxyethylene sorbitol ester and polyoxyethylene sorbitan ester , microcrystalline cellulose, aluminum metahydroxide, bentonite, agar, or tracanth
  • a suspending agent such as polyoxyethylene sorbitol ester and polyoxyethylene sorbitan ester
  • microcrystalline cellulose such as aluminum metahydroxide, bentonite, agar, or tracanth
  • the present invention relates to a skin external preparation for preventing hair loss or promoting hair growth comprising the tandem insulin-like growth factor-1 protein consisting of the amino acid sequence of SEQ ID NO: 1 as an active ingredient.
  • the formulation of the external preparation for skin of the present invention can be used by methods such as direct application or dispersion on hair or scalp.
  • the hair to which the external preparation for skin of the present invention is applied includes hair roots and hair follicles of the head, hair and eyelashes, eyebrows, beard, armpits, pubic hair, and all parts of the body having hair roots and hair follicles. Therefore, the present invention is a hair tonic, hair lotion, hair cream, hair spray, hair mousse, hair gel, hair conditioner, hair shampoo, hair conditioner, hair pack, hair treatment, eyebrow hair growth agent, eyelash hair growth agent or eyelash nutrient agent, or for pets It can be used as a shampoo and conditioner for pets.
  • the dose of the external preparation for skin according to the present invention may be appropriately determined in consideration of gender, age, hair loss symptoms, hair condition, and the like.
  • the external preparation for skin having a function of promoting hair growth and preventing hair loss according to the present invention may be added as a raw material for cosmetics and pharmaceuticals.
  • the present invention relates to a health functional food composition for preventing hair loss or promoting hair growth comprising the tandem insulin-like growth factor-1 protein consisting of the amino acid sequence of SEQ ID NO: 1 as an active ingredient.
  • composition is preferably prepared in any one formulation selected from powder, granule, pill, tablet, capsule, candy, syrup and beverage, but is not limited thereto.
  • the health functional food composition of the present invention may be prepared by adding the tandem insulin-like growth factor-1 protein as it is or by mixing it with other foods or food ingredients, and may be appropriately prepared according to a conventional method.
  • foods to which the tandem insulin-like growth factor-1 protein can be added include dairy products including caramel, meat, sausage, bread, chocolate, candy, snacks, confectionery, pizza, ramen, other noodles, gum, and ice cream; It may be in any one form selected from various soups, beverages, teas, drinks, alcoholic beverages and vitamin complexes, and includes all health functional foods in a conventional sense. That is, there is no particular limitation on the type of the food.
  • the health functional food composition includes various nutrients, vitamins, minerals (electrolytes), synthetic and natural flavorants, colorants and enhancers (cheese, chocolate, etc.), pectic acid and its salts, alginic acid and its salts, organic acids, protective colloidal thickeners , a pH adjuster, a stabilizer, a preservative, glycerin, alcohol, a carbonation agent used in carbonated beverages, and the like. It may also contain pulp for the production of natural fruit juices and vegetable beverages.
  • the above components may be used independently or in combination.
  • the health functional food composition of the present invention may contain various flavoring agents or natural carbohydrates as additional ingredients, and the natural carbohydrates include monosaccharides such as glucose and fructose, disaccharides such as maltose and sucrose, dextrin, and cyclo polysaccharides such as dextrin, and sugar alcohols such as xylitol, sorbitol, and erythritol.
  • the proportion of the natural carbohydrate is not very important, but with respect to 100 g of the composition of the present invention, it is preferably 0.01 to 0.04 g, more preferably 0.02 to 0.03 g, but is not limited thereto.
  • natural sweeteners such as tau martin and stevia extract, or synthetic sweeteners such as saccharin and aspartame may be used.
  • tandem IGF-1 tandem insulin-like growth factor-1
  • IGF-1 insulin-like growth factor-1
  • the tandem insulin-like growth factor-1 of the present invention has two consecutive sequences of insulin-like growth factor-1, and consists of the following amino acid sequence.
  • Tandem insulin-like growth factor-1 protein sequence
  • the tandem insulin-like growth factor-1 protein and the insulin-like growth factor-1 protein-treated group increased hair follicle tissue cells in a concentration-dependent manner compared to the untreated group.
  • tandem insulin-like growth factor-1 Since the molecular weight of tandem insulin-like growth factor-1 is twice that of insulin-like growth factor-1, when the tandem insulin-like growth factor-1 and insulin-like growth factor-1 of the present invention are treated at the same ppm concentration, IGF-1 The number of moles of Tendem IGF-1 compared to the number of moles is halved. Therefore, it can be seen that there is a similar or increased proliferative effect of dermal papilla cells in the hair follicles even when tendem IGF-1 is treated with half the number of moles. Therefore, the tandem insulin-like growth factor-1 of the present invention has a significant dermal papilla hair follicle compared to insulin-like growth factor-1. It can be seen that there is a cell proliferation effect.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Health & Medical Sciences (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Epidemiology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Medicinal Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Dermatology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Food Science & Technology (AREA)
  • Organic Chemistry (AREA)
  • Nutrition Science (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Mycology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Polymers & Plastics (AREA)
  • Birds (AREA)
  • Diabetes (AREA)
  • Molecular Biology (AREA)
  • Endocrinology (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Immunology (AREA)
  • Cosmetics (AREA)

