WO2021069709A1 - Anti-chemokin like receptor 1 humanized antibodies and their therapeutic applications - Google Patents
Anti-chemokin like receptor 1 humanized antibodies and their therapeutic applications Download PDFInfo
- Publication number
- WO2021069709A1 WO2021069709A1 PCT/EP2020/078488 EP2020078488W WO2021069709A1 WO 2021069709 A1 WO2021069709 A1 WO 2021069709A1 EP 2020078488 W EP2020078488 W EP 2020078488W WO 2021069709 A1 WO2021069709 A1 WO 2021069709A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- antibody
- cmklr1
- antigen
- binding fragment
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2866—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39558—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/24—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
- C07K16/241—Tumor Necrosis Factors
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2818—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2839—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the integrin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2878—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
- A61K2039/507—Comprising a combination of two or more separate antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/75—Agonist effect on antigen
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
Definitions
- the invention pertains to the field of immunotherapy.
- the present invention provides new humanized anti-chemerin receptor antibodies which have a Resolvin E1 -like agonist activity on chemokine like receptor-1 (CMKLR1).
- CNKLR1 chemokine like receptor-1
- the present invention also provides uses of such antibody in therapy, in particular for treating autoimmune diseases and chronic inflammatory diseases, infectious diseases, cancers, and any condition wherein the resolution phase of inflammation is disrupted or delayed.
- the resolution process which allows the ending of the inflammatory response is a complex process involving the sequential and chronological engagement of cellular (e.g. granulocytes or macrophages) and chemical (e.g. cytokines or specialized pro-solving mediators or factors) effectors.
- cellular e.g. granulocytes or macrophages
- chemical e.g. cytokines or specialized pro-solving mediators or factors
- Chemokine-like receptor 1 also known as ChemR23, and chemokine receptor like 2 (CCRL2) are 7-transmembrane receptors identified by their homology to known G- protein-coupled receptors (AJ Kennedy and AP Davenport, 2018).
- the Chemokine-like Receptor 1 (CMKLR1 ; also named Dez in Murine animals), is an orphan G protein-coupled receptor related to GPR-1 (38% overall amino acid identity), C3a receptor (38%), C5a anaphylatoxin receptor (36%) and formyl Met-Leu-Phe receptors (35%).
- ChemR23 is more distantly related to the chemokine receptors subfamily (Samson et al. , 1998).
- CMKLR1 is expressed on monocytes, on macrophages, on dendritic cells, and on NK cells, as well as on adipocytes and endothelial cells. Recent studies identified ligands for these receptors and their functions have begun to be unveiled. Accordingly, a first plasma protein-derived chemoattractant named chemerin has been identified as a ligand for CMKLR1.
- the second ligand of CMKLR1 is the lipid mediator Resolvin E1 (RvE1) that belongs to the Resolvin family.
- RvE1 lipid mediator Resolvin E1
- the anti-inflammatory lipid mediator Resolvin E1 inhibits leukocyte infiltration and pro-inflammatory gene expression.
- the interest in the chemerin system i.e. the signaling pathway(s) activated or not by Chemerin receptors by their ligands like Chemerin and Resolvin
- the chemerin system is of major interest for its role in the inflammation process, in particular for its role in the resolution of the inflammation. A number of diseases are related to delay or disruption of the resolution process.
- pro-resolving factor mediators are derived from polyunsaturated fatty acids, including lipoxins, the resolving family, including E-series resolvins and D-series resolvins, protectins, and maresins. Nonetheless, pro-resolving molecules are difficult to synthesize because of their lipidic nature. Production of pro-resolving molecules in sufficient quantities, for a clinical trial for example, is a burden, and very few SPM have gone through efficient production. Besides that, antibodies specifically targeting G-protein-coupled receptors are difficult to produce. There is therefore a need for molecules having the capability to take part, in particular to initiate or enhance the resolution stage of the inflammatory response like pro-resolving factors.
- the invention relates to a humanized anti-CMKLR1 antibody or antigen binding fragment thereof or antigen-binding antibody mimetic or modified antibody.
- the inventors have sought to obtain improved humanized antibodies when compared to wild type anti-CMKLR1 antibody known in the prior art. While it is known that some residues in the variable domain CDR and framework (FR) sequences, including residues in the Vernier zone, canonical residues, residues at the variable heavy and variable light chains interface, etc, are critical in the structure of an antibody and should not be mutated in order to preserve the biochemical and biological activity of an antibody, the inventors have surprisingly discovered that some mutations within the heavy chain variable domain and/or the light chain variable domain sequence of wild type antibody, including some of such critical residues, allow increasing human residue content (up to 99% of humanization) while functional features are associated with these humanized antibodies, which are not shared by wild type anti-CMKLR1 in particular which are improved, and at the same time that production of these humanized antibodies may be improved as compared to less or distinctly humanized anti-CMKLR1 antibodies.
- FR variable domain CDR and framework
- the humanized heavy chain variable domain and light chain variable domain derived from non-humanized antibody allow a production of functional antibodies in different cell lines, like but no limited to Chinese Hamster Ovary (CHO) cell line, transformed African Green Monkey Kidney Fibroblast Cells (COS-7) cell line and Human Embryonic Kidney cell line (HEK 293) in conditions that enable recovering significant yield of antibodies that bind their target with an activity that may even be increased with respect to the binding activity of the wild type antibody.
- CHO Chinese Hamster Ovary
- COS-7 transformed African Green Monkey Kidney Fibroblast Cells
- HEK 293 Human Embryonic Kidney cell line
- Some of the obtained humanized heavy chain variable domain and light chain variable domain were in particular further humanized with respect to a first humanization step carried out on framework regions of the heavy and light chains variable domains, leading to the provision of antibodies suitable for high yield production in different cell lines, with a reduced immunogenicity, and having at least the functional features of their parental antibody.
- Anti-CMKLR1 antibodies exhibiting the recited features are useful for a potent treatment of several diseases, including diseases wherein inflammation is involved, and more particularly inflammatory diseases.
- diseases including diseases wherein inflammation is involved, and more particularly inflammatory diseases.
- inflammation is involved, and more particularly inflammatory diseases.
- several very advantageous biological effects have been reached, associated in particular to the apoptosis of neutrophils and to the reduction of migration and/or transmigration of neutrophils and/or macrophages notably, leading to strong remedi action in the resolution of inflammation.
- the new compounds allow thus to combine the production capacity and the biological activity.
- an antibody or antigen binding fragment thereof which binds to Chemokin-like receptor 1 (CMKLR1), in particular human CMKLR1, comprising: a) an antibody heavy chain variable (VH) domain comprising the three CDRs VHCDR1, VHCDR2 and VHCDR3, wherein:
- VHCDR1 is selected from the group consisting of SEQ ID No.3, SEQ ID No. 4, SEQ ID No. 5, SEQ ID No. 6 and SEQ ID No. 7;
- VHCDR2 is selected from the group consisting of SEQ ID No. 9, SEQ ID No. 10, SEQ ID No. 11, SEQ ID No. 12 and SEQ ID No. 61;
- VHCDR3 is selected from the group consisting of SEQ ID No. 13, SEQ ID No. 14, SEQ ID No. 15 and SEQ ID No. 16; b) an antibody light chain variable (VL) domain comprising the three CDRs VLCDR1, VLCDR2 and VLCDR3, wherein: - VLCDR1 is selected from the group consisting of SEQ ID No. 17, SEQ ID No. 18,
- VLCDR2 is selected from the group consisting of SEQ ID No. 24, SEQ ID No. 25, SEQ ID No. 26, SEQ ID No. 27, SEQ ID No. 28, SEQ ID No. 29, SEQ ID No. 30, SEQ ID No. 31, SEQ ID No. 32 and SEQ ID No. 33;
- VLCDR3 is selected from the group consisting of SEQ ID No. 34, SEQ ID No. 35 and SEQ ID No. 36.
- said antibody or antigen-binding fragment thereof which binds to Chemokin-like receptor 1 (CMKLR1), in particular human CMKLR1, comprises: a) an antibody heavy chain variable (VH) domain comprising the three CDRs VHCDR1, VHCDR2 and VHCDR3, wherein:
- VHCDR1 is selected from the group consisting of SEQ ID No.3, SEQ ID No. 4, SEQ ID No. 5, SEQ ID No. 6 and SEQ ID No. 7;
- VHCDR2 is selected from the group consisting of SEQ ID No. 9, SEQ ID No. 10, SEQ ID No. 11 and SEQ 61; or VHCDR2 corresponds to the amino acid sequence of SEQ ID No. 12 or SEQ ID No. 63 with the proviso that VHCDR1 is not SEQ ID No. 3 or SEQ ID No. 4; VHCDR3 is selected from the group consisting of SEQ ID No. 13, SEQ ID No. 14, SEQ ID No. 15 and SEQ ID No. 16; b) an antibody light chain variable (VL) domain comprising the three CDRs VLCDR1, VLCDR2 and VLCDR3, wherein: - VLCDR1 is selected from the group consisting of SEQ ID No. 17, SEQ ID No. 18,
- VLCDR2 is selected from the group consisting of SEQ ID No. 24, SEQ ID No. 25, SEQ ID No. 26, SEQ ID No. 27, SEQ ID No. 28, SEQ ID No. 29, SEQ ID No. 30, SEQ ID No. 31, SEQ ID No. 32 and SEQ ID No. 33;
- VLCDR3 is selected from the group consisting of SEQ ID No. 34, SEQ ID No. 35 and SEQ ID No. 36.
- said antibody or antigen-binding fragment thereof which binds to Chemokin-like receptor 1 (CMKLR1), in particular human CMKLR1, comprises: a) an antibody heavy chain variable (VH) domain comprising the three CDRs VHCDR1, VHCDR2 and VHCDR3, wherein:
- VHCDR1 is selected from the group consisting of SEQ ID No.3, SEQ ID No. 4, SEQ ID No. 5, SEQ ID No. 6 and SEQ ID No. 7;
- - VHCDR2 is selected from the group consisting of SEQ ID No. 9, SEQ ID No. 10,
- VHCDR1 is SEQ ID No. 3 or SEQ ID No. 4 and VHCDR2 corresponds to the amino sequence of SEQ ID NO: 12
- said heavy chain variable (VH) domain does not comprise a framework VHFR3 of SEQ ID No. 70, preferably with the proviso that said heavy chain variable (VH) domain comprises a framework FR3 of SEQ ID NO: 69,
- VHCDR3 is selected from the group consisting of SEQ ID No. 13, SEQ ID No. 14, SEQ ID No. 15 and SEQ ID No. 16; b) an antibody light chain variable (VL) domain comprising the three CDRs VLCDR1, VLCDR2 and VLCDR3, wherein:
- VLCDR1 is selected from the group consisting of SEQ ID No. 17, SEQ ID No. 18, SEQ ID No. 19, SEQ ID No. 20, SEQ ID No. 21 , SEQ ID No. 22 and SEQ ID No. 23;
- VLCDR2 is selected from the group consisting of SEQ ID No. 24, SEQ ID No. 25, SEQ ID No. 26, SEQ ID No. 27, SEQ ID No. 28, SEQ ID No. 29, SEQ ID No. 30,
- VLCDR3 is selected from the group consisting of SEQ ID No. 34, SEQ ID No. 35 and SEQ ID No. 36.
- the antibody or antigen-binding fragment thereof binds specifically to the third extra-cellular loop (EL3) of CMKLR1, in particular an epitope located within the third extra-cellular loop (EL3) of CMKLR1; more particularly the antibody or antigen-binding fragment thereof binds specifically to a polypeptide comprising amino acid sequence SEQ ID No: 2 or SEQ ID No. 59 or to an epitope located within amino acid sequence SEQ ID No. 60.
- An antibody or an antigen-binding fragment thereof according to this embodiment is suitable for production in different cell lines, including but not limited to mammalian cell lines, with a yield of production suitable for purposes of development of a drug candidate, while the specific binding capability to the extra cellular third loop of CMKLR1 and its Resolvin E1 -like agonist capability on CMKLR1 are retained.
- the humanized antibodies disclosed herein may therefore be efficiently produced and share the functional capabilities of their parental antibody.
- CMKLR1 Chemokin-like receptor 1
- CMKLR1 Chemokin-like receptor 1
- HEK cells suitable for the production in mammalian cells such as COS or CHO or HEK cells, in particular with a yield over 0.1 mg/ml, in particular with a yield over 1 mg/ml, more particularly with a yield of at least 10 mg/ml, and again more particularly with a yield over 100 mg/ml
- VH Variable Heavy domain comprises the amino acid sequence of the frameworks (FR1 , FR2, FR3 and FR4) of a Heavy Chain variable domain wherein each framework harbors a sequence identity respectively with the framework of the same rank in the sequence of SEQ ID No.
- the Variable Light (VL) domain comprises the amino acid sequence of the frameworks (FR1, FR2, FR3 and FR4) of a Light Chain Variable domain wherein each framework harbors a sequence identity respectively with the framework of the same rank in the sequence of SEQ ID No.50 that is at least 60 % for FR1, at least 70 % for FR2, at least 75 % for FR3 and at least 80 % for FR4, and more particularly of 100% for FR1, at least
- said humanized anti-CMKLR1 antibody or said antigen binding fragment thereof specifically binds to the third extra-cellular loop (EL3) of CMKLR1, in particular the antibody or antigen-binding fragment thereof binds specifically to a polypeptide comprising amino acid sequence SEQ ID No: 2 orSEQ ID No. 59 or to an epitope located within amino acid sequence SEQ ID No. 60.
- the inventors starting from the anti-CMKLR1 antibody 2G1 , synthetized various heavy chain variable domains and light chain variable domains.
- the humanized heavy chain variable domain of SEQ ID No. 41 and the humanized light chain variable domain of SEQ ID No. 50 were particularly suitable for the production of humanized anti-CMKLR1 antibodies in cell or cell line, including mammalian cell like CHO cells or COS cells or HEK Cells. Having selected a particular human germline sequence for the design of the heavy chain variable domain and light chain variable domain, humanized antibodies with the herein defined identities in framework regions were also able to be produced in decent amounts in cell or cell line for the purpose of developing an antibody that may give rise to a drug candidate.
- the particular anti-CMKLR1 antibodies provided herein share a highly similar structure with their parental antibody comprising heavy chain variable domain of SEQ ID No. 41 and light chain variable domain of SEQ ID No. 50, allowing the correct production, conformation and secretion of the anti-CMKLR1 antibody, thereby allowing the provision of an antibody which binds to the particular epitope of the Chemerin-like receptor 1 and having a Resolvin E1 -like agonist capability on this receptor in sufficient amount for therapeutic purposes.
- an antibody which is a humanized anti- Chemerin Like Receptor 1 (CMKLR1) antibody or an antigen-binding fragment thereof suitable for the production in mammalian cells such as COS or CHO cells, in particular with a yield over 0.1 mg/ml, more particularly with a yield over 1 mg/ml, more particularticularly with a yield over 10 mg/ml, again more particularly with a yield over 100 mg/ml, wherein : a) the Variable Heavy (VH) domain comprises the amino acid sequence of the frameworks (FR1 , FR2, FR3 and FR4) of a Heavy Chain variable domain wherein each framework harbors a sequence identity respectively with the framework of the same rank in the sequence of SEQ ID No.
- CMKLR1 humanized anti- Chemerin Like Receptor 1
- the Variable Light (VL) domain comprises the amino acid sequence of the frameworks (FR1, FR2, FR3 and FR4) of a Light Chain Variable domain wherein each framework harbors a sequence identity respectively with the framework of the same rank in the sequence of SEQ ID No.50 that is at least 60 % for FR1 , at least 80 % for FR2, at least 75 % for FR3 and at least 70 % for FR4.
- said humanized anti-CMKLR1 antibody or said antigen binding fragment thereof specifically binds to the third extra-cellular loop (EL3) of CMKLR1; in particular the antibody or antigen-binding fragment thereof binds specifically to a polypeptide comprising amino acid sequence SEQ ID No: 2 or SEQ ID No. 59 or located within amino acid sequence SEQ ID No 60.