Abstract

본 발명은 텐덤 인슐린 유사 성장인자-1 및 이를 유효성분으로 함유하는 탈모방지 또는 발모촉진용 조성물에 관한 것으로, 본 발명의 텐덤 인슐린 유사 성장인자-1(Tandem IGF-1)을 처리하여, 모낭 모유두 세포(Hair follicle dermal papilla cell)가 농도 의존적으로 증가한다는 것을 확인하였으며, 본 발명의 텐덤 인슐린 유사 성장인자-1는 인슐린 성장인자-1(IGF-1)에 비해 현저한 모낭 모유두 세포(Hair follicle dermal papilla cell) 증식 효과가 있어, 본 발명의 조성물은 탈모방지 또는 발모촉진용 화장품, 피부외용제 또는 건강기능식품에 유용하게 사용될 수 있다.

Description

텐덤 인슐린 유사 성장인자-1 및 이를 유효성분으로 함유하는 탈모방지 또는 발모촉진용 조성물
본 발명은 텐덤 인슐린 유사 성장인자-1 및 이를 유효성분으로 함유하는 탈모방지 또는 발모촉진용 조성물에 관한 것이다.
인체의 모발은 약 10만~15만 개 정도이며, 각각의 모발은 서로 다른 모주기를 가지고 성장기(anagen), 퇴행기(catagen) 및 휴지기(telogen)를 반복하며 생성, 성장 및 탈락하는데, 그 결과 전체 모발의 약 15％에 해당하는 모발이 휴지기와 퇴행기에 놓여 있어 일일 평균 50∼100개의 모발이 정상적으로 탈락하고 재생산된다. 이러한 모발의 생장주기는 약 3∼6년을 사이클로 반복한다. 일반적으로, 탈모증이라 함은 모발주기의 성장기(anagen)에 해당하는 기간이 여러 원인으로 인해 짧아져 퇴행기와 휴지기 모발의 비율이 상대적으로 많아져 모발이 탈락하는 수가 평균치보다 많아지는 것을 말하며, 원인으로는 유전적 안드로겐 호르몬의 작용, 국소혈류 장애에 의한 영양 장애, 자율신경계 장애, 자가면역질환, 내분비 장애가 있으나 현재까지 탈모에 관한 명확한 원인은 밝혀지지 않은 상태이며, 전술한 원인이 복합적으로 작용하여 발생하는 것으로 알려져 있다. 따라서 탈모의 치료를 위해서는 휴지기 상태의 모낭을 성장기로 빨리 갈 수 있도록 하고, 짧아진 성장기를 늘려주는 것이 중요하다.
모발이 자라는 모근의 뿌리부분은 모구(hair bulb)라고 하고, 그 아랫부분의 움푹 들어간 부분을 모유두라고 한다. 모유두는 모발의 발생에 있어 가장 중요한 부분으로, 모유두에는 혈관이나 신경이 있고, 바로 그 위에 있는 모모세포에 영양분을 공급하여 모발의 성장을 촉진하게 된다. 이러한 모유두의 수는 태어날 때 결정되는데, 모유두가 없어지고 그 수가 감소할수록 모발의 수도 감소하게 된다.
최근 식생활의 변화, 생활습관의 변화, 사회 환경에 의한 과한 스트레스의 증가 등으로 비정상적인 탈모를 유발하고 있는 인구가 점차 증가하는 추세이며, 특히 청년 및 장년과 여성 탈모 인구가 증가하고 있는 상황으로, 머리카락이나 털이 어떤 원인에 의하여 정상보다 적거나 없는 상태를 의미하는 탈모는 모발이 휴지기 상태에서 빠지는 일반적인 탈모 현상(휴지기 탈모, telogen effluvium)과 비정상적인 탈모 현상인 성장기 탈모 현상(anagen effluvium)으로 구별할 수 있는 데, 일반적으로 탈모증이라 함은 후자를 일컫는다. 탈모증의 형태에는 원형 탈모증(alopecia areata), 조기 탈모증, 여성 탈모증(androgen alopecia in women), 매독성 탈모증, 장년성 탈모증(male pattern baldness) 등이 있다.
탈모를 위해 개발된 가장 대표적인 탈모방지제로서 피나스테라이드(finasteride)를 들 수 있는데, 이는 직접적인 탈모 원인 물질인 디하이드로테스토스테론을 생성하는 5-α환원효소의 활성을 저해하는 약물이다. 그러나 피나스테라이드 제제의 경우는 임산부에게는 태아의 기형을 유발할 수 있으며, 장기간 투여시 성욕감퇴, 발기부전, 사정장애 등의 부작용이 보고되어 있어 복용에 주의해야 하는 단점이 있다. 이 외에 널리 사용되고 있는 미녹시딜(minoxidil) 함유 발모제 또한 FDA에서 일반의약품으로 승인을 받은 제제이지만, 여성에게는 투여할 수 없고 피부자극, 가려움, 홍조 등의 부작용이 있다. 따라서, 남녀 모두에게 안전하고 부작용이 없으면서 탈모방지 및 발모 효과가 있는 제품을 개발할 필요성이 있다.