- such humanized antibody or the antigen-binding fragment thereof comprises a) an antibody heavy chain variable (VH) domain comprising the three CDRs VHCDR1 , VHCDR2 and VHCDR3, wherein:
- - VHCDR1 is selected from the group consisting of SEQ ID No.3, SEQ ID No. 4, SEQ ID No. 5, SEQ ID No. 6 and SEQ ID No. 7; and - VHCDR2 is selected from the group consisting of SEQ ID No. 9, SEQ ID No.
- VHCDR3 is selected from the group consisting of SEQ ID No. 13, SEQ ID No. 14, SEQ ID No. 15 and SEQ ID No. 16; and b) an antibody light chain variable (VL) domain comprising the three CDRs VLCDR1, VLCDR2 and VLCDR3, wherein:
- VLCDR1 is selected from the group consisting of SEQ ID No. 17, SEQ ID No. 18, SEQ ID No. 19, SEQ ID No. 20, SEQ ID No. 21, SEQ ID No. 22 and SEQ ID No. 23; and
- such humanized antibody or the antigen-binding fragment thereof comprises: a) an antibody heavy chain variable (VH) domain comprising the three CDRs VHCDR1 , VHCDR2 and VHCDR3, wherein:
- VHCDR1 is selected from the group consisting of SEQ ID No.3, SEQ ID No. 4, SEQ ID No. 5, SEQ ID No. 6 and SEQ ID No. 7; and
- VHCDR2 is selected from the group consisting of SEQ ID No. 9, SEQ ID No. 10, SEQ ID No. 1 land SEQ 61; or VHCDR2 comprises or consists of the amino acid sequence of SEQ ID No. 12 or SEQ ID No. 63 with the proviso that VHCDR1 is not SEQ ID No.3 or SEQ ID No. 4; and - VHCDR3 is selected from the group consisting of SEQ ID No. 13, SEQ ID No.
- VL antibody light chain variable domain comprising the three CDRs VLCDR1, VLCDR2 and VLCDR3, wherein:
- VLCDR1 is selected from the group consisting of SEQ ID No. 17, SEQ ID No. 18, SEQ ID No. 19, SEQ ID No. 20, SEQ ID No. 21, SEQ ID No. 22 and SEQ ID No. 23; and
- VLCDR2 is selected from the group consisting of SEQ ID No. 24, SEQ ID No. 25, SEQ ID No. 26, SEQ ID No. 27, SEQ ID No. 28, SEQ ID No. 29, SEQ ID No. 30, SEQ ID No. 31, SEQ ID No. 32 and SEQ ID No. 33; and
- VLCDR3 is selected from the group consisting of SEQ ID No. 34, SEQ ID No. 35 and SEQ ID No. 36.
- such humanized antibody or the antigen-binding fragment thereof comprises: a) an antibody heavy chain variable (VH) domain comprising the three CDRs VHCDR1 , VHCDR2 and VHCDR3, wherein:
- VHCDR1 is selected from the group consisting of SEQ ID No.3, SEQ ID No. 4, SEQ ID No. 5, SEQ ID No. 6 and SEQ ID No. 7; and
- VHCDR2 is selected from the group consisting of SEQ ID No. 9, SEQ ID No. 10, SEQ ID No. 11 and SEQ 61; when VHCDR1 is SEQ ID No. 3 or SEQ ID No. 4 and VHCDR2 comprises or consists of the amino acid sequence of SEQ ID No. 12 said heavy chain variable (VH) domain does not comprise a framework VHFR3 of SEQ ID No. 70, preferably with the proviso that said heavy chain variable (VH) domain comprises VHFR3 of SEQ ID No. 69 ; and - VHCDR3 is selected from the group consisting of SEQ ID No. 13, SEQ ID No.
- VL antibody light chain variable domain comprising the three CDRs VLCDR1, VLCDR2 and VLCDR3, wherein:
- VLCDR1 is selected from the group consisting of SEQ ID No. 17, SEQ ID No. 18, SEQ ID No. 19, SEQ ID No. 20, SEQ ID No. 21, SEQ ID No. 22 and SEQ ID No.
- - VLCDR2 is selected from the group consisting of SEQ ID No. 24, SEQ ID No. 25, SEQ ID No. 26, SEQ ID No. 27, SEQ ID No. 28, SEQ ID No. 29, SEQ ID No. 30, SEQ ID No. 31, SEQ ID No. 32 and SEQ ID No. 33; and - VLCDR3 is selected from the group consisting of SEQ ID No. 34, SEQ ID No.
- Such antibody presents the same advantageous features as the antibodies defined according to the first aspect and the second aspect of the invention; i.e. high yield production, specific binding to an epitope located within the third extra loop of the chemerin- like Receptor 1, a Resolvin E1 -like agonist capability.
- the disclosed antibodies are suitable for being used in the treatment of a condition wherein the resolution of the inflammation is delayed or disrupted. All antibodies described herein are suitable for inducing the resolution of the inflammation, and/or enhancing resolution of the inflammation, and/or initiating resolution of the inflammation.
- a humanized anti-CMKLR1 compound is considered as being either a humanized anti-CMKLR1 antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic or modified antibody.
- said compound is defined by the sequences of its CDR.
- the anti-CMKLR1 compound is an antibody defined by the sequences of its CDRs and its framework regions (FR).
- An anti-CMKLR1 compound is a compound which binds specifically to the Chemokin-like receptor 1 (CMKLR1).
- CMKLR1 refers to a Chemokin-Like Receptor 1 protein (also designated as chemR23), a member of the G-protein coupled receptor family from a mammal species, preferably a human CMKLR1.
- chemR23 a Chemokin-Like Receptor 1 protein
- the invention relates to an anti-CMKLR1 antibody or antigen binding fragment thereof or antigen-binding antibody mimetic or modified antibody defined by at least one functional feature.
- said anti-CMKLR1 compound is defined by its capability to inhibit secretion of pro-inflammatory cytokines, in particular IL12, and/or its capability to enhance secretion of anti-inflammatory cytokines, in particular
- the anti-CMKLR1 compound inhibits or enhances cytokine secretion by macrophages, in particular by pro-inflammatory macrophages and/or by pro-resolution of the inflammation macrophages.
- the anti- CMKLR1 compound of the invention enhances the polarization of macrophages into anti- inflammatory macrophages, in particular pro-resolution macrophages.
- the anti-CMKLR1 compound of the invention enhances the apoptosis of neutrophils as compared to a control antibody.
- the invention relates to an anti-CMKLR1 antibody or antigen binding fragment thereof or antigen-binding antibody mimetic that has agonist properties towards the Resolvin E1 (RvE1)/CMKLR1 interaction, thereby mimicking at least one of the effects induced by the binding of RvE1 to CMKLR1 on CMKLRI-positive cells.
- RvE1 Resolvin E1
- “Agonist properties towards RvE1-CMKLR1 interaction ” means that the antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic or modified antibody of the invention, which targets the CMKLR1 , has the effect of mimicking at least one of the effects provided by the binding of RvE1 to CMKLR1, thereby activating the receptor signaling pathway normally activated by RvE1 , especially the binding of human RvE1 to human CMKLR1 , in particular on dendritic cells, neutrophils, monocytes and macrophages.
- the compounds of the invention may lead to the activation of the G protein signaling pathway, in particular Ga, signaling pathway and/or Ga 0 , without activating the b-arrestin pathway.
- the compound of the invention may lead to the inhibition of the b-arrestin pathway.
- the binding of a compound according to the invention induces the activation of Akt and/or Erk protein(s) in vitro and/or in vivo.
- the compound may be considered as an anti-CMKLR1 agonist having a Resolvin E1 -like capability when the G- protein signaling pathway is activated in CMKLRI-potitive cells stimulated with the compound of the invention, and in a more particular embodiment, also when the B-arrestin pathway is not activated, and in particular conditions, when the B-arrestin pathway is inhibited.
- a Resolvin-E1 like agonist antibody may be defined as an antibody able to bind CMKLR1, and thereby able to induce the phosphorylation of the Akt and/or Erk protein(s), as compared to a control antibody.
- a control antibody may be an antibody which does not specifically bind CMKLR1.
- Phosphorylation of a protein may be determined according to methods well known by the skilled artisan, for example by the method disclosed in the examples of the present description.
- the compound of the invention enhances activation of the G protein pathway induced by CMKLR1.
- the compound of the invention does not induce the activation of the b-arrestin pathway induced by CMKLR1.
- the compound of the invention inhibits the b-arrestin pathway induced by CMKLR1.
- a compound of the invention since a compound of the invention induces at least one agonist effect of the binding of RvE1 to CMKLR1, and since RvE1 is a pro-resolution factor or pro-resolution mediator, a compound of the invention is a pro-resolution factor or a pro-resolution mediator; e.g. a pro-resolution factor may be defined as a compound which inhibits the b- arrestin pathway induced by CMKLR1 and/or enhances activation of the G protein pathway induced by CMKLR1 in CMKLRI-positive cells, as compared to a control compound, which is known for not specifically interacting with CMKLR1.
- the activation/inhibition of these pathways may be assessed according to the methods disclosed in the working examples of the invention.
- the effect of the agonist compound is assessed in human cells.
- a compound of the invention does not interfere with the binding of Chemerin to CMKLR1.
- Chemerin is one of the natural ligand of CMKLR1.
- a compound according to the invention is not an agonist and/or not an antagonist of the interaction between Chemerin and CMKLR1.
- the absence of such an agonist and/or antagonist capability may be assessed according to the examples of the invention, wherein a competition assay to measure Chemerin-dependent Beta-arrestin recruitment by CMKLR1 receptor in presence of anti-CMKLR1 antibody of the invention is disclosed.
- the anti-CMKLR1 compound of the invention does not compete with Chemerin for the binding to CMKLR1.
- the absence of competition between an anti-CMKLR1 compound of the invention and chemerin may be determined when, in presence of the CMKLR1 compound of the invention, the binding of Chemerin to CMKLR1 is at least 50%, more preferably at least 80%, still more preferably at least 90% and most preferably similar, to the binding of Chemerin to CMKLR1, under the same experimental conditions but without the presence of the anti-CMKLR1 of the invention.
- the absence of competition between an anti-CMKLR1 compound of the invention and Chemerin may be determined according to the method illustrated in example 9.
- the anti-CMKLR1 compound has the capability in vitro and/or in vivo to activate at least one of the Akt signaling pathway proteins (also known as PI3K-Akt Pathway) and/or Erk signaling pathway proteins, preferably Akt protein and/or Erk protein, preferably both the Akt and the Erk proteins.
- Akt signaling pathway proteins also known as PI3K-Akt Pathway
- Erk signaling pathway proteins preferably Akt protein and/or Erk protein, preferably both the Akt and the Erk proteins.
- Activation of a pathway may be assessed according to methods known in the art, and in particular with methods disclosed in the examples of the present invention.
- the present invention relates to an agonist of CMKLR1 having a Resolvin E1 -like capability for use in the therapeutic treatment of an inflammatory condition in a patient, in particular an inflammatory condition wherein the resolution phase of the inflammation is delayed or disrupted, in particular in a chronic inflammation, in particular said agonist being selected from the group consisting of an antibody or antigen-binding fragment thereof, a peptide, a polypeptide and a protein.
- CMKLR1 having a Resolvin E1 -like capability may be identified as the or a “agonist”; both terms include an antibody or antigen-bind fragment thereof (also reference anti-CMKLR1 antibody), a protein, a peptide or a polypeptide; the term compound or anti-CMKLR1 compound may also be used in the following description as a synonym of “agonist” (of the invention), thereby including an antibody or antigen-bind fragment thereof (also referred to as anti- CMKLR1 antibody), a protein, a peptide or a polypeptide.
- an agonist of CMKLR1 having a Resolvin E1 -like capability induces the apoptosis of polymorphonuclear neutrophils (also simply referenced neutrophils, PMN or PMNs herein), and/or the decrease or the inhibition of the migration capability of these cells, in particular through the inhibition of their capacity of transmigration through endothelium towards the site of inflammation as described later in the application
- an agonist of CMKLR1 having a Resolvin E1 -like capability induces the internalization of different receptors expressed on the cell surface on various myeloid cells, notably macrophages and/or dendritic cells, thereby enhancing the processes which induce or sustain the resolution of the inflammation as described later in the application; in particular an agonist of CMKLR1 having a Resolvin E1 -like capability induces the internalization of different receptors CMKLR1, and CXCR4 and/or CCR7 expressed on the
- CMKLR1 having a Resolvin E1 -like capability decreases or inhibits the capability of neutrophils and macrophages and/or dendritic cells to migrate; in particular, it decreases or inhibits the ability of neutrophils to transmigrate through the site of inflammation by lowering the rolling capability of these cells due to the internalization and/or the decrease of cell surface expression of CD62L, reducing their ability to transmigrate through the endothelium;
- CMKLR1 having a Resolvin E1 -like capability comprising a domain suitable for interaction with a Fc receptor, like IgG constant domain, in particular lgG1 constant domain
- Fc receptor like IgG constant domain, in particular lgG1 constant domain
- the Fc Receptors of macrophages or neutrophils recognize particularly very efficiently the Fc fragment of the anti-CMKLR1 IgG-constant domain, or lgG1 constant domain, leading or contributing to the apoptosis of the neutrophils recognized by the anti-CMKLR1 lgG1-antibodies
- the inventors herein demonstrate that myeloid cells which are involved in the inflammation process (i.e. which sustain inflammation) and which express CMKLR1, and CXCR4 and/or CCR7, are particularly suitable targets for an agonist of CMKLR1 having a Resolvin E14ike capability, for the treatment of a pathological inflammation process.
- the invention relates especially to an agonist of anti-Chemerin Like Receptor 1 (CMKLR1) having a Resolvin E14ike capability, for use in the treatment of a patient suffering from an inflammatory condition, in particular an inflammatory condition wherein the resolution of inflammation is delayed or disrupted, wherein the agonist of CMKLR1 having a Resolvin E1 ike capability is selected from the group consisting of an antibody or antigen-binding fragment thereof, a peptide, a polypeptide and a protein, and wherein the agonist : induces or activates the apoptosis of neutrophils at the site of inflammation, and/or inhibits or decreases the transmigration capability of neutrophils through endothelium towards the site of inflammation, and/or inhibits the migration of macrophages and/or of dendritic cells from the site of inflammation to secondary lymphoid organs and/or towards the site of inflammation.
- CMKLR1 anti-Chemerin Like Receptor 1
- the invention relates to the use of an agonist of CMKLR1 having a Resolvin E1 -like capability, like an antibody, in particular a humanized antibody, or antigen-binding fragment thereof, to induce or enhance or activate the apoptosis of neutrophils, in the treatment of an inflammatory condition, in particular an inflammatory condition wherein the resolution of inflammation is delayed or disrupted.
- an agonist of CMKLR1 having a Resolvin E1 -like capability like an antibody, in particular a humanized antibody, or antigen-binding fragment thereof, to induce or enhance or activate the apoptosis of neutrophils, in the treatment of an inflammatory condition, in particular an inflammatory condition wherein the resolution of inflammation is delayed or disrupted.
- the invention relates to a humanized anti-CMKLR1 antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic or modified antibody.
- the term “antibody” comprises polyclonal antibodies, monoclonal antibodies or recombinant antibodies.
- a "monoclonal antibody” is intended to refer to a preparation of antibody molecules to obtain antibodies which share a common heavy chain and common light chain amino acid sequence, in contrast with “polyclonal” antibody preparations which contain a mixture of antibodies of different amino acid sequence.
- Monoclonal antibodies can be generated by several known technologies like phage, bacteria, yeast or ribosomal display, as well as by classical methods exemplified by hybridoma-derived antibodies. They may also be synthetized using the disclosed amino acid sequences as reference. Thus, the term “monoclonal” is used to refer to all antibodies derived from one nucleic acid clone.
- the term “antibody” further comprises antibodies which have been modified as compared to a wild type antibody; and encompass chimeric antibodies, humanized antibodies, modified antibodies, and antigen-binding antibody mimetics.
- a particular wild type antibody of reference in the context of the invention is antibody 2G1.
- the antibodies of the present invention include recombinant antibodies.
- the term “recombinant antibody” refers to antibodies which are produced, expressed, generated or isolated by recombinant means, such as antibodies which are expressed using a recombinant expression vector transfected into a host cell; antibodies isolated from a recombinant combinatorial antibody library; antibodies isolated from an animal (e.g.
- a mouse which is transgenic due to human immunoglobulin genes; or antibodies which are produced, expressed, generated or isolated in any other way in which particular immunoglobulin gene sequences (such as human immunoglobulin gene sequences) are assembled with other DNA sequences.
- Recombinant antibodies include, for example, chimeric and humanized antibodies.
- a “chimeric antibody” refers to an antibody in which the sequence of the variable domain derived from the germline of a mammalian species, such as a mouse, have been grafted onto the sequence of the constant domain derived from the germline of another mammalian species, such as a human.
- a “humanized antibody” refers in a first embodiment to an antibody in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human or especially humanized framework sequences.
- a “humanized antibody” refers to an antibody wherein at least one CDR and all or part of framework sequences have been humanized.
- an “antigen-binding fragment of an antibody” means a part of an antibody, i.e. a molecule corresponding to a portion of the structure of the antibody of the invention, that exhibits antigen-binding capability for CMKLR1, possibly in its native form; such fragment especially exhibits the same or substantially the same antigen-binding specificity for said antigen compared to the antigen-binding specificity of the corresponding four-chain antibody.
- the antigen-binding fragments have a similar binding affinity as the corresponding 4-chain antibodies.
- antigen-binding fragment that have a reduced antigen-binding affinity with respect to corresponding 4-chain antibodies are also encompassed within the invention.
- the antigen-binding capability can be determined by measuring the affinity between the antibody and the target fragment. These antigen-binding fragments may also be designated as “functional fragments” of antibodies.
- Antigen-binding fragments of antibodies are fragments which comprise their hypervariable domains designated CDRs (Complementary Determining Regions) or part(s) thereof encompassing the recognition site for the antigen, i.e. the extracellular domain of CMKLR1, in particular the third loop of the extracellular domain of CMKLR1 (designated EL3), thereby defining antigen recognition specificity.
- EL3 is localized between amino acid residue 283 and amino acid residue 300 of SEQ ID No: 1.
- the amino acid sequence of the EL3 domain is the amino acid sequence of SEQ ID No: 2.
- EL3 is also comprised within the polypeptide of SEQ ID No: 52.
- Each Light and Heavy chain variable domains (respectively VL and VH) of a four-chain immunoglobulin has three CDRs designated VLCDR1, VLCDR2 and VLCDR3 for the light chain variable domain; and VHCDR1, VHCDR2, VHCDR3 for the heavy chain variable domain.
- Each Light chain and Heavy chain variable domains of a four-chain immunoglobulin has four framework regions (FR), designated LFR1, LFR2, LFR3 and LFR4 for the light chain variable domain; and HFR1 , HFR2, HFR3 and HFR4 for the heavy chain variable domain.
- FR framework regions
- the nomenclature system used for defining the CDR domains and the framework domains is the kabat system.
- the skilled person is able to determine the location of the various regions/domains of antibodies by reference to the standard definitions in this respect set forth, including a reference numbering system, a reference to the numbering system of KABAT or by application of the IMGT “collier de perle” algorithm.
- the delimitation of the regions/domains may vary from one reference system to another.
- the regions/domains as defined in the present invention encompass sequences showing variations in length or localization of the concerned sequences within the full-length sequence of the variable domains of the antibodies, of approximately +/- 10%.
- antigen-binding fragments can thus be defined by comparison with sequences of antibodies in the available databases and prior art, and especially by comparison of the location of the functional domains in these sequences, noting that the positions of the framework and constant domains are well defined for various classes of antibodies, especially for IgGs, in particular for mammalian IgGs. Such comparison also involves data relating to 3-dimensional structures of antibodies.
- antigen binding fragments of an antibody that contain the variable domains comprising the CDRs of said antibody encompass Fv, dsFv, scFv, Fab, Fab', F(ab')2.
- Fv fragments consist of the VL and VH domains of an antibody associated together by hydrophobic interactions; in dsFv fragments, the VH:VL heterodimer is stabilized by a disulphide bond; in scFv fragments, the VL and VH domains are connected to one another via a flexible peptide linker thus forming a single-chain protein.
- Fab fragments are monomeric fragments obtainable by papain digestion of an antibody; they comprise the entire L chain, and a VH-CH1 fragment of the H chain, bound together through a disulfide bond.
- the F(ab')2 fragment can be produced by pepsin digestion of an antibody below the hinge disulfide; it comprises two Fab’ fragments, and additionally a portion of the hinge region of the immunoglobulin molecule.
- the Fab' fragments are obtainable from F(ab')2 fragments by cutting a disulfide bond in the hinge region.
- F(ab')2 fragments are divalent, i.e.
- Fv a VHVL dimmer constituting the variable part of Fab
- dsFv a VHVL dimmer constituting the variable part of Fab
- dsFv a VHVL dimmer constituting the variable part of Fab
- dsFv a VHVL dimmer constituting the variable part of Fab
- dsFv a VHVL dimmer constituting the variable part of Fab
- dsFv dsFv
- scFv scFv
- Fab Fab' fragments
- Fab' fragments monovalent, i.e. they comprise a single antigen-binding site.
- These basic antigen-binding fragments of the invention can be combined together to obtain multivalent antigen-binding fragments, such as diabodies, tribodies or tetrabodies.
- multivalent antigen-binding fragments are also part of the present invention.
- modified antibody includes "bispecific" antibodies and refers to antibodies that recognize two different antigens by virtue of possessing at least one region (e.g. derived from a variable region of a first antibody) that is specific for a first antigen, and at least a second region (e.g. derived from a variable region of a second antibody) that is specific for a second antigen.
- a bispecific antibody specifically binds to two target antigens and is thus one type of multispecific antibody.
- Multispecific antibodies, which recognize two or more different antigens can be produced by recombinant DNA methods or include, but are not limited to, antibodies produced chemically by any convenient method.
- Bispecific antibodies include all antibodies or conjugates of antibodies, or polymeric forms of antibodies which are capable of recognizing two different antigens.
- Bispecific antibodies include antibodies that have been reduced and reformed so as to retain their bivalent characteristics and to antibodies that have been chemically coupled so that they can have several antigen recognition sites for each antigen such as BiME (Bispecific Macrophage Enhancing antibodies), BiTE (bispecific T cell engager), DART (Dual affinity retargeting); DNL (dock-and-lock), DVD-lg (dual variable domain immunoglobulins), HAS (human serum albumin), kih (knobs into holes).
- Antigen-binding antibody mimetics are organic compounds that specifically bind antigens, but that are not structurally related to antibodies.
- Antibody mimetics are being developed as therapeutic and diagnostic agents. Antigen-binding antibody mimetics may also be selected among the group comprising affibodies, affilins, affimers, affitins, DARPins, and Monobodies. [45] An antigen-binding antibody mimetic is more preferentially selected from the groups comprising affitins and anticalins.
- Affitins are artificial proteins with the ability to selectively bind antigens. They are structurally derived from the DNA binding protein Sac7d, found in Sulfolobus acidocaldarius, a microorganism belonging to the archaeal domain. By randomizing the amino acids on the binding surface of Sac7d, e.g. by generating variants corresponding to random substitutions of 11 residues of the binding interface of Sac7d, an affitin library may be generated and subjecting the resulting protein library to rounds of ribosome display, the affinity can be directed towards various targets, such as peptides, proteins, viruses and bacteria. Affitins are antibody mimetics and are being developed as tools in biotechnology.
- Anticalins are artificial proteins that are able to bind to antigens, either to proteins or to small molecules. They are antibody mimetics derived from human lipocalins which are a family of naturally binding proteins.
- Anticalins are about eight times smaller with a size of about 180 amino acids and a mass of about 20 kDa (Skerra, Febs J., 275:11, 2008).
- Anticalin phage display libraries have been generated which allow for the screening and selection, in particular of anticalins with specific binding properties.
- the skilled person may readily develop anticalins with the required binding properties using methods know in the art, in particular as disclosed in EP patent EP1270725 B1, US patent US8536307 B2, Schlehuber and Skerra, Biophys. Chem., 96:2-3, 2002 and the above-cited publication, in particular the generation of phage display and/or ribosome display libraries and their screening using an antigen as disclosed herein.
- Anticalins and affitins may both be produced in a number of expression system comprising bacterial expression systems.
- the invention includes the use of affitins, anticalins and other similar antibody mimetics with the features of the antibodies described herein, in particular with regard to their binding capability to CMKLR1, to their agonist capability towards the binding between RvE1 and CMKLR1, their capability to induce or inhibit secretion of particular cytokines as described herein, to their use in the treatment or the prevention of a disease as described herein, all of which are contemplated as mimetics according to the invention.
- modified antibody refers to antibodies the amino sequence of which has been modified by mutation of at least one amino acid residue. Accordingly, “modified antibody” encompasses chimeric antibodies or humanized antibodies as defined herein, “modified antibody” may also correspond to a molecule comprising an antibody or an antigen-binding fragment thereof, wherein said monoclonal antibody or functional fragment thereof is associated with a functionally different molecule.
- a modified antibody of the invention may be either a fusion chimeric protein or a conjugate resulting from any suitable form of attachment including covalent attachment, grafting, chemical bonding with a chemical or biological group or with a molecule, such as a PEG polymer or another protective group or molecule suitable for protection against proteases cleavage in vivo, for improvement of stability and/or half-life of the antibody or functional fragment.
- “Humanized” forms of non-human (e.g., murine) antibodies are chimeric immunoglobulins, immunoglobulin chains or fragments thereof (such as Fv, Fab, Fab', F(ab')2 or other target-binding subsequences of antibodies) which contain minimal sequence derived from non-human immunoglobulin.
- the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all the CDR regions correspond to those of a non-human immunoglobulin and/or humanized version of those; and all or substantially all of the FR regions are those of a human immunoglobulin template sequence or harbors substitution of non-human residues (such as rodent residues) for amino acid residues present in the human immunoglobulin template sequence at the corresponding location.
- the humanized antibody may also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin template chosen.
- Fc immunoglobulin constant region
- the invention relates to an antibody comprising a heavy chain variable region as disclosed herein and a light chain variable region as disclosed herein, the heavy chain variable region and/or the light chain variable region further comprising a constant region, in particular a Fc region.
- CMKLR1 CMKLR1 with an affinity of at least 1 X 10 6 M, 1 X 10- 7 M, 1 X 10- 8 M, 1 X 10- 9 M, 1 X 10 10 M, 1 X 10 11 M, 1 X 10 12 M, or more, and/or to bind to CMKLR1 with an affinity which is at least two-fold greater to its affinity for a non specific target (e.g. another protein than CMKLR1).
- the affinity may be assessed according to various methods well known from those skilled in the art.
- therapeutically effective amount is used to refer to an amount of any given compound as defined herein sufficient for at least the improvement of the clinical or physiological condition of a treated patient.
- therapeutically effective amount of the antibody, antigen-binding fragment thereof, antigen-binding antibody mimetic or modified antibody according to the invention to be administered is governed by considerations such as the disorder being treated, the particular mammal being treated, the clinical condition of the individual patient, the cause of the disorder, the site of delivery of the agent, the method of administration, the scheduling of administration, and other factors known to medical practitioners.
- the CMKLR1 is a human CMKLR1, which corresponds to NCBI Protein accession number Q99788.2.
- a heavy chain variable domain and a light chain variable domain both comprise 3 CDRs (CDR1, CDR2 and CDR3 from 5’ end to 3’ end respectively) and 4 framework regions (FR1, FR2, FR3 and FR4 from 5’ end to 3’ end respectively).
- Humanization of the murine antibody may consist of humanizing at least one framework region within the light chain variable region and/or within the heavy chain variable region or both. In a particular embodiment, several framework regions may be humanized, in particular within the heavy chain variable region and within the light chain variable region.
- the wild type CDRs may be conserved, but the CDRs may also be replaced by the CDRs described herein.
- the anti-CMKLR1 compound according to the invention may comprise at least 1, or at least 2, or at least 3 or at least 4, or at least 5, or 6 wild type CDRs when the framework regions are humanized.
- the anti-CMKLR1 compound is a humanized version of the parental chimeric antibody 2G1 (which comprises the heavy chain variable domain of SEQ ID No. 37 and the light chain variable domain of SEQ ID No. 49), wherein at least 1 framework region is humanized, in particular wherein at least 1 framework region and at least 1 CDR are humanized.
- variable regions of the antibody may be associated with antibody constant regions, like IGg1, lgG2, lgG3 or lgG4 constant regions, especially lgG1 constant region.
- antibody constant regions like IGg1, lgG2, lgG3 or lgG4 constant regions, especially lgG1 constant region.
- These constant regions may be further mutated or modified, by methods known in the art, for modifying their binding capability towards Fc receptor.
- the antibody or antigen-binding fragment thereof according to the invention is a humanized monoclonal antibody, in particular wherein the antibody light chain constant domain is derived from a human kappa light chain constant domain, in particular wherein the light chain constant domain comprises or consists of the sequence of SEQ ID No: 79, and wherein the antibody heavy chain constant domain is derived from a human lgG1, lgG2, lgG3, or lgG4 heavy chain constant domain, especially lgG1 heavy chain constant domain in particular wherein the antibody heavy chain constant domain comprises or consists of the amino acid sequence of SEQ ID 80, SEQ ID No. 81, SEQ ID No. 82, SEQ ID No. 83 or SEQ ID No.
- the antibody heavy chain constant domain comprises or consists of the amino acid sequence of SEQ ID No:80 or SEQ ID No. 83.
- the binding to the polypeptide comprising or consisting of amino acid residues of sequence SEQ ID No: 2 and/or SEQ Id No: 59 and/or located within amino acid sequence SEQ ID No 60 and/or for the binding to the third extra-loop of CMKLR1 may be assessed by the examples disclosed in the examples of the invention by binding affinity analysis by ELISA assays.
- a cross-blocking assay e.g. a competitive ELISA assay
- a polypeptide comprising or consisting of the epitope or the third loop may be coated on the wells of a microtiter plate and pre-incubated with or without candidate competing antibody and then a biotin-labeled 2G1 antibody of the invention is added.
- the amount of labeled anti-2G1 antibody bound to the polypeptide comprising or consisting of the polypeptide of SEQ ID No: 2 and/or SEQ Id No: 59 and/or located within amino acid sequence SEQ ID No 60 and/or the third loop of CMKLR1 in the wells is measured using avidin-peroxidase conjugate and appropriate substrate.
- the antibody can be labeled with a radioactive or fluorescent label or some other detectable and measurable label.
- the amount of labeled anti-2G1 antibody that bound to the polypeptide of SEQ ID No: 2 and/or SEQ Id No: 59 and/or located within amino acid sequence SEQ ID No 60 and/or to the third loop will have an indirect correlation to the ability of the candidate competing antibody (test antibody) to compete for binding to the same epitope or to the same loop, i.e., the greater the affinity of the test antibody for the same epitope, the less labeled 2G1 antibody will be bound to the antigen-coated wells.
- a candidate competing antibody is considered an antibody that competes for binding to the same polypeptide or third loop as 2G1 antibody of the invention when the candidate antibody can block binding of the 2G1 antibody by at least 20%, preferably by at least 20-50%, even more preferably, by at least 50% as compared to a control performed in parallel in the absence of the candidate competing antibody (but may be in the presence of a known non-competing antibody). It will be understood that variations of this assay can be performed to arrive at the same quantitative value.