한편, 한국공개특허 제2016-0121122호에는 Sirt2 단백질을 코딩하는 뉴클레오티드; 상기 Sirt2 단백질과 단백질 전달 도메인의 융합 단백질을 유효성분으로 포함하는, 탈모방지 또는 발모촉진용 조성물이 개시되어 있고, 한국등록특허 제1558222호에는 사이클로필린 A를 포함하는 탈모방지 및 발모개선을 위한 조성물이 개시되어 있지만, 본 발명의 텐덤 인슐린 유사 성장인자-1 및 이를 유효성분으로 함유하는 탈모방지 또는 발모촉진용 조성물에 대해 개시된 바 없다.
본 발명은 상기와 같은 요구에 의해 도출된 것으로서, 본 발명은 텐덤 인슐린 유사 성장인자-1 및 이를 유효성분으로 함유하는 탈모방지 또는 발모촉진용 조성물을 제공하고, 본 발명의 텐덤 인슐린 유사 성장인자-1(Tandem IGF-1)을 처리하여, 모낭 모유두 세포(Hair follicle dermal papilla cell)가 농도 의존적으로 증가한다는 것을 확인하였으며, 본 발명의 텐덤 인슐린 유사 성장인자-1는 인슐린 성장인자-1(IGF-1)에 비해 현저한 모낭 모유두 세포(Hair follicle dermal papilla cell) 증식 효과가 있다는 것을 확인함으로써, 본 발명을 완성하였다.
상기 목적을 달성하기 위하여, 본 발명은 서열번호 1의 아미노산 서열로 이루어진 텐덤 인슐린 유사 성장인자-1 단백질을 제공한다.
또한, 본 발명은 서열번호 1의 아미노산 서열로 이루어진 텐덤 인슐린 유사 성장인자-1 단백질을 유효성분으로 포함하는 탈모방지 또는 발모촉진용 화장료 조성물을 제공한다.
또한, 본 발명은 서열번호 1의 아미노산 서열로 이루어진 텐덤 인슐린 유사 성장인자-1 단백질을 유효성분으로 포함하는 탈모방지 또는 발모촉진용 피부 외용제를 제공한다.
또한, 본 발명은 서열번호 1의 아미노산 서열로 이루어진 텐덤 인슐린 유사 성장인자-1 단백질을 유효성분으로 포함하는 탈모방지 또는 발모촉진용 건강기능식품 조성물을 제공한다.
본 발명은 텐덤 인슐린 유사 성장인자-1 및 이를 유효성분으로 함유하는 탈모방지 또는 발모촉진용 조성물에 관한 것으로, 본 발명의 텐덤 인슐린 유사 성장인자-1(Tandem IGF-1)을 처리하여, 모낭 모유두 세포(Hair follicle dermal papilla cell)가 농도 의존적으로 증가한다는 것을 확인하였으며, 본 발명의 텐덤 인슐린 유사 성장인자-1는 인슐린 성장인자-1(IGF-1)에 비해 현저한 모낭 모유두 세포(Hair follicle dermal papilla cell) 증식 효과가 있다.
도 1은 본 발명의 텐덤 인슐린 유사 성장인자-1(tandem IGF-1) 단백질을 분리 정제한 SDS-PAGE 결과로, A는 Ni 레진 단계별 결과이고, B는 최종 분리정제한 결과이다.
도 2는 본 발명의 텐덤 인슐린 유사 성장인자-1(tandem IGF-1) 단백질을 모낭 모유두 세포에 처리한 후 크리스탈 바이올렛 염색을 통해 세포 증식을 확인한 결과이다.
본 발명은 서열번호 1의 아미노산 서열로 이루어진 텐덤 인슐린 유사 성장인자-1 단백질에 관한 것이다. 상기 텐덤 인슐린 유사 성장인자-1 단백질은 인간 모유두세포의 크기를 증가시킬수 있다.
또한 본 발명은 서열번호 1의 아미노산 서열로 이루어진 텐덤 인슐린 유사 성장인자-1 단백질을 유효성분으로 포함하는 탈모방지 또는 발모촉진용 화장료 조성물에 관한 것이다.
본 발명의 화장료 조성물에는 상기 유효성분 이외에 화장품 조성물에 통상적으로 이용되는 성분들을 포함하며, 예컨대 지방 물질, 유기 용매, 용해제, 농축제 및 겔화제, 연화제, 항산화제, 현탁화제, 안정화제, 발포제(foaming agent), 방향제, 계면활성제, 물, 이온형 또는 비이온형 유화제, 충전제, 금속이온 봉쇄제 및 킬레이트화제, 보존제, 비타민, 차단제, 습윤화제, 필수 오일, 염료, 안료, 친수성 또는 친유성 활성제, 지질 소낭과 같은 통상적인 보조제, 그리고 담체를 포함한다.