- the anti-CMKLR1 antibody or antigen-binding fragment thereof has an effect of a pro resolution factor of inflammation, in particular has such an effect by interacting with myeloid cell lineages.
- a particular VHCDR2 is present in antibodies which may present a reduced immunogenicity in human, thereby allowing the provision of antibodies which may be more potent for therapeutic purposes, since less side- effects are expected when reduced-immunogenic antibodies are administered to a patient.
- CMKLR1 anti-Chemokin Like Receptor 1
- said antibody of antigen-binding fragment thereof comprising: a. an antibody heavy chain variable (VH) domain comprising the three CDRs VHCDR1 , VHCDR2 and VHCDR3, wherein:
- VHCDR1 is selected from the group consisting of SEQ ID No.3, SEQ ID No. 4, SEQ ID No. 5, SEQ ID No. 6 and SEQ ID No. 7;
- VHCDR2 is selected from the group consisting of SEQ ID No. 9, SEQ ID No. 10, SEQ ID No. 11, SEQ ID No. 12 and SEQ ID No. 61; - VHCDR3 is selected from the group consisting of SEQ ID No. 13, SEQ ID No. 14,
- VL antibody light chain variable
- VLCDR1 is selected from the group consisting of SEQ ID No. 17, SEQ ID No. 18, SEQ ID No. 19, SEQ ID No. 20, SEQ ID No. 21, SEQ ID No. 22 and SEQ ID No.
- VLCDR2 is selected from the group consisting of SEQ ID No. 24, SEQ ID No. 25, SEQ ID No. 26, SEQ ID No. 27, SEQ ID No. 28, SEQ ID No. 29, SEQ ID No. 30, SEQ ID No. 31, SEQ ID No. 32 and SEQ ID No. 33;
- - VLCDR3 is selected from the group consisting of SEQ ID No. 34, SEQ ID No. 35 and SEQ ID No. 36.
- the antibody or antigen-binding fragment thereof binds specifically to an epitope located within the third extra-cellular loop (EL3) of CMKLR1, more particularly the antibody or antigen-binding fragment thereof binds specifically to a polypeptide comprising amino acid sequence SEQ ID No: 2 or SEQ ID No. 59 or to an epitope located within amino acid sequence SEQ ID No. 60.
- CMKLR1 anti-Chemokin Like Receptor 1
- said antibody of antigen-binding fragment thereof comprising: a. an antibody heavy chain variable (VH) domain comprising the three CDRs VHCDR1, VHCDR2 and VHCDR3, wherein:
- VHCDR1 is selected from the group consisting of SEQ ID No.3, SEQ ID No. 4, SEQ ID No. 5, SEQ ID No. 6 and SEQ ID No. 7;
- - VHCDR2 is selected from the group consisting of SEQ ID No. 9, SEQ ID No. 10,
- VHCDR2 corresponds to the amino acid residues of SEQ ID No. 12 or SEQ ID No. 63 with the proviso that VHCDR1 is not SEQ ID No. 3 or SEQ ID No. 4;
- VHCDR3 is selected from the group consisting of SEQ ID No. 13, SEQ ID No. 14, SEQ ID No. 15 and SEQ ID No. 16; b. an antibody light chain variable (VL) domain comprising the three CDRs
- VLCDR1 is selected from the group consisting of SEQ ID No. 17, SEQ ID No. 18, SEQ ID No. 19, SEQ ID No. 20, SEQ ID No. 21, SEQ ID No. 22 and SEQ ID No. 23;
- - VLCDR2 is selected from the group consisting of SEQ ID No. 24, SEQ ID No. 25,
- SEQ ID No. 26 SEQ ID No. 27, SEQ ID No. 28, SEQ ID No. 29, SEQ ID No. 30, SEQ ID No. 31, SEQ ID No. 32 and SEQ ID No. 33;
- VLCDR3 is selected from the group consisting of SEQ ID No. 34, SEQ ID No. 35 and SEQ ID No. 36.
- the antibody or antigen-binding fragment thereof binds specifically to an epitope located within the third extra-cellular loop (EL3) of CMKLR1, more particularly the antibody or antigen-binding fragment thereof binds specifically to a polypeptide comprising amino acid sequence SEQ ID No: 2 or SEQ ID No. 59 or to an epitope located within amino acid sequence SEQ ID No. 60.
- CMKLR1 anti-Chemokin Like Receptor 1
- CMKLR2 antigen-binding fragment thereof which binds to CMKLR1, in particular human CMKLR1
- said antibody of antigen-binding fragment thereof comprising: a. an antibody heavy chain variable (VH) domain comprising the three CDRs VHCDR1 , VHCDR2 and VHCDR3, wherein:
- VHCDR1 is selected from the group consisting of SEQ ID No.3, SEQ ID No. 4, SEQ ID No. 5, SEQ ID No. 6 and SEQ ID No. 7;
- VHCDR2 is selected from the group consisting of SEQ ID No. 9, SEQ ID No. 10, SEQ ID No. 11 and SEQ ID No. 61; when VHCDR1 is SEQ ID No. 3 or SEQ ID No. 4 and VHCDR2 corresponds to the amino sequence of SEQ ID NO: 12 said heavy chain variable (VH) domain does not comprise a framework VHFR3 of SEQ ID No. 70, preferably with the proviso that said heavy chain variable (VH) domain comprises a framework FR3 of SEQ ID NO: 69,
- - VHCDR3 is selected from the group consisting of SEQ ID No. 13, SEQ ID No. 14,
- VL antibody light chain variable
- VLCDR1 is selected from the group consisting of SEQ ID No. 17, SEQ ID No. 18, SEQ ID No. 19, SEQ ID No. 20, SEQ ID No. 21, SEQ ID No. 22 and SEQ ID No. 23;
- VLCDR2 is selected from the group consisting of SEQ ID No. 24, SEQ ID No. 25, SEQ ID No. 26, SEQ ID No. 27, SEQ ID No. 28, SEQ ID No. 29, SEQ ID No. 30, SEQ ID No. 31, SEQ ID No. 32 and SEQ ID No. 33;
- VLCDR3 is selected from the group consisting of SEQ ID No. 34, SEQ ID No. 35 and SEQ ID No. 36.
- the antibody or antigen-binding fragment thereof binds specifically to an epitope located within the third extra-cellular loop (EL3) of CMKLR1, more particularly the antibody or antigen-binding fragment thereof binds specifically to a polypeptide comprising amino acid sequence SEQ ID No: 2 orSEQ ID No. 59 or to an epitope located within amino acid sequence SEQ ID No. 60.
- the binding to the epitope located within the third extra-cellular loop (EL3) of CMKLR1 in particular wherein the antibody or antigen-binding fragment thereof binds specifically to a polypeptide comprising amino acid sequence SEQ ID No: 2 or SEQ ID No. 59 or to an epitope located within amino acid sequence of SEQ ID No. 60, may be assessed according to the method disclosed here above.
- the particular selection of VHCDR2 may allow the provision of antibodies with a reduced immunogenicity as compared to antibodies which have a different VHCDR2.
- Such an antibody is an agonist of CMKLR1 mimicking the effect of a binding of Resolvin E1 to CMKLR1 7.e. having a Resolvin E1 -like capability as defined here above.
- the anti- CMKLR1 antibody or antigen-binding fragment thereof has an effect of a pro-resolution factor of inflammation, in particular has such an effect by interacting with myeloid cell lineages.
- the anti-CMKLR1 antibody or an antigen binding fragment thereof comprises: - VHCDR1 selected from the group consisting of SEQ ID No. 3 and SEQ ID No. 4.
- the anti-CMKLR1 antibody or an antigen binding fragment thereof comprises:
- VHCDR2 selected from the group consisting of SEQ ID No. 9, SEQ ID No. 10, SEQ ID No. 11 and SEQ ID No. 61.
- the anti-CMKLR1 antibody or an antigen binding fragment thereof comprises: VHCDR3 selected from the group consisting of SEQ ID No. 13, SEQ ID No. 14 and SEQ ID No. 15.
- the anti-CMKLR1 antibody or an antigen binding fragment thereof comprises: - VLCDR1 selected from the group consisting of SEQ ID No. 17, SEQ ID No. 18,
- the anti-CMKLR1 antibody or an antigen binding fragment thereof comprises:
- VLCDR2 selected from the group consisting of SEQ ID No. 24, SEQ ID No. 25, SEQ ID No. 26, SEQ ID No. 27 and SEQ ID No. 33.
- the anti-CMKLR1 antibody or an antigen binding fragment thereof comprises:
- the anti-CMKLR1 antibody or an antigen binding fragment thereof comprises:
- VHCDR1 selected from the group consisting of SEQ ID No. 3 and SEQ ID No. 4; and/or
- VHCDR2 selected from the group consisting of SEQ ID No. 9, SEQ ID No. 10, SEQ ID No. 11 and SEQ ID No. 61 ; and/or
- VHCDR3 selected from the group consisting of SEQ ID No. 13, SEQ ID No. 14 and SEQ ID No. 15.
- VLCDR1 selected from the group consisting of SEQ ID No. 17, SEQ ID No. 18, SEQ ID No. 19 and SEQ ID No. 23, and/or - VLCDR2 selected from the group consisting of SEQ ID No. 24, SEQ ID No. 25,
- SEQ ID No. 26 SEQ ID No. 27 and SEQ ID No. 33; and/or VLCDR3 selected from the group consisting of SEQ ID No. 34, SEQ ID No. 35 and SEQ ID No. 36.
- the anti-CMKLR1 antibody or an antigen-binding fragment thereof comprises the following CDRs: VHCDR1 of SEQ ID NO: 4, VHCDR2 of SEQ ID NO:
- VHCDR3 of SEQ ID NO: 13 VLCDR1 of SEQ ID NO: 19, VLCDR2 of SEQ ID NO: 26 and VLCDR3 of SEQ ID NO: 35.
- the anti-CMKLR1 antibody or an antigen- binding fragment thereof comprises a heavy chain variable domain comprising or consisting of an amino acid sequence selected from the group consisting of SEQ ID No. 38, SEQ ID No. 39, SEQ ID No. 40, SEQ ID No. 62, SEQ ID No. 89, SEQ ID No. 90 and SEQ ID No. 91.
- the anti-CMKLR1 antibody or an antigen-binding fragment thereof comprises a heavy chain variable domain comprising or consisting of an amino acid sequence of SEQ ID No. 91.
- the anti-CMKLR1 antibody or an antigen binding fragment thereof comprises a light chain variable domain comprising or consisting of an amino acid sequence selected from the group consisting of SEQ ID No. 49, SEQ ID No. 50, SEQ ID No. 51, SEQ ID No. 52, SEQ ID No. 53, SEQ ID No. 54, SEQ ID No. 55, SEQ ID No. 56, SEQ ID No. 57, SEQ ID No. 58, SEQ ID No. 92 and SEQ ID No. 93.
- the anti-CMKLR1 antibody or an antigen-binding fragment thereof comprises a light chain variable domain comprising or consisting of an amino acid sequence of SEQ ID No. 93.
- the anti-CMKLR1 antibody or an antigen- binding fragment thereof comprises: a heavy chain variable domain comprising or consisting of an amino acid sequence selected from the group consisting of SEQ ID No. 38, SEQ ID No. 39, SEQ ID No. 40, SEQ ID No. 62, SEQ ID No. 89, SEQ ID No. 90 and SEQ ID No. 91; and a light chain variable domain comprising or consisting of an amino acid sequence selected from the group consisting of SEQ ID No. 49, SEQ ID No. 50, SEQ ID No.
- SEQ ID No. 52 SEQ ID No. 53, SEQ ID No. 54, SEQ ID No. 55, SEQ ID No. 56, SEQ ID No. 57, SEQ ID No. 58, SEQ ID No. 92 and SEQ ID No. 93.
- the anti-CMKLR1 antibody or an antigen-binding fragment thereof according to the invention comprises a heavy chain variable domain comprising or consisting of the amino acid residues selected from the group consisting of 38, SEQ ID No. 39, SEQ ID No. 40, and SEQ ID No. 62; and a light chain variable domain comprising or consisting of an amino acid sequence selected from the group consisting of SEQ ID No. 54, SEQ ID No. 55 and SEQ ID No. 56.
- the anti-CMKLR1 antibody or an antigen-binding fragment thereof comprises a heavy chain variable domain comprising or consisting of an amino acid sequence SEQ ID No. 38 and a light chain variable domain of SEQ ID No. 49.
- the anti-CMKLR1 antibody or an antigen-binding fragment thereof comprises a heavy chain variable domain comprising or consisting of an amino acid sequence of SEQ ID No. 91 , and a light chain variable domain comprising or consisting of an amino acid sequence of SEQ ID No. 93.
- said antibody is advantageously characterized in that its Fc fragment is characteristic of an lgG1.
- EL3 extra-cellular loop
- the combination of the heavy chain variable domain of SEQ ID No. 37 and light chain variable domain of SEQ ID No. 49 corresponds to the parental antibody 2G1.
- the binding of the compound to a polypeptide comprising or consisting of amino acid sequence of sequence SEQ ID No: 2 or SEQ ID No. 59 or located within SEQ ID No. 60 or to a polypeptide comprising or consisting of the third loop (EL3) of the extracellular domain of CMKLR1 may be assessed according to the method disclosed here above, and illustrated in the examples of the invention.
- the anti-CMKLR1 antibody or an antigen-binding fragment thereof comprises a heavy chain variable domain comprising or consisting of an amino acid sequence of SEQ ID No. 91.
- the anti-CMKLR1 antibody or an antigen-binding fragment thereof comprises a light chain variable domain comprising or consisting of an amino acid sequence of SEQ ID No. 93.
- the anti-CMKLR1 antibody or an antigen-binding fragment thereof comprises a heavy chain variable domain comprising or consisting of an amino acid sequence of SEQ ID No. 91, and a light chain variable domain comprising or consisting of an amino acid sequence of SEQ ID No. 93.
- the invention relates to any of the above defined compound of the invention, for use in the prevention and/or the treatment of a disease wherein the resolution of inflammation is delayed or disrupted, and/or a disease selected from the group of inflammatory diseases, in particular acute inflammatory diseases, chronic inflammatory diseases such as chronic inflammatory pulmonary diseases (e.g asthma), keratoconjunctivitis, periodontal disease, eczema, inflammatory bowel disease, in particular Crohn’s disease or colitis, in particular ulcerative colitis or spontaneous colitis, cystic fibrosis, cutaneous inflammation ; autoimmune diseases such as diabetes, NASH, in particular type I diabetes, psoriasis, lupus, rheumatoid arthritis, multiple sclerosis, Sjogren’s syndrome, celiac disease, vasculitis, myasthenia gravis; infection diseases such as sepsis, severe
- Fibrosis notably lung and hepatic fibrosis
- ANCA Anti neutrophil Cytoplasmic Autoantibodies
- pathologies vaculitis
- pathologies due to apoptosis of neurons linked to ChermR23 are in particular concerned.
- the invention relates to any of the above defined compound of the invention, for use in the prevention and/or the treatment of a disease wherein the resolution of inflammation is delayed or disrupted, and/or a disease selected from the group of inflammatory diseases, in particular acute inflammatory diseases, chronic inflammatory diseases such as asthma, keratoconjunctivitis, periodontal disease, eczema, inflammatory bowel disease, in particular Crohn’s disease or colitis, in particular ulcerative colitis or spontaneous colitis; cystic fibrosis, autoimmune diseases such as diabetes, in particular type I diabetes, psoriasis, lupus, rheumatoid arthritis, multiple sclerosis, Sjogren’s syndrome, celiac disease, vasculitis, myasthenia gravis; infection diseases such as sepsis, peritonitis; severe viral indications with severe inflammatory conditions, such as coronavirus (e.g.COVID-19), degenerative diseases; wound healing disorders,
- inflammatory diseases in particular acute
- the invention relates to any of the above defined compound of the invention, for use in the prevention and/or the treatment of a cancer, in particular solid and liquid cancers, metastatic cancers, in particular carcinoma, in particular mammary carcinoma or colon carcinoma, or colorectal cancer or lung cancer or myeloid cancer, in particular leukemia, in particular a cancer wherein cancer cells express CMKLR1 or where the microenvironment of the tumor is invaded by cells expressing or overexpressing CMKLR1.
- a cancer in particular solid and liquid cancers, metastatic cancers, in particular carcinoma, in particular mammary carcinoma or colon carcinoma, or colorectal cancer or lung cancer or myeloid cancer, in particular leukemia, in particular a cancer wherein cancer cells express CMKLR1 or where the microenvironment of the tumor is invaded by cells expressing or overexpressing CMKLR1.
- the antibody of the invention elicits at least one of the following effect in favor of resolution in vitro and/or in vivo : increases the apoptosis of polymorphonuclear neutrophils, referenced herein under the acronym PMN or PM Ns, on the inflammation site; such an effect is illustrated in the examples of the invention.
- the regulation of apoptosis of neutrophils is crucial for therapeutic intervention in inflammatory related-diseases.
- the use of an agonist of CMKLR1 having Resolvin El- like capability antibody on PM Ns induces a strong apoptosis of neutrophils, as compared to a control antibody, during the inflammation induction.
- apoptosis is enhanced or induced when the expression of caspase-3 is over 1-log, more preferably 2-log, and most preferably 3-log, after 11 hours of treatment with an agonist of CMKLR1 having Resolvin E1 -like capability antibody as compared to a negative control; a method is disclosed in the examples of the invention; reduces or inhibits transmigration through endothelium of PMNs (neutrophils) towards the site of inflammation; preventing them to relocate to the site of inflammation, and exert their pro-inflammation effects.
- the migration and transmigration of neutrophils is prevented or reduced by the administration of an agonist of CMKLR1 having Resolvin E1 -like capability lgG1 antibody.
- the Agonist of CMKLR1 having Resolvin E1 -like capability is a humanized antibody with human constant regions derived or issued from human lgG1.
- the Agonist of CMKLR1 having Resolvin E1 -like capability antibody is of the human lgG1 isotype, i.e. the constant fragment of the heavy chain and of the light chain are derived or issued from a human lgG1 antibody constant heavy chain and light chain fragment.
- the agonist of CMKLR1 having Resolvin E1 -like capability antibody of the present invention comprises a Fc domain of lgG1 isotype.
- Transmigration of neutrophils may be assessed by the method disclosed in the examples of the invention; it may be considered that a neutrophil has a reduced migration and/or transmigration capability when the cell surface expression of
- CD62L is reduced by at least 1-log in a staining experiment, as compared to a negative control.
- the inventors found that agonist of CMKLR1 having Resolvin El- like capability humanized lgG1 antibodies of the invention does not exhibit cytotoxicity in vivo ⁇ in other words, the use of the agonist of CMKLR1 does not exhibit a significant depletion of CMKLR1 -positive cells in vivo.
- the use of the agonist of the invention does not exhibit a cytotoxic activity on CMKLRI-positive cells; decreases the cell surface expression of CMKLR1, and CXCR4 and/or CCR7.
- the cell surface expression is considered on macrophages and/or dendritic cells.
- CMKLR1 having Resolvin E1 capability binds to its target
- CMKLR1 and CXCR4 and/or CCR7 hand are heterodimerized and internalized.
- the antibody of the invention does induce the internalization and/or inhibit the expression of CMLKLR1 and/or CXCR4 and/or CCR7 at the cell surface of CMKLRI-positive cells.
- CMLKLR1, and CXCR4 and/or CCR7 in cells incubated in the presence of the antibody is reduced, or is significantly reduced, relatively to cell surface expression in cells incubated in otherwise identical conditions, but in the absence of the Agonist of CMKLR1 having Resolvin E1 -like capability.
- the invention relates to humanized anti-Chemerin Like Receptor 1 (CMKLR1) antibody or an antigen-binding fragment thereof suitable for the production in mammalian cells such as COS or CHO cells with a yield over 0.1 mg/ml, in particular over 1 mg/ml, in particular over 10 mg/ml, and more particularly over 100 mg/ml, wherein: a) the Variable Heavy (VH) domain comprises the amino acid sequence of the frameworks (FR1 , FR2, FR3 and FR4) of a Heavy Chain variable domain wherein each framework harbors a sequence identity respectively with the framework of the same rank in the sequence of SEQ ID No.
- VH Variable Heavy
- the Variable Light (VL) domain comprises the amino acid sequence of the frameworks (FR1, FR2, FR3 and FR4) of a Light Chain Variable domain wherein each framework harbors a sequence identity respectively with the framework of the same rank in the sequence of SEQ ID No.50 that is at least 60 % for FR1 , at least 70 % for FR2, at least 75 % for FR3 and at least 80 % for FR4; and more particularly of 100% for FR1, at least 90 % for FR2, at least 90% for FR3 and 100 % for FR4.
- the humanized anti-CMKLR1 antibody or antigen binding fragment thereof specifically binds to the third extra-cellular loop (EL3) of CMKLR1, in particular wherein the antibody or antigen-binding fragment thereof binds specifically to a polypeptide comprising amino acid sequence SEQ ID No: 2 or SEQ ID No. 59 or located within amino acid sequence SEQ ID No 60.
- EL3 extra-cellular loop
- This embodiment may lead to ease the production of antibodies (or antigen-binding fragment thereof) in vitro. It should be noted that this definition of the antibody is independent from any other definition of the anti- CMKLR1 antibody of the invention, including the definition of antibodies by CDR domains.
- the definition of the antibody of the invention by FR sequences may be combined by a definition with CDR domains and/or functional features.
- such an antibody which may or may not exhibit identity to the framework domains as disclosed herein, comprises at least one, in particular six, of the following CDRs: a VHCDR1 selected from the group consisting of SEQ ID No.3, SEQ ID No. 4, SEQ ID No. 5, SEQ ID No. 6 and SEQ ID No. 7; and/or - a VHCDR2 selected from the group consisting of SEQ ID No 9, SEQ ID No. 10,
- VL Variable Light domain
- SEQ ID No. 19 SEQ ID No. 20, SEQ ID No. 21, SEQ ID No. 22 and SEQ ID No. 23; and/or a VLCDR2 selected from the group consisting of SEQ ID No. 24, SEQ ID No. 25, SEQ ID No. 26, SEQ ID No. 27, SEQ ID No. 28, SEQ ID No. 29, SEQ ID No. 30, SEQ ID No. 31, SEQ ID No. 32 and SEQ ID No. 33; and/or a VLCDR3 selected from the group consisting of SEQ ID No. 34, SEQ ID No. 35 and SEQ ID No. 36.
- At least one of the framework domains HFR1, HFR2, HFR3, HFR4, LFR1, LFR2, LFR3 and LFR4 is selected from the following groups: for VHFRI of SEQ ID No. 65; for VHFR2 of SEQ ID No. 66, SEQ ID No. 67 or SEQ ID NO. 68; for VHFR3 of SEQ ID No. 69 or SEQ ID No. 70; for VHFR4 of SEQ ID No: 71; for VLFR1 of SEQ ID No. 72; for VLFR2 of SEQ ID No. 73 or SEQ ID No. 74; for VLFR3 of SEQ ID No. 75 or SEQ ID No. 76 for VLFR4 of SEQ I D No. 77.
- the antibody or antigen-binding fragment thereof has the amino acid sequence of the heavy chain variable domain selected from the group of SEQ ID No: 41, SEQ ID No: 38 SEQ ID No: 42, SEQ ID No: 43 and the amino acid sequence of the light chain variable domain is the sequence of SEQ ID No: 50.
- said antibody or antigen-binding fragment thereof comprises the following frameworks domains: - VHFR1 of SEQ ID NO: 65
- said antibody comprises the following frameworks domains: - VHFR1 of SEQ ID NO: 65
- VHCDR1 selected from the group consisting of SEQ ID No.3, SEQ ID No. 4, SEQ ID No. 5, SEQ ID No. 6 and SEQ ID No. 7; and/or a VHCDR2 selected from the group consisting of SEQ ID No 9, SEQ ID No. 10,
- VL domain comprises: a VLCDR1 selected from the group consisting of SEQ ID No. 17, SEQ ID No. 18, SEQ ID No. 19, SEQ ID No. 20, SEQ ID No. 21, SEQ ID No. 22 and SEQ ID No.
- VLCDR2 selected from the group consisting of SEQ ID No. 24, SEQ ID No. 25, SEQ ID No. 26, SEQ ID No. 27, SEQ ID No. 28, SEQ ID No. 29, SEQ ID No. 30, SEQ ID No. 31, SEQ ID No. 32 and SEQ ID No. 33; and/or - a VLCDR3 selected from the group consisting of SEQ ID No. 34, SEQ ID No.
- This embodiment may lead to ease the production of antibodies (or antigen-binding fragment thereof) in vitro.
- the invention particularly relates to humanized anti-CMKLR1 antibody or an antigen- binding fragment thereof optimized to reduce immunogenicity while maintaining high binding activity and stability and biological functions, said antibody or antigen-binding fragment thereof comprises the following CDRs:
- said antibody or an antigen-binding fragment thereof whose CDRs sequences are SEQ ID NO: 4, 12, 13, 19, 26 and 35 comprises the following frameworks domains:
- the present disclosure particularly relates to an antibody anti-CMKLR1 or an antigen binding fragment thereof optimized to reduce immunogenicity while maintaining high binding activity and stability and biological functions which is suitable for in vitro production.
- the antibody anti-CMKLR1 or an antigen-binding according to the previous paragraph has the amino acid sequence of the heavy chain variable domain of SEQ ID No: 91 , and the amino acid sequence of the light chain variable domain is the sequence of SEQ ID No: 93.
- said antibody is advantageously characterized in that its Fc fragment is characteristic of an lgG1.
- the antibodies of the invention may be characterized by the amino acid sequence of framework domains as disclosed above and further characterized by the amino acid sequence of at least one of their CDR domains.
- the humanized anti- CMKLR1 antibody or an antigen binding fragment thereof according to this embodiment harbors a Heavy Chain variable domain VHCDR2 comprising or consisting of an amino acid sequence selected from the group consisting of SEQ ID No 9, SEQ ID No. 10, SEQ ID No. 11, SEQ ID No. 12, SEQ 61 , SEQ ID No. 63 and SEQ ID No. 64.
- an antibody or antigen-binding fragment thereof which comprises: a) an antibody heavy chain variable (VH) domain comprising the three CDRs VHCDR1, VHCDR2 and VHCDR3, wherein:
- VHCDR1 is selected from the group consisting of SEQ ID No.3, SEQ ID No. 4, SEQ ID No. 5, SEQ ID No. 6 and SEQ ID No. 7;
- - VHCDR2 is selected from the group consisting of SEQ ID No. 9, SEQ ID No. 10,
- VHCDR2 corresponds to the amino acid residues of SEQ ID No. 12 with the proviso that VHCDR1 is not SEQ ID No. 4;
- VHCDR3 is selected from the group consisting of SEQ ID No. 13, SEQ ID No. 14, SEQ ID No. 15 and SEQ ID No. 16; b) an antibody light chain variable (VL) domain comprising the three CDRs VLCDR1, VLCDR2 and VLCDR3, wherein:
- VLCDR1 is selected from the group consisting of SEQ ID No. 17, SEQ ID No. 18, SEQ ID No. 19, SEQ ID No. 20, SEQ ID No. 21, SEQ ID No. 22 and SEQ ID No. 23;
- - VLCDR2 is selected from the group consisting of SEQ ID No. 24, SEQ ID No. 25,
- SEQ ID No. 26 SEQ ID No. 27, SEQ ID No. 28, SEQ ID No. 29, SEQ ID No. 30, SEQ ID No. 31, SEQ ID No. 32 and SEQ ID No. 33;
- VLCDR3 is selected from the group consisting of SEQ ID No. 34, SEQ ID No. 35 and SEQ ID No. 36; for the preventive or the therapeutic treatment of: an inflammatory disease, in particular acute inflammatory diseases, chronic inflammatory diseases such as chronic inflammatory pulmonary diseases (e.g.
- asthma chronic respiratory disease
- keratoconjunctivitis periodontal disease
- eczema inflammatory bowel disease, in particular Crohn’s disease or colitis, in particular ulcerative colitis or spontaneous colitis
- cystic fibrosis NASH (Nonalcoholic steatohepatitis), hepatic fibrosis, lung fibrosis, anti -neutrophil cytoplasm antibodies-related disease (ANCA), vasculitis, in particular ANCA mediated vasculitis, scleroderma, in particular wherein, as a result of the administration of the treatment, the resolution of inflammation is enhanced; an autoimmune disease such as diabetes, in particular type I diabetes, psoriasis, lupus, rheumatoid arthritis, multiple sclerosis, Sjogren’s syndrome, celiac disease, vasculitis, myasthenia gravis, or an infection disease such as sepsis, peritonitis, degenerative diseases, wound healing disorders or dry eye syndrome,
- an antibody or antigen binding fragment thereof which comprises: a) an antibody heavy chain variable (VH) domain comprising the three CDRs VHCDR1, VHCDR2 and VHCDR3, wherein:
- VHCDR1 is selected from the group consisting of SEQ ID No.3, SEQ ID No. 4, SEQ ID No. 4, SEQ ID No. 4, SEQ ID No. 4, SEQ ID No. 4, SEQ ID No. 4, SEQ ID No. 4, SEQ ID No. 4, SEQ ID No. 4, SEQ ID No. 4, SEQ ID No. 4, SEQ ID No. 4, SEQ ID No. 4, SEQ ID No. 4, SEQ ID No. 4, SEQ ID No. 4, SEQ ID No. 4, SEQ ID No. 4, SEQ ID No. 4, SEQ ID No. 4, SEQ ID No. 4, SEQ ID No. 4, SEQ ID No. 4, SEQ ID No. 4, SEQ ID No. 4, SEQ ID No. 4, SEQ ID No. 4, SEQ ID No. 4, SEQ ID No. 4, SEQ ID No. 4, SEQ ID No. 4, SEQ ID No. 4, SEQ ID No. 4, SEQ ID No. 4, SEQ ID No. 4, SEQ ID No. 4, SEQ ID No. 4, SEQ ID No. 4, SEQ ID No. 4, SEQ
- VHCDR2 is selected from the group consisting of SEQ ID No. 9, SEQ ID No. 10, SEQ ID No. 11 and SEQ 61; when VHCDR1 is SEQ ID No. 3 or SEQ ID No. 4 and VHCDR2 corresponds to the amino sequence of SEQ ID NO: 12, said heavy chain variable (VH) domain does not comprise a framework VHFR3 of SEQ ID No. 70, preferably with the proviso that said heavy chain variable (VH) domain comprises a framework FR3 of SEQ ID NO: 69, - VHCDR3 is selected from the group consisting of SEQ ID No. 13, SEQ ID No. 14,
- VL antibody light chain variable
- VLCDR1 is selected from the group consisting of SEQ ID No. 17, SEQ ID No. 18, SEQ ID No. 19, SEQ ID No. 20, SEQ ID No. 21, SEQ ID No. 22 and SEQ ID No. 23;
- VLCDR2 is selected from the group consisting of SEQ ID No. 24, SEQ ID No. 25, SEQ ID No. 26, SEQ ID No. 27, SEQ ID No. 28, SEQ ID No. 29, SEQ ID No. 30, SEQ ID No. 31, SEQ ID No. 32 and SEQ ID No. 33;
- VLCDR3 is selected from the group consisting of SEQ ID No. 34, SEQ ID No. 35 and SEQ ID No. 36; for the preventive or the therapeutic treatment of the diseases as described above.
- the humanized antibody or antigen-binding fragment thereof, or antigen-binding antibody mimetic or modified antibody comprises: a) the Variable Heavy (VH) domain comprises the amino acid sequence of the frameworks (FR1, FR2, FR3 and FR4) of a Heavy Chain variable domain wherein each framework harbors a sequence identity respectively with the framework of the same rank in the sequence of SEQ ID No.