본 발명의 조성물은 당업계에서 통상적으로 제조되는 어떠한 제형으로도 제조될 수 있으며, 예를 들어, 용액, 현탁액, 유탁액, 페이스트, 겔, 크림, 로션, 파우더, 오일, 분말 파운데이션, 유탁액 파운데이션, 왁스 파운데이션 및 스프레이 등으로 제형화될 수 있다. 보다 상세하게는, 본 발명의 조성물은 스킨, 스킨 소프트너, 스킨토너, 아스트린젠트, 로션, 밀크로션, 모이스쳐로션, 영양로션, 마사지크림, 영양크림, 아이 크림, 모이스쳐 크림, 핸드크림, 에센스, 영양에센스, 팩, 클렌징폼, 클렌징 워터, 클렌징 로션, 클렌징 크림, 바디로션, 바디클렌져, 비누, 파우더, 헤어토닉, 헤어컨디셔너, 헤어에센스, 헤어로션, 헤어영양로션, 헤어샴푸, 헤어린스, 헤어트리트먼트, 헤어크림, 헤어영양크림, 헤어모이스처크림, 헤어맛사지크림, 헤어왁스, 헤어에어로졸, 헤어팩, 헤어영양팩, 헤어비누, 헤어클렌징폼, 모발건조제, 모발보존처리제, 모발염색제, 모발용 웨이브제, 모발탈색제, 헤어겔, 헤어글레이즈, 헤어드레싱어, 헤어래커, 헤어모이스처라이저, 헤어무스 또는 헤어스프레이의 화장품 제형으로 제조될 수 있으나, 이에 제한되지 않는다.
본 발명의 화장료 조성물의 제형이 페이스트, 크림 또는 겔인 경우에는 담체 성분으로서 동물성유, 식물성유, 왁스, 파라핀, 전분, 트라칸트, 셀룰로오스 유도체, 폴리에틸렌 글리콜, 실리콘, 벤토나이트, 실리카, 탈크 또는 산화아연 등이 이용될 수 있다.
본 발명의 화장료 조성물의 제형이 파우더 또는 스프레이인 경우에는 담체 성분으로서 락토스, 탈크, 실리카, 알루미늄 히드록시드, 칼슘 실리케이트 또는 폴리아미드 파우더가 이용될 수 있고, 특히 스프레이인 경우에는 추가적으로 클로로플루오로 히드로카본, 프로판/부탄 또는 디메틸 에테르와 같은 추진체를 포함할 수 있다. 본 발명의 화장료 조성물의 제형이 용액 또는 유탁액인 경우에는 담체 성분으로서 용매, 용해화제 또는 유탁화제가 이용되고, 예컨대 물, 에탄올, 이소프로판올, 에틸 카보네이트, 에틸 아세테이트, 벤질 알코올, 벤질 벤조에이트, 프로필렌글리콜, 1,3-부틸글리콜 오일, 글리세롤 지방족 에스테르, 폴리에틸렌 글리콜 또는 소르비탄의 지방산 에스테르가 있다.
본 발명의 화장료 조성물의 제형이 현탁액인 경우에는 담체 성분으로서 물, 에탄올 또는 프로필렌글리콜과 같은 액상의 희석제, 에톡실화 이소스테아릴 알코올, 폴리옥시에틸렌 소르비톨 에스테르 및 폴리옥시에틸렌 소르비탄 에스테르와 같은 현탁제, 미소결정성 셀룰로오스, 알루미늄 메타히드록시드, 벤토나이트, 아가 또는 트라칸트 등이 이용될 수 있다.
또한, 본 발명은 서열번호 1의 아미노산 서열로 이루어진 텐덤 인슐린 유사 성장인자-1 단백질을 유효성분으로 포함하는 탈모방지 또는 발모촉진용 피부 외용제에 관한 것이다.
본 발명의 피부 외용제의 제형으로 모발 또는 두피에 직접 도포 또는 산포하는 등의 방법에 의해 사용될 수 있다. 본 발명의 피부 외용제가 적용되는 모발이란, 머리의 모근 및 모낭, 머리카락 및 속눈썹과 겉눈썹, 수염, 겨드랑이, 음모, 신체 전반에 모근 및 모낭이 있는 모든 부위를 포함한다. 따라서 본 발명은 헤어토닉, 헤어로션, 헤어크림, 헤어스프레이, 헤어무스, 헤어젤, 헤어컨디셔너, 헤어샴푸, 헤어린스, 헤어팩, 헤어트리트먼트, 눈썹발모제, 속눈썹발모제 또는 속눈썹영양제, 또는 애완동물용 샴푸 및 애완동물용 린스로 사용될 수 있다. 본 발명에 따른 피부 외용제의 용량은 성별, 연령, 탈모증세, 모발상태 등을 고려하여 적절히 결정될 수 있다. 본 발명에 따른 발모촉진 및 탈모방지 기능이 있는 피부 외용제는 화장품과 의약품의 원료로 첨가될 수 있다.
또한, 본 발명은 서열번호 1의 아미노산 서열로 이루어진 텐덤 인슐린 유사 성장인자-1 단백질을 유효성분으로 포함하는 탈모방지 또는 발모촉진용 건강기능식품 조성물에 관한 것이다.
상기 조성물은 분말, 과립, 환, 정제, 캡슐, 캔디, 시럽 및 음료 중에서 선택된 어느 하나의 제형으로 제조되는 것이 바람직하지만, 이에 한정하지 않는다.