- VH Variable Heavy
- the Variable Light (VL) domain comprises the amino acid sequence of the frameworks (FR1, FR2, FR3 and FR4) of a Light Chain Variable domain wherein each framework harbors a sequence identity respectively with the framework of the same rank in the sequence of SEQ ID No.50 that is at least 60 % for FR1 , at least 70 % for FR2, at least 75 % for FR3 and at least 80 % for FR4, and more particularly of 100% for FR1, at least 90 % for FR2, at least 90% for FR3 and 100 % for FR4; for the preventive or the therapeutic treatment of: an inflammatory disease, in particular acute inflammatory diseases, chronic inflammatory diseases such as chronic inflammatory
- asthma chronic respiratory disease
- keratoconjunctivitis periodontal disease
- eczema inflammatory bowel disease, in particular Crohn’s disease or colitis, in particular ulcerative colitis or spontaneous colitis
- cystic fibrosis NASH (Nonalcoholic steatohepatitis), hepatic fibrosis, lung fibrosis, anti -neutrophil cytoplasm antibodies-related disease (ANCA), vasculitis, in particular ANCA mediated vasculitis, scleroderma, in particular wherein, as a result of the administration of the treatment, the resolution of inflammation is enhanced; an autoimmune disease such as diabetes, in particular type I diabetes, psoriasis, lupus, rheumatoid arthritis, multiple sclerosis, Sjogren’s syndrome, celiac disease, vasculitis, myasthenia gravis, or an infection disease such as sepsis, peritonitis, degenerative diseases, wound healing disorders, severe viral indications
- CMKLR1 in particular wherein, as a result of the administration of the treatment, the resolution of inflammation is enhanced.
- the antibody comprises the following frameworks domains,
- VLFR4 of SEQ ID NO: 77, and comprises the following CDRs:
- VHCDR1 is selected from the group consisting of SEQ ID No.3, SEQ ID No. 4, SEQ ID No. 5, SEQ ID No. 6 and SEQ ID No. 7; and/or - VHCDR2 is selected from the group consisting of SEQ ID No. 9, SEQ ID No. 10,
- VHCDR3 is selected from the group consisting of SEQ ID No. 13, SEQ ID No. 14, SEQ ID No. 15 and SEQ ID No. 16; and wherein the Variable Light (VL) domain comprises: - a VLCDR1 is selected from the group consisting of SEQ ID No. 17, SEQ ID No. 18,
- VLCDR2 is selected from the group consisting of SEQ ID No. 24, SEQ ID No. 25, SEQ ID No. 26, SEQ ID No. 27, SEQ ID No. 28, SEQ ID No. 29, SEQ ID No. 30, SEQ ID No. 31 , SEQ ID No. 32 and SEQ ID No. 33; and/or
- VLCDR3 is selected from the group consisting of SEQ ID No. 34, SEQ ID No. 35 and SEQ ID No. 36 and is for use in the preventive or therapeutic treatment of: an inflammatory disease, in particular acute inflammatory diseases, chronic inflammatory diseases such as chronic inflammatory pulmonary diseases (e.g.
- asthma chronic respiratory disease
- keratoconjunctivitis periodontal disease
- eczema inflammatory bowel disease, in particular Crohn’s disease or colitis, in particular ulcerative colitis or spontaneous colitis
- cystic fibrosis NASH (Nonalcoholic steatohepatitis), hepatic fibrosis, lung fibrosis, anti -neutrophil cytoplasm antibodies-related disease (ANCA), vasculitis, in particular ANCA mediated vasculitis, scleroderma, in particular wherein, as a result of the administration of the treatment, the resolution of inflammation is enhanced;
- an autoimmune disease such as diabetes, in particular type I diabetes, psoriasis, lupus, rheumatoid arthritis, multiple sclerosis, Sjogren’s syndrome, celiac disease, vasculitis, myasthenia gravis, or an infection disease such as sepsis, peritonitis, degenerative diseases, wound healing disorders, severe viral
- Such particular antibody or antigen-binding fragment thereof for the preventive or therapeutic treatment of one of the conditions disclosed above is particular characterized in that it comprises the following CDRs: VHCDR1 of SEQ ID NO: 4, VHCDR2 of SEQ ID NO: 12, VHCDR3 of SEQ ID NO: 13 and, VLCDR1 of SEQ ID NO: 19, VLCDR2 of SEQ ID NO: 26, VLCDR3 of SEQ ID NO: 35 and the following frameworks VHFR1 of SEQ ID NO: 65, VHFR2 of SEQ ID NO: 67, VHFR3 of SEQ ID NO: 69, VHFR4 of SEQ ID NO: 71, VLFR1 of SEQ ID NO: 72, VLFR2 of SEQ ID NO: 73, VLFR3 of SEQ ID NO: 76, VLFR4 of SEQ ID NO: 77.
- the amino acid sequence of the heavy chain variable domain of the antibody comprises or consists of SEQ ID NO: 91 and the amino acid sequence of the light chain variable domain of the antibody comprises or consists of SEQ ID NO: 93.
- the invention relates to a composition comprising an anti-CMKLR1 compound as described herein, in particular a pharmaceutical composition comprising an anti-CMKLR1 compound according to the invention and a further therapeutic agent, or pharmaceutical acceptable carrier.
- the invention relates to a composition
- a composition comprising an anti-CMKLR1 compound according to the invention and a therapeutic agent selected from the group consisting of immunomodulatory agent, immune checkpoint blocker, immune checkpoint activator, antibody, or anti-SIRPa antibody (P84 - anti-mouse SIRPa from Merck Millipore).
- the invention relates to a combination of compounds comprising an anti-CMKLR1 compound as described herein, in particular a pharmaceutical composition comprising an anti-CMKLR1 compound according to the invention and an anti-PD1 or an anti-PDL1 compound, in particular an anti-PD1 compound; such a compound is in particular selected from the group consisting of an antibody, an antigen-binding antibody fragment, an antigen-binding antibody mimetic, a small molecule like an aptamer or a peptide, a modified antibody, like but not limited to a humanized or a chimeric antibody, able to bind to PD1 or PDL1.
- the invention relates to a combination of compounds comprising an anti-CMKLR1 compound as described herein, in particular a pharmaceutical composition comprising an anti-CMKLR1 compound according to the invention and an anti-SIRPa compound; such a compound is in particular selected from the group consisting of an antibody, an antigen-binding antibody fragment, an antigen-binding antibody mimetic, a small molecule like an aptamer or a peptide, a modified antibody, like but not limited to a humanized or a chimeric antibody, able to bind to SIRPa, in particular human SIRPa.
- the invention also relates to a combination, for instance for fibrosis treatment, comprising a therapeutic compound, which is or not a cytokine, and which stimulates pro resolution macrophages.
- the invention concerns the therapeutic use of the anti-CMKLR1 compound of the invention, especially for inducing and/or enhancing the resolution of inflammation, in particular for inducing and/or enhancing the resolution of inflammation when said resolution is delayed or disrupted, in view of treating diseases wherein the extension of the inflammation is pathologic, or wherein the duration of the resolution of inflammation is pathologic.
- the anti-CMKLR1 compound binds CMKLR1 with an affinity (KD value) of at least 10E-8 M, more preferably with an affinity of at least 10E-9 M.
- affinity KD value
- “Appreciable affinity” includes binding with an affinity of about 10 8 M (KD) or stronger.
- binding is considered specific when the binding affinity is between 10 8 M and 10 12 M, optionally between 10 9 M and 10 1 ° M, in particular at least 10 9 M.
- a binding domain specifically reacts with or binds to a target can be tested readily by, inter alia, comparing the reaction of said binding domain with a target protein or antigen with the reaction of said binding domain with proteins or antigens other than the target protein.
- Such an antibody of the invention specifically binds CMKLR1 and has an agonist effect towards the interaction between RvE1 and CMKLR1.
- the anti-CMKLR1 compound binds specifically to an epitope localized within the third extra-loop of CMKLR1, in particular to an epitope localized within amino acid residue sequences set forth in SEQ ID No: 2 or SEQ ID No: 59 or SEQ ID No. 60, in particular SEQ ID No: 2.
- An anti-CMKLR1 compound binding within this particular region of CMKLR1 may have an agonist property on CMKLR1 , thereby mimicking the binding of RvE1 to CMKLR1.
- the invention relates to an anti-CMKLR1 antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic or modified antibody as defined here above, which has an agonist capability towards the interaction between RvE1 and CMKLR1, for use as a medicament.
- the invention relates to an anti-CMKLR1 antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic or modified antibody as defined here above, which has the capability to induce the activation of Akt and/or Erk protein(s) in vitro and/or in vivo.
- the activation of these proteins may be assessed by the methods described in the examples of the present invention.
- the anti-CMKLR1 antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic or modified antibody has the capability to activate either Akt and/or Erk protein, or both, in macrophages, in particular in human macrophages.
- the present invention also relates to a method of treatment in a subject in need thereof comprising administering to said subject an effective amount of an anti-CMKLR1 antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic as defined above, which has an agonist capability towards the interaction between RvE1 and CMKLR1, or in other words which is an RvE1-agonist like factor or modulator.
- Modifying the polarization of macrophages to favour anti-inflammatory cells can be useful in a number of pathologies or situations. As described above, this modification is particularly useful in the context of a disease selected from the group of inflammatory diseases, including but not limited to acute inflammatory diseases and chronic inflammatory diseases, inflammatory bowel disease, Crohn’s disease, asthma, keratoconjunctivitis, periodontal disease, eczema, colitis, in particular ulcerative colitis or spontaneous colitis, cystic fibrosis; diabetes, in particular type I diabetes, peritonitis, psoriasis, carcinoma, in particular mammary carcinoma or colon carcinoma, cancers, metastatic cancers, lung cancer, degenerative disease, infection disease, in particular sepsis, autoimmune diseases, NASH, scleroderma, colitis or Crohn’s disease in a subject that is refractory to corticosteroids and/or immunosuppressive treatment.
- inflammatory diseases including but not limited to acute inflammatory diseases and chronic inflammatory diseases
- the present invention also relates to the use of an anti-CMKLR1 antibody or antigen- binding fragment thereof or antigen-binding antibody mimetic as defined above, which has a Resolvin E1 -like agonist capability, in the manufacture of a medicament.
- the invention relates to an anti-CMKLR1 antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic or modified antibody, like but not limited to humanized or chimeric antibody, as defined here above, for its use in the treatment of a chronic inflammatory disease, in particular for treating chronic colitis.
- the invention relates to an anti-CMKLR1 antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic as defined above, which has an agonist activity towards the interaction of CMKLR1 for use in the treatment of a delayed or disrupted resolution of an inflammatory condition, in particular an inflammatory disease wherein its resolution is delayed or disrupted, and/or in the treatment or the prevention of a disease selected from the group of inflammatory diseases, including but not limited to acute inflammatory diseases and chronic inflammatory diseases, inflammatory bowel disease, Crohn’s disease, asthma, keratoconjunctivitis, periodontal disease, eczema, colitis, in particular ulcerative colitis or spontaneous colitis, cystic fibrosis, diabetes, in particular type I diabetes, peritonitis, psoriasis, carcinoma, in particular mammary carcinoma or colon carcinoma, cancers, degenerative disease, infection disease, in particular sepsis, autoimmune diseases.
- a disease selected from the group of inflammatory diseases, including but not
- a delay or a disruption in the resolution of an inflammatory condition occurs when the resolution of inflammation is delayed or disrupted as compared to a normal resolution (i.e. the resolution occurring in a patient who experiences physiological resolution after an inflammatory event).
- a resolution delay or defect can result in an increased penetration of granulocytes at the inflammatory site.
- a resolution delay or defect may be assessed by quantification of granulocytes at the inflammatory site.
- Granulocyte population may be measured for example by histology, cytometry or indirect biochemical techniques such as elastase quantification by enzyme immunoassay or molecular quantification by PCR of granulocyte receptor 1).
- a resolution delay or defect may also be assessed by the determination of a delay in the apoptosis of granulocytes, measured for example by cytology using specific antibodies against annexin 5.
- a defect or a delay in the resolution of the inflammation may also be determined by assessing by quantifying the synthesis of pro-inflammatory cytokines such as TNF-alpha, IL8 or IL12 and anti-inflammatory cytokines such as IL-10. Cytokine secretion may be assessed by enzyme immunoassay or by PCR.
- a defect or a delay in the resolution of the inflammation may also be determined by assessing the activation of transcription factors involved in the synthesis of inflammatory cytokines, such as NF-kappaB which can be measured for example by nuclear translocation or by Western blot and/or by quantification of the level of degradation of IkappaB).
- a defect or a delay in the resolution of the inflammation may also be determined by quantifying specialized pro-resolving mediators (such as lipoxins, resolvins, protectins or maresins) or their precursors (like 17-HDOHE or 14-HDOHE) by mass spectrometry or enzyme immunoassay.
- a defect or a delay of the resolution then results in a defect of the synthesis of one or more of these mediators.
- a resolution defect or delay can also be determined when expression of the receptors of the resolution molecules is decreased.
- These receptors may be selected from the group comprising ALX, CMK1R1, GPR32 or GPR18.
- the internalization and processing of those receptors into the cytoplasm may also be assessed.
- expression of some receptors of inflammatory cytokines or lipids may also be assessed, an overexpression compared to a normal condition being significant of a delay or a defect in the resolution of the inflammation. These conditions may be measured by histology, cytology or PCR.
- the resolution defect can also result in a decreased or inhibited switch of pro-inflammatory to pro-resolutive macrophages, a damage in phagocytosis or efferocytosis of the same cells.
- a delay or a defect of the resolution may be assessed by analyzing the switch of pro-inflammatory to pro- resolutive macrophages in a particular condition as compared to a normal condition, as exemplified in the examples of the present invention.
- anti-CMKLR1 compound can be used to treat an individual who has a cancer selected from the group consisting of mammary cancer, in particular mammary carcinoma cancer, melanoma, colon cancer, in particular colon carcinoma cancer, leukemia, in particular acuter myeloid leukemia, in particular when cancer cells over-express CMKLR1.
- mammary cancer in particular mammary carcinoma cancer, melanoma, colon cancer, in particular colon carcinoma cancer, leukemia, in particular acuter myeloid leukemia, in particular when cancer cells over-express CMKLR1.
- the invention relates to an anti-human CMKLR1 antibody or antigen binding fragment thereof or antigen-binding antibody mimetic or modified antibody as defined above, for its uses as defined above, wherein said anti-human CMKLR1 antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic or modified antibody of the invention is administered to a patient presenting a CMKLRI-positive tumor.
- the antibody or antigen-binding fragment thereof of the invention can be administered in a variety of suitable routes, e.g., intravenously (IV), subcutaneously (SC), or, intramuscularly (IM) to the subject.
- the anti-CMKLR1 compound can be administered alone or in combination with another therapeutic agent, e.g., a second human monoclonal antibody or antigen binding fragment thereof.
- the antibody is administered together with another agent, for example, an immunosuppressive agent, an erythropoiesis-stimulating agent (ESA), in combination with therapeutic cell compositions, and the like.
- the invention relates to an anti-CMKLR1 compound or antigen-binding fragment thereof or antigen-binding antibody mimetic for its use as defined above, wherein the anti-CMKLR1 antibody or antigen-binding fragment is combined with a second therapeutic agent.
- the administration of the second therapeutic agent can be simultaneous or not with the administration of the anti-CMKLR1 compound.
- a co-administration can be prepared in the form of a combination drug (product), also known as a “combo”.
- a combo is a fixed-dose combination that includes two or more active pharmaceutical ingredients combined in a single dosage form, which is manufactured and distributed in fixed doses. But the dose regimen and/or the administration route can also differ.
- this second therapeutic agent is selected from the group consisting of chemotherapeutic agents, radiotherapy agents, immunotherapeutic agents, cell therapy agents (such as CAR-T cells), antibiotics and probiotics.