본 발명의 건강기능식품 조성물은 텐덤 인슐린 유사 성장인자-1 단백질을 그대로 첨가하거나 다른 식품 또는 식품 성분과 함께 혼합하여 제조될 수 있고, 통상적인 방법에 따라 적절하게 제조될 수 있다. 상기 텐덤 인슐린 유사 성장인자-1 단백질을 첨가할 수 있는 식품의 예로는 카라멜, 육류, 소시지, 빵, 초콜릿, 캔디류, 스낵류, 과자류, 피자, 라면, 기타 면류, 껌류, 아이스크림류를 포함한 낙농제품, 각종 수프, 음료수, 차, 드링크제, 알코올 음료 및 비타민 복합제 중에서 선택된 어느 하나의 형태일 수 있으며, 통상적인 의미에서의 건강기능식품을 모두 포함한다. 즉, 상기 식품의 종류에는 특별한 제한은 없다. 상기 건강기능식품 조성물은 여러 가지 영양제, 비타민, 광물(전해질), 합성 및 천연 풍미제, 착색제 및 증진제(치즈, 초콜릿 등), 펙트산 및 그의 염, 알긴산 및 그의 염, 유기산, 보호성 콜로이드 증점제, pH 조절제, 안정화제, 방부제, 글리세린, 알코올, 탄산음료에 사용되는 탄산화제 등을 함유할 수 있다. 또한, 천연 과일 주스 및 야채 음료의 제조를 위한 과육을 함유할 수 있다. 상기의 성분은 독립적으로 또는 조합하여 사용할 수 있다. 또한, 본 발명의 건강기능식품 조성물은 여러 가지 향미제 또는 천연 탄수화물 등을 추가 성분으로서 함유할 수 있으며, 상기 천연 탄수화물은 포도당, 과당과 같은 단당류, 말토스, 슈크로스와 같은 이당류, 덱스트린, 사이클로 덱스트린과 같은 다당류, 자일리톨, 소르비톨, 에리트리톨 등의 당 알코올이다. 상기 천연 탄수화물의 비율은 크게 중요하지 않지만, 본 발명의 조성물 100g에 대하여, 0.01~0.04g인 것이 바람직하고, 더욱 바람직하게는 0.02~0.03g을 포함하는 것이지만 이에 한정하지 않는다. 감미제로는 타우마틴, 스테비아 추출물과 같은 천연 감미제나, 사카린, 아스파르탐과 같은 합성 감미제 등을 사용할 수 있다.
이하, 실시예를 이용하여 본 발명을 더욱 상세하게 설명하고자 한다. 이들 실시예는 오로지 본 발명을 보다 구체적으로 설명하기 위한 것으로 본 발명의 범위가 이들에 의해 제한되지 않는다는 것은 당해 기술분야에서 통상의 지식을 가진 자에게 있어 자명한 것이다.
제조예 1. 텐덤 인슐린 유사 성장인자의 제조
플라스미드에 텐덤 인슐린 유사 성장인자-1(tandem IGF-1) 유전자를 삽입한 후, 대장균에서 대량 생산 및 분리하였다. 대조군으로는 플라스미드에 인슐린 유사 성장인자-1(IGF-1) 유전자를 삽입한 후, 대장균에서 대량 생산 및 분리정제하였다(도 1).
본 발명의 텐덤 인슐린 유사 성장인자-1은 인슐린 유사 성장인자-1이 2개 연속된 서열이며, 하기 아미노산 서열로 이루어진 것이다.
텐덤 인슐린 유사 성장인자-1 단백질 서열:
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA-GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA(서열번호 1)
실시예 1. 모낭 모유두 세포 증식 효과 확인
상기 제조예 1에서 대량 생산 및 분리된 텐덤 인슐린 유사 성장인자-1의 모낭 모유두 세포의 증식 효과를 확인하기 위해, 배양한 모낭 모유두 세포(Hair follicle dermal papilla cell)에 0.01, 0.1, 1 또는 10ppm(㎍/㎖)의 농도로 텐덤 인슐린 유사 성장인자-1(Tandon IGF-1, 실험예) 및 인슐린 유사 성장인자-1(IGF-1, 비교예)을 각각 처리한 후, 3일 동안 37℃에서 배양하였다. 이후 크리스탈 바이올렛 염색법으로 세포 증식 여부를 확인하였다(도 2).
그 결과, 도 2에 개시한 바와 같이, 텐덤 인슐린 유사 성장인자-1 단백질 및 인슐린 유사 성장인자-1 단백질 처리군은 무처리군에 비해 모낭 조직 세포가 농도 의존적으로 증가하였다.
10ppm의 텐덤 인슐린 유사 성장인자-1 단백질을 처리한 경우, 10ppm의 인슐린 유사 성장인자-1 단백질 처리군 대비 세포 증식 정도가 더 큰 것으로 나타났다.
텐덤 인슐린 유사 성장인자-1의 분자량은 인슐린 유사 성장인자-1의 두배이므로, 본 발명의 텐덤 인슐린 유사 성장인자-1과 인슐린 유사 성장인자-1을 동일한 ppm 농도로 처리하는 경우, IGF-1의 몰수 대비 텐뎀 IGF-1의 몰수는 절반이 된다. 따라서, 절반의 몰수로 텐뎀 IGF-1를 처리하더라도 유사하거나 증가한 모낭 모유두 세포의 증식 효과가 있다는 것을 알 수 있으므로, 본 발명의 텐덤 인슐린 유사 성장인자-1은 인슐린 유사 성장인자-1 대비 현저한 모낭 모유두 세포의 증식 효과가 있다는 것을 알 수 있다.

Claims (5)

  1. 서열번호 1의 아미노산 서열로 이루어진 텐덤 인슐린 유사 성장인자-1 단백질.
  2. 제1항에 있어서, 상기 텐덤 인슐린 유사 성장인자-1 단백질은 인간 모유두세포의 크기를 증가시키는 것을 특징으로 하는 텐덤 인슐린 유사 성장인자-1 단백질.
  3. 서열번호 1의 아미노산 서열로 이루어진 텐덤 인슐린 유사 성장인자-1 단백질을 유효성분으로 포함하는 탈모방지 또는 발모촉진용 화장료 조성물.
  4. 서열번호 1의 아미노산 서열로 이루어진 텐덤 인슐린 유사 성장인자-1 단백질을 유효성분으로 포함하는 탈모방지 또는 발모촉진용 피부 외용제.
  5. 서열번호 1의 아미노산 서열로 이루어진 텐덤 인슐린 유사 성장인자-1 단백질을 유효성분으로 포함하는 탈모방지 또는 발모촉진용 건강기능식품 조성물.
PCT/KR2020/018267 2019-12-13 2020-12-14 텐덤 인슐린 유사 성장인자-1 및 이를 유효성분으로 함유하는 탈모방지 또는 발모촉진용 조성물 WO2021118323A1 (ko)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR10-2019-0166242 2019-12-13
KR20190166242 2019-12-13