- immunotherapeutic agents useful in the context of the invention are selected from the group consisting of therapeutic vaccines (DNA, RNA or peptide vaccines), immune checkpoint blockers or activators, in particular of adaptive immune cells (T or B lymphocytes) or immunoconjugates such as antibody-drug conjugates.
- therapeutic vaccines DNA, RNA or peptide vaccines
- immune checkpoint blockers or activators in particular of adaptive immune cells (T or B lymphocytes) or immunoconjugates such as antibody-drug conjugates.
- T or B lymphocytes adaptive immune cells
- immunoconjugates such as antibody-drug conjugates.
- immunotherapeutic agents refers in particular to agents that could take cancer vaccines from interesting biological phenomena to effective therapeutic agents including: T-cell growth factors to increase number and repertoire of naive T cells, growth factors to increase the number of dendritic cells (DCs), agonists to activate DCs and other antigen-presenting cells (APCs), adjuvants to allow and augment cancer vaccines, agonists to activate and stimulate T cells, inhibitors of T-cell checkpoint blockade, T-cell growth factors to increase the growth and survival of immune T cells, agents to inhibit, block, or neutralize cancer cell and immune cell-derived immunosuppressive cytokine.
- T-cell growth factors to increase number and repertoire of naive T cells
- DCs dendritic cells
- APCs antigen-presenting cells
- adjuvants to allow and augment cancer vaccines
- agonists to activate and stimulate T cells inhibitors of T-cell checkpoint blockade
- T-cell growth factors to increase the growth and survival of immune T cells
- immune checkpoint blocker or activator are known in the art.
- immune checkpoint blockers or activators of adaptive immune cells that could be useful are anti-PDL1, anti-PD1, anti-CTLA4, anti- SIRPa; anti-CD137, anti-CD2, anti-CD28, anti-CD40, anti-HVEM, anti-BTLA, anti-CD160, anti-TIGIT, anti-TIM-1/3, anti-LAG-3, anti-2B4, and anti-OX40, anti-CD40 agonist, CD40- L, TLR agonists, anti-ICOS, ICOS-L and B-cell receptor agonists, in particular anti-CD137 and anti-SIRPa.
- the second therapeutic agent is an anti-PDL1 or an anti-PD1 compound, in particular an anti-PD1 compound, and more particularly an anti-PD1 antibody.
- the second therapeutic agent is an anti-SIRPa compound, in particular an anti-SIRPa antibody
- Said immunotherapeutic agent can also be an antibody targeting tumoral antigen, particularly selected from the group consisting of anti-Her2, anti-EGFR, anti-CD20, anti- CD19, anti-CD52.
- the antibody may be provided at an effective dose from about 1 ng/kg body weight to about 30 mg/kg body weight, or more.
- the dosage may range from 1 pg/kg to about 20 mg/kg, optionally from 10 pg/kg up to 10 mg/kg or from 100 pg/kg up to 5 mg/kg.
- the term “effective dose” or “effective dosage” or “effective amount” is defined as an amount sufficient to achieve or at least partially achieve the desired effect.
- the term “effective dose” is meant to encompass an amount sufficient to cure or at least partially arrest the disease and its complications or alleviate the symptoms of the disease in a patient already suffering from the disease.
- Amounts or doses effective for this use will depend on the condition to be treated, the delivered antibody construct, the therapeutic context and objectives, the severity of the disease, prior therapy, the patient's clinical history and response to the therapeutic agent, the route of administration, the size (body weight, body surface or organ size) and/or condition (the age and general health) of the patient, and the general state of the patient's own immune system.
- the proper dose can be adjusted such that it can be administered to the patient once or over a series of administrations, and in order to obtain the optimal therapeutic effect.
- Dosing for such purposes may be repeated as required, e.g. daily, semi-weekly, weekly, semi-monthly, monthly, or as required during relapses.
- the invention relates to a pharmaceutical composition
- a pharmaceutical composition comprising an antibody or antigen-binding fragment thereof as defined above and a pharmaceutically acceptable carrier.
- a pharmaceutical composition is meant to encompass a composition suitable for administration to a subject or patient, such as a mammal, especially a human.
- a “pharmaceutical composition” is sterile and is usually free of contaminants that are capable of eliciting an undesirable response within the subject (e.g. the compound(s) in the pharmaceutical composition is pharmaceutical grade).
- Pharmaceutical compositions can be designed for administration to subjects or patients in need thereof via a number of different routes of administration including oral, buccal, rectal, parenteral, intraperitoneal, intradermal, intratracheal and the like.
- a "pharmaceutically acceptable carrier” is meant to encompass an excipient, diluent, carrier, and adjuvant that are useful in preparing a pharmaceutical composition that are generally safe, non-toxic and neither biologically nor otherwise undesirable, and include an excipient, diluent, carrier, and adjuvant that are acceptable for veterinary use as well as human pharmaceutical use.
- “A pharmaceutically acceptable carrier” as used herein includes both one and more than one such excipient, diluent, carrier, and adjuvant.
- the invention relates to a pharmaceutical composition which comprises as an active ingredient an antibody or antigen-binding fragment thereof as defined above and a pharmaceutically acceptable carrier.
- the invention relates to a therapeutic means, in particular a combination product means, which comprises as active ingredients: an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic as defined above and a second therapeutic agent, wherein said active ingredients are formulated for separate, sequential or combined therapy, in particular for combined or sequential use.
- a combination product comprising an anti-CMKLR1 compound as defined above and a second therapeutic agent for simultaneous, separate or sequential use a medicament.
- the invention relates to a combination product as defined above, wherein the second therapeutic agent is selected from the group consisting of chemotherapeutic agents, radiotherapy agents, cell therapy agents, immunotherapeutic agents, antibiotics and probiotics.
- the invention relates to a combination product as defined above, wherein said immunotherapeutic agent is selected from the group consisting of therapeutic vaccines, immune checkpoint blockers or activators, in particular of adaptive immune cells (T and B lymphocytes) and antibody-drug conjugates.
- said immunotherapeutic agent is selected from the group consisting of therapeutic vaccines, immune checkpoint blockers or activators, in particular of adaptive immune cells (T and B lymphocytes) and antibody-drug conjugates.
- the invention relates to a combination product as defined above, wherein said immune checkpoint blocker or activator of adaptive immune cells (T and B lymphocytes) is selected from the group consisting of anti-PDL1, anti-PD1, anti-SIRPA, anti-CTLA4, anti-CD137, anti-CD2, anti-CD28, anti-CD40, anti-HVEM, anti-BTLA, anti- CD160, anti-TIGIT, anti-TIM-1/3, anti-LAG-3, anti-2B4, and anti-OX40, anti-CD40 agonist, CD40-L, TLR agonists, antMCOS, ICOS-L and B-cell receptor agonists, in particular selected from the group consisting of anti-PDL1, anti-PD1 and anti-CD137.
- T and B lymphocytes is selected from the group consisting of anti-PDL1, anti-PD1, anti-SIRPA, anti-CTLA4, anti-CD137, anti-CD2, anti-CD28, anti-CD40, anti-HVEM, anti-BTLA
- the second therapeutic agent is an anti-PDL1 or an anti-PD1 compound, in particular an anti-PD1 compound, and more particularly an anti-PD1 antibody.
- the second therapeutic agent is an anti-SIRPa compound, in particular an anti-SIRPa antibody.
- said immunotherapeutic agent is an antibody targeting tumoral antigen, particularly selected from the group consisting of anti-Her2, anti-EGFR, anti- CD20, anti-CD19, anti-CD52.
- the invention relates to a combination product as defined above, for simultaneous, separate or sequential use in the treatment of any condition susceptible of being improved or prevented by modifying macrophage polarization to proresolutive macrophages.
- the invention relates to a method of treatment of any condition susceptible of being improved or prevented by modifying macrophage polarization to proresolutive macrophages in a subject in need thereof comprising administering simultaneously, separately or sequentially to said subject an effective amount of a combination product as defined above.
- the invention relates to the use of a combination product as defined above in the manufacture of a medicament for the treatment of any condition susceptible of inducing proresolutive4nflammatory macrophages.
- a combination product as defined above for simultaneous, separate or sequential use in the treatment of a pathology selected from the group consisting of inflammatory diseases, including but not limited to acute inflammatory diseases and chronic inflammatory diseases, inflammatory bowel disease, Crohn’s disease, NASH, scleroderma, asthma, keratoconjunctivitis, periodontal disease, eczema, colitis, in particular ulcerative colitis or spontaneous colitis, cystic fibrosis, diabetes, in particular type I diabetes, peritonitis, psoriasis, carcinoma, in particular mammary carcinoma or colon carcinoma, cancers, metastatic cancers, lung cancer, degenerative disease, infection disease, in particular sepsis, autoimmune diseases or for use in vaccination.
- inflammatory diseases including but not limited to acute inflammatory diseases and chronic inflammatory diseases,
- the invention relates to a method of treatment of a pathology selected from the group of inflammatory diseases, including but not limited to acute inflammatory diseases and chronic inflammatory diseases, inflammatory bowel disease, Crohn’s disease, NASH, scleroderma, asthma, keratoconjunctivitis, periodontal disease, eczema, colitis, in particular ulcerative colitis or spontaneous colitis, cystic fibrosis, diabetes, in particular type I diabetes, peritonitis, psoriasis, carcinoma, in particular mammary carcinoma or colon carcinoma, cancers, metastatic cancers, lung cancer, degenerative disease, infection disease, in particular sepsis, autoimmune diseases of a subject in need thereof comprising administering simultaneously, separately or sequentially to said subject an effective amount of a combination product as defined above.
- inflammatory diseases including but not limited to acute inflammatory diseases and chronic inflammatory diseases, inflammatory bowel disease, Crohn’s disease, NASH, scleroderma, asthma, keratoconjunctivit
- the invention also relates to a polynucleotide encoding an anti-CMKLR1 compound as defined herein.
- the invention also relates to a nucleic acid molecule, ora group of nucleic acid molecules, more particularly an isolated nucleic acid molecule(s) and/or a recombinant a nucleic acid molecule(s), which encode(s) any anti-CMKLR1 compound according to the present disclosure, more particularly which encode(s) a heavy chain variable domain comprising or consisting of the amino acid residues of sequences set forth in SEQ ID No. 38, SEQ ID No. 39, SEQ ID No. 40 and SEQ ID No.
- a light chain variable domain comprising or consisting of the amino acid residues of sequences set forth in SEQ ID No. 49, SEQ ID No. 50, SEQ ID No. 51, SEQ ID No. 52, SEQ ID No. 53, SEQ ID No. 54, SEQ ID No. 55, SEQ ID No. 56, SEQ ID No. 57 and SEQ ID No. 58.
- the present invention relates to a nucleic acid molecule, or a group of nucleic acid molecules, more particularly an isolated nucleic acid molecule(s) and/or a recombinant a nucleic acid molecule(s), which encode(s) a heavy chain variable domain of the antibody consists of SEQ ID NO: 91 and the amino acid sequence of the light chain variable domain of the antibody consists of SEQ ID NO: 93.
- the nucleic acid molecule(s) may further comprise regulation sequences, like but not limited to enhancers, silencers, promoters, in particular expression promoters, signal peptide, for transcription and expression of the encoded heavy chain variable domain and/or the light chain variable domain.
- the invention also relates to a vector comprising the polynucleotide as disclosed herein, or comprising the nucleic acid molecule(s) as disclosed herein.
- a vector is a nucleic acid molecule used as a vehicle to transfer a genetic material into a cell, and in a preferred embodiment allows the expression of a polynucleotide inserted within the vector.
- the term vector encompasses plasmids, viruses, cosmids and artificial chromosomes.
- a vector generally comprises an origin of replication, a multicloning site, and a selectable marker.
- the vector itself is generally a nucleotide sequence, commonly a DNA sequence, that comprises an insert (transgene) and a larger sequence that serves as the "backbone" of the vector.
- Modern vectors may encompass additional features besides the transgene insert and a backbone: promoter, genetic marker, antibiotic resistance, reporter gene, targeting sequence, protein purification tag.
- Vectors called expression vectors (expression constructs) specifically are for the expression of the transgene in the target cell, and generally have control sequences.
- the invention relates to a cell, an isolated cell, a host cell, an isolated host cell, or a cell line comprising a vector as defined above.
- these terms related to cells are intended to include any individual cell or cell culture that can be or has been recipient of vectors, exogenous nucleic acid molecules, and polynucleotides encoding the antibody construct of the present invention; and/or recipients of the antibody construct itself.
- the introduction of the respective material into the cell can be carried out by way of transformation, transfection and the like.
- These terms are also intended to include progeny or potential progeny of a single cell.
- Suitable host cells include prokaryotic or eukaryotic cells, and also include but are not limited to bacteria, yeast cells, fungi cells, plant cells, and animal cells such as insect cells and mammalian cells, e.g., murine, rat, rabbit, macaque or human.
- the cell or cell line is selected from the group consisting of CHO, COS and HEK cells, and produced at least 0.1 mg/ml, in particular at least 1 mg/ml of antibodies, in particular at least 10 mg/ml, more particularly at least 100 mg/ml, when genetically engineered with a vector comprising vectors, exogenous nucleic acid molecules, and polynucleotides encoding the antibody construct of the present invention; and/or recipients of the antibody construct itself.
- the invention concerns the use of an antibody or antigen binding fragment thereof as defined in any one of the embodiments disclosed herein, for the manufacture of a medicament.
- the invention concerns the use of an antibody or antigen binding fragment thereof as defined in any one of the embodiments disclosed herein, for the manufacture of a medicament useful for treating a condition wherein inflammation is involved.
- the invention concerns the use of an antibody or antigen binding fragment thereof as defined in any one of the embodiments disclosed herein, for the manufacture of a medicament useful for preventive or the therapeutic treatment of: an inflammatory disease, in particular acute inflammatory diseases, chronic inflammatory diseases such as chronic inflammatory pulmonary diseases (e.g.
- keratoconjunctivitis keratoconjunctivitis, periodontal disease, eczema, inflammatory bowel disease, in particular Crohn’s disease or colitis, in particular ulcerative colitis or spontaneous colitis, cystic fibrosis, NASH (Nonalcoholic steatohepatitis), scleroderma, anti-neutrophil cytoplasm antibodies-related disease ANCA associated disease, in particular wherein, as a result of the administration of the treatment, the resolution of inflammation is enhanced; an autoimmune disease such as diabetes, in particular type I diabetes, psoriasis, lupus, rheumatoid arthritis, multiple sclerosis, Sjogren’s syndrome, celiac disease, vasculitis, myasthenia gravis, or an infection disease such as sepsis, peritonitis, degenerative diseases, wound healing disorders, severe viral indications with severe inflammatory conditions, such as coronavirus (e.g.COVID-19), or dry eye syndrome
- FIG. 1 Effect of the anti-CMKLR1 variants 1G1, 2G1, 3G1 and 4G1 chimeric antibodies on the DCs maturation and differentiation.
- Mice dendritic cells were incubated during maturation phase (24h or 48h) followed by a differentiation phase with excipient or RvE1 or anti-CMKLR1 antibodies variants (mutations on positions 1 and 2 of SEQ ID No. 8, corresponding to the VH-CDR3: 1G1 (LL), 2G1 (LI), 3G1 (IL) or 4G1 (II) or isotype controls (hlgG1 or mlgG)).
- Cells were then stained for FACS analysis with cell marker antibodies: A. CD80-PE; B. CD86-FITC; C.
- FIG. 1 Effect of an anti-CMKLR1 antibody on a mice acute inflammatory colitis model induced by DSS.
- Mice were injected after 6 days of DSS induction with isotype control hlgG1 (10pg per mouse) (x), RvE1 (1pg per mouse) daily ( ⁇ ), or 2G1 antibody (10pg per mouse) three times ( ⁇ ) for 5 days. Wild type mice, not treated, are represented by an T .
- FIG. 3 Effect of an anti-CMKLR1 antibody on a mice acute inflammatory colitis model induced by TNBS.