Publications (1)

Publication Number Publication Date
WO2021118323A1 true WO2021118323A1 (ko) 2021-06-17

Family

ID=76330232

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2020/018267 WO2021118323A1 (ko) 2019-12-13 2020-12-14 텐덤 인슐린 유사 성장인자-1 및 이를 유효성분으로 함유하는 탈모방지 또는 발모촉진용 조성물

Country Status (2)

Country Link
KR (1) KR20210075897A (ko)
WO (1) WO2021118323A1 (ko)

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20040076780A (ko) * 2003-02-26 2004-09-03 (주)케어젠 재조합 인슐린 유사 성장인자를 함유하는 화장료 조성물
KR20070091568A (ko) * 2006-03-06 2007-09-11 (주)케어젠 인슐린 유사 성장인자―１의 활성을 가지는 펩타이드 및그의 용도
US20090038022A1 (en) * 2004-11-29 2009-02-05 Nadia Rosenthal IGF-1 Novel peptides
KR20100035240A (ko) * 2008-09-26 2010-04-05 (주)케어젠 성장인자―관련 펩타이드 및 그의 용도
KR20190073147A (ko) * 2017-12-18 2019-06-26 주식회사 엘지생활건강 인슐린유사 성장인자-1의 융합 단백질을 포함하는 피부개선용 화장료 조성물

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20040076780A (ko) * 2003-02-26 2004-09-03 (주)케어젠 재조합 인슐린 유사 성장인자를 함유하는 화장료 조성물
US20090038022A1 (en) * 2004-11-29 2009-02-05 Nadia Rosenthal IGF-1 Novel peptides
KR20070091568A (ko) * 2006-03-06 2007-09-11 (주)케어젠 인슐린 유사 성장인자―１의 활성을 가지는 펩타이드 및그의 용도
KR20100035240A (ko) * 2008-09-26 2010-04-05 (주)케어젠 성장인자―관련 펩타이드 및 그의 용도
KR20190073147A (ko) * 2017-12-18 2019-06-26 주식회사 엘지생활건강 인슐린유사 성장인자-1의 융합 단백질을 포함하는 피부개선용 화장료 조성물

Also Published As

Publication number Publication date
KR20210075897A (ko) 2021-06-23

Similar Documents

Publication Publication Date Title
KR20060128964A (ko) 마카 추출물의 제조 방법
CN107530258B (zh) 用于促进毛发生长或毛发修复和用于抗炎的组合物
KR20140115400A (ko) 붉나무 추출물을 유효성분으로 포함하는 탈모방지 및 발모촉진용 두피케어조성물
EP3812393A1 (en) Composition for preventing hair loss or promoting hair growth
KR20190125775A (ko) 식물 유래 오일을 유효성분으로 함유하는 모발 성장촉진 또는 탈모방지용 조성물
RU2711298C2 (ru) Композиция для предотвращения или лечения выпадения волос, содержащая белок хемокинового лиганда 1, содержащего с-х-с мотив (cxcli)
KR102075842B1 (ko) 한약재 em 발효액을 유효성분으로 함유하는 탈모방지 또는 발모촉진용 조성물
WO2021118323A1 (ko) 텐덤 인슐린 유사 성장인자-1 및 이를 유효성분으로 함유하는 탈모방지 또는 발모촉진용 조성물
WO2018190695A1 (ko) 나한과 잔사 추출물을 유효성분으로 함유하는 피부주름의 예방 또는 개선용 조성물
KR102386120B1 (ko) 밀크씨슬 꽃 추출물을 유효성분으로 포함하는 탈모 방지 또는 발모 촉진용 조성물
KR20210131598A (ko) 동백나무 과피 추출물을 유효성분으로 포함하는 탈모 방지 또는 발모 촉진용 조성물
KR102231474B1 (ko) 위타페린 a를 유효성분으로 포함하는 여드름의 예방, 개선 또는 치료용 조성물
KR20220096277A (ko) 생열귀나무 추출물을 유효성분으로 포함하는 탈모 예방 또는 치료용, 또는 발모 또는 육모 촉진용 조성물
RU2709195C1 (ru) Фармацевтическая композиция для предотвращения или лечения выпадения волос, содержащая белок-хемокинового лиганда 1, содержащего с-х-с мотив (схсl1), и миноксидил в качестве активных ингредиентов
JP2004149729A (ja) 抗酸化剤
CN107530253B (zh) 含有补骨脂定的用于促进生发及/或育发的组合物
KR102435396B1 (ko) 이소프로스타노이드를 포함하는 탈모 방지 및 발모 촉진용 조성물
RU2794988C1 (ru) Композиция для предупреждения выпадения волос или стимуляции роста волос
KR102360927B1 (ko) 런시나트사이드를 포함하는 탈모 방지 및 발모 촉진용 조성물
KR20190124853A (ko) 유자씨 오일 및 콜라겐 활성 펩티드를 유효성분으로 함유하는 탈모방지 또는 발모촉진용 조성물
KR102343372B1 (ko) 탈모 예방 또는 치료용 약학 조성물
KR102600558B1 (ko) 아트라릭산을 포함하는 발모 촉진 및 탈모 방지용 조성물
KR102276483B1 (ko) 식물 복합 추출물을 유효성분으로 포함하는 탈모 예방 또는 치료용, 또는 발모 또는 육모 촉진용 조성물
KR101933835B1 (ko) 플럼바긴 및 생강 추출물을 포함하는 피부 미백용 조성물
KR102268761B1 (ko) 론코카르푸스 에리오칼릭스 추출물을 이용한 발모 촉진 또는 탈모 억제용 조성물

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 20898900

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 20898900

Country of ref document: EP

Kind code of ref document: A1

32PN Ep: public notification in the ep bulletin as address of the adressee cannot be established

Free format text: NOTING OF LOSS OF RIGHTS PURSUANT TO RULE 112(1) EPC (EPO FORM 1205A DATED 08.12.2022)

122 Ep: pct application non-entry in european phase

Ref document number: 20898900

Country of ref document: EP

Kind code of ref document: A1