- Mice received 200 pL of the haptenating agent TNBS at 5% in 50% ethanol on day 0 and then were injected with isotype control hlgG1 (10pg per mouse) (x), RvE1 (1pg per mouse) daily ( ⁇ ), or 2G1 antibody (10pg per mouse) three times ( ⁇ ) for 5 days, or non- treated (wild type animals) (A). Mice were sacrificed colon length was measured in each condition.
- FIG. 4 Effect of an anti-CMKLR1 antibody on a IL10 KO mice chronic inflammatory colitis model.
- Mice KO for IL10 develop a spontaneous inflammatory colitis. They were treated with an Anti-CMKLR1 antibody (2G1) ( ⁇ ) or isotype control (hlgG1) (x) intra- peritoneally (25pg/injection, 3 times a week).
- 2G1 Anti-CMKLR1 antibody
- hlgG1 isotype control intra- peritoneally (25pg/injection, 3 times a week).
- A Animal weight loss during and after treatment.
- FIG. 1 Effect of an anti-CMKLR1 antibody on a mice typel non-obese diabetes model. Mice develop spontaneous diabetes. When glycaemia was between 180 and 234 mg/dL, they were treated with anti-CMKLR1 antibody ( ⁇ in A and B, ⁇ in C) or isotype control antibody (x in A and B; ⁇ in C) intraperitoneally at 20pg/injection three times a week for 2 weeks.
- A Percentage of survival
- B individual representation of blood glucose concentration in mg/dL.
- FIG. 1 C. pooled representation of blood glucose concentration in mg/dL.
- Figure 6. Effect of anti-CMKLR1 agonist on an autoimmune disease such as mice psoriasis model. Aldara treated mice for 4 to 6 consecutive days were injected intra peritoneally with: 2G1 ( ⁇ ) or isotype control antibody (x). A. thicknesses and B weight.
- Figure 7 Effect of an anti-CMKLR1 antibody on a mice peritonitis model. Preventive injection of anti-CMKLR1 was performed before Zymosan A injection (1mg per mouse in 1mL).: RvE1 (1pg per mouse) ( ⁇ ), 2G1 antibody (10pg per mouse) ( ⁇ ) or isotype control antibody (x).
- C Resolution index.
- Figure 8 Effect of an anti-CMKLR1 antibody on a 4T1 breast tumor model. Mice were inoculated with 4T 1 cells (0,25 million) in the mammary gland. Then the anti- CMKLR1 antibody (2G1) (A. ⁇ B. ⁇ ) or an anti-41 BB antibody (3H3) ( ⁇ ) or both antibodies (A) were injected twice at day 4 and day 7 (1 Opg/injection) or a control antibody (lgG1 isotype antibody clone 3G8) (x A. and B.) was injected three time a week for three weeks. A. The tumor area was measured 8 days after tumor injection and then every 2 days. B.
- CMKLR1 on Ulcerative Colitis (UC) or Crohn’s Disease patient biopsies before and after anti-TNFa treatment
- x represents controls
- ⁇ represents CMKLR1 expression in patient responding to corticosteroids treatment and/or immunosuppression treatment before Infliximab treatment
- ⁇ represents CMKLR1 expression in patient non responding to corticosteroids treatment and/or immunosuppression treatment before Infliximab treatment
- D represents CMKLR1 expression in patient responding to corticosteroids treatment and/or immunosuppression treatment after Infliximab treatment
- ⁇ represents CMKLR1 expression in patient non-responding to corticosteroids treatment and/or immunosuppression treatment after Infliximab treatment.
- A CMKLR1 transcript expression in Ulcerative colitis patients before and after Infliximab treatment.
- B CMKLR1 transcript expression in Crohn’s Disease patients before and after Infliximab treatment in inflamed colon bio
- FIG. 11 Expression of CMKLR1 on UC patient biopsies before and after anti a4b7 (VDZ) treatment.
- A. Represents the CMKLR1 (CMKLR1) transcript expression in Ulcerative colitis patients before and after Vedolizumab treatment in inflamed colon biopsies.
- R corresponds to patient responsive to VDZ treatment
- NR corresponds to patient non- responsive to VDZ treatment.
- FIG. 12 Binding analysis of the anti-CMKLR1 antibody on a CMKLR1 peptide by ELISA.
- Figure 13 Study of CMKLR1 expression on different cell lines by FACS and western blot.
- A. The protein expression at cell surface of CMKLR1 was determined using the 2G1 antibody at different concentration (ng/ml) on two human different T cell lines Thp1 and U937.
- CMKLR1 protein expression was tested by western blot on T cell lines (Thp1 and U937), fibroblast cell line MRC5, NK cell lines NKL and negative and transduced CHO cells for CMKLR1.
- Figure 14 Expression of CMKLR1 on mice myeloid cells by FACS. After differentiation, mice myeloid lineage cells were analyzed for their CMKLR1 expression at cell surface.
- A expression on macrophage monocytes (MO).
- FIG. 15 Expression of CMKLR1 on human monocytes and mice bone marrow cells stimulated with pro-inflammatory stimuli.
- CMKLR1 ChemR23
- FIG. 16 Study of the myeloid cell activation markers after CMKLR1 pathway activation. Dendritic cells incubated in excipient, RvE1, 2G1 or isotype control (hlgG1) were then stained for FACS analysis with marker antibodies: A. CD80-PE. B. CD86-FITC. C. CD103-PerCPCy5.5. D. CD40-PeCy7. E. l/Ab-APC. Mean of Fluorescence was determined in each condition.
- FIG. 17 Study of the CMKLR1 pathway activation: Akt and Erk phosphorylation.
- the Phosphorylated protein Akt or Erk were assessed using P-Akt antibody or P-Erk antibody (p44/42).
- FIG. 19 Effect of an anti-CMKLR1 antibody in the CD45Rb h,gh T-cell transfer chronic colitis mouse model.
- C Anatomic pathology scores used to calculate the severity of the pathology and the inflammation (inflammation score, vasculutis score, colon thickness and fibrotic colon wall).
- FIG 20 Effect of an anti-CMKLR1 antibody on a Hepatocarcinoma mice model (HCC model).
- Anti-tumor effect of anti-CMKLR1 antibody (2G1, 0.8mg/kg) i.p. administration three times a week for 2 weeks in combination (A) or not ( ⁇ ) with two injections on day 4 and 8 of anti-PD1 mAb ( RMP1-14 clone, 8mg/kg) or with injections (twice a week) of anti-PD-1 antibody alone (D).
- Mice have been treated during 2 weeks in an orthotropic model of murine hepatoma (2.5.10 L 6 of Hepa 1.6 cells injected through the portal vein on day 0).
- Isotype control antibody was used at 0,8 mg/kg three times a week for 2 weeks. Mice response were considered partial (PR) when mice survive few days to 1 month after stop of treatment or complete (CR) when mice survive over 1 month or cured when they survive three times longer than the time necessary to all control mice dye.
- FIG. 21 Production of anti-CMKLR1 antibody in different cell lines.
- CDR of 2G1 heavy chain were grafted in three human germlines framework, named IGHV3- 23*04, IGHV1-46*01 and IGHV7-4-1 (IMGT nomenclature).
- CDR of 2G1 light chain were grafted in three human germlines framework, named IGKV1-13*02, IGKV6-21*01 and IGKV3- 11*01 (IMGT nomenclature).
- Each sequence was fused to constant fragment of human immunoglobulin and co-transfected in mammalian cells to produce humanized antibody in COS and CHO cells. Production was assessed in the supernatant.
- VH WT and VL WT correspond respectively to the heavy and light chains of 2G1 antibody.
- Figure 22 Production of humanized antibody derived from 2G1.
- VH WT and VL WT corresponds to the variable domains of the 2G1 antibody.
- the germline is issued from humanized version of the variable domains of 2G1, and are disclosed here below in the examples.
- Figure 23 Binding recognition of C7 peptide by humanized anti-CMKLR1 derived from 2G1. Binding of C7biot in the supernatant of CHO cells transfected with different combinations of heavy and light chains (VHWT+VLWT: combination of SEQ ID No. 37 and SEQ ID No. 49; HCLC: combination of SEQ ID No. 42 and SEQ ID No.52; HDLC: combination of SEQ ID No. 43 and SEQ ID No.52; HOLD: combination of SEQ ID No. 42 and SEQ ID No.53; HDLD: combination of SEQ ID No. 43 and SEQ ID No.53).
- FIG. 24 ED50 of anti-CMKLR1 derived from 2G1 antibody.
- 2G1wt HALA: combination of SEQ ID No. 41 and SEQ ID No. 50; combination of SEQ ID No. 37 and SEQ ID No. 49;
- HCLC combination of SEQ ID No. 42 and SEQ ID No.52;
- HDLC combination of SEQ ID No. 43 and SEQ ID No.52;
- HCLD combination of SEQ ID No. 42 and SEQ ID No.53; HDLD: combination of SEQ ID No. 43 and SEQ ID No.53.
- FIG. 25 Inhibition of CCR7 expression on M1 macrophages cells in vitro with anti- ChemR23 antibodies coated.
- 2G1 and all humanized 2G1 variants HALA, HCLC, HCLD, HDLC and HDLD
- Isotype control were added as controls.
- Two isotypes which prevent FcRy binding i.e., 2G1-N297A (2G1wt mutated in N297A to reduce FcyR binding), and 2G4 (wt with isotype lgG4mutated in S228P to stabilise hinge region) were also added.
- Pro-inflammatory macrophages M1 were added on coated plate for 48h, and CCR7 expression at the surface of the macrophages was measured by flow cytometry.
- Figure 26 - Neutrophil apoptosis. A) Survival/Mortality of neutrophils B) Caspase-3 expression C) ROS production.
- Neutrophils were isolated from blood of healthy volunteers and cultured for 24h (Mortality analysis), or 4h, 6h, 11 h (Caspase-3 assay), or 5h (ROS assay) on coated Iso Ctrl (cross), chimeric anti-ChemR232G1 (square) or different humanized versions of the 2G1 (diamonds).
- Mortality of PMN was analyzed by incubating PMN with specific markers of the mortality and viability and then counted by picture analysis.
- Caspase-3 is revealed by western blot and intensity of signals was determined with a software. ROS production was revealed with a specific marker and analyzed on pictures.
- Figure 28 Neutrophils transmigration ratio- A) transmigration ratio of PMNs in healthy patients - B) Ratio PMNs in inflamed patients suffering from ANCA
- Endothelial cells were coated and +/- activated with 100U/ml_ of TNFa overnight. Then PMN were added with or without TNFa at 100U/ml_ and Ab for two hours. The transmigrated PMN were collected and analyzed by flow cytometry.
- FIG 29 CD62L expression.
- PMN from healthy volunteers were incubated in culture medium with coated Ab at 10pg/mL for different times and collected for CD62L staining analyzed by flow cytometry (left panel).
- the soluble form of the CD62L released by shedding is detected by ELISA in the supernatant of PMN incubated with coated Ab (right panel).
- Figure 30 Mesothelioma model Survival
- AK-7 cells (3M) were injected in the pleural cavity and mice received either Iso Ctrl or 2G1 three times a week for 3 weeks starting at d4 at 1 mg/kg.
- mice received an IP injection of azoxymethane at 7,5mg/kg and 5 days later, three cycles of 5 days-DSS and 14 days-water started. Treatment or placebo were administered after the 1 st cycle and kept going until the end two times a week. Mice were weighted and stool analyzed two times a week. Colons and tumors were measured and numbered 80 days after the chemical injection.
- Figure 32 autoimmune encephalomyelitis experimental model. - A) Weight variation overtime B) illness score
- Figure 33 Binding of purified antibodies on human ChemR23 peptide by ELISA assay (A), with ED50 concentration (ng/ml) (B).
- A ELISA assay
- B ED50 concentration
- donkey anti-human IgG, Fc specific Jackson Immunoresearch; USA; reference 709-005-098
- B ED50 concentration
- FIG. 34- A Binding of purified antibodies incubated 7 days at 4°C or 37°C on human ChemR23 ELISA assay.
- B SEC profile by gel filtration chromatography of purified antibodies incubated 7 days at 37°C.
- Each purified humanized anti-ChemR23 antibody HALA, HDLD, HD-LDT52S, HEF-LDT52S, HEF-LEF were incubated for 7 days at 4°C or 37°C.
- Figure 36 Increase of dead PMN neutrophils in vitro with anti-ChemR23 antibodies coated.
- PMN from healthy volunteers were incubated in culture medium with coated HEF- LDT52S, HEF-LEF and HDLD antibody variants at 10pg/mL for 24h and stained either with a dead/viability kit (LIVE/DEAD (Invitrogen)).
- LIVE/DEAD Invitrogen
- the percentages of positive cells were obtained by analyzing the pictures with Fiji software. Isotype control was added as control.
- a mutated version of HEF-LDT52S antibody which does not bind to Fc receptors (FcR) (HEF-LDT52S N297A) were also added.
- the 2G1 and 1G1 (another synthetized antibody) antibodies were able to inhibit DCs activation and/or maturation in a stronger manner than other synthetized antibodies (3G1 and 4G1) cells towards a pro-inflammatory pathway since level of detection of DCs expressing CD103 and lAb treated with 2G1 was lower than DCs cells treated with C7 antibody (the method used in this assay is described in point 10.2 of the examples).
- the viability of cells is enhanced after treatment with 1G1 or 2G1 antibodies as compared to cells treated with others antibodies, including C7, or Resolvin E1.
- the 2G1 was humanized using in silico CDR grafting method, a method of humanization. The resulting humanized sequences from the CDR and FR regions, as well as from the variable heavy chain and light chain are described in the following tables. Amino acid Sequence SEQ ID No.
- Colitis was induced in 8-10 weeks-old-C57BI/6 male mice by adding 2% (wt/vol) of DSS to the sterile drinking ad libitum water for 6 days. Treatments were injected intra-peritoneally: Isotype control hlgG1 (10pg per mouse), RvE1 (1pg per mouse) daily, or 2G1 antibody (10pg per mouse) three times for 5 days. Colitis follow-up consisting of body weight and stool score (0: normal stool; 4: blood in stool) parameters were performed daily. When mice were euthanized, colon length representing the pathology severity was measured. Resolution index was determined in the different conditions as described in Bannenberg et al., 2005.
- FIG. 2 The DSS animal model presented on Figure 2 is an acute inflammatory model.
- Figure 1 shows a better overall state of the animals treated with the anti-CMKLR1 antibody than states of animals receiving the control antibody or the resolvin RvE1.
- the anti-CMKLR1 treated mice lost significantly less weight (Fig. 2A) and the score stool (Fig. 2B) was significantly better.
- Figure 2C and 2D Regarding the colon length and resolution index ( Figure 2C and 2D), the animals receiving the anti-CMKLR1 or RvE1 presented similar results.
- EXAMPLE 2 Induction of colitis by TNBS Colitis was induced in 8-10 weeks-old-C57BI/6 male mice by intrarectal injection of 200 pL of the haptenating agent TNBS at 5% in 50% ethanol on day 0. Treatments were injected intra- peritoneally; RvE1 (1pg per mouse) daily for three days, or 2G1 antibody (10pg per mouse) twice for 3 days. Colitis follow-up consisting of body weight and stool score (0: normal stool; 4: blood in stool) parameters were performed daily (data not represented). When mice are euthanized, colon length representing the pathology severity was measured.
- Colitis induced by TNBS is another model of acute inflammation.
- Figure 3 shows that animals treated with anti-CMKLR1 or RvE1 have a colon length which is the same as normal animal (wt). However, those treated with the isotype control presented a shorten colon length. These results confirmed the therapeutic potential of an anti-CMKLR1 antibody acting like RvE1 on acute inflammatory mice models.
- IL10-KO model - Spontaneous colitis model IL-10KO mice develop a spontaneous colitis from 20 weeks of age mostly due to the absence of regulatory T cells function through IL-10 secretion in the intestine.
- IL-10KO mice were followed-up three times a week from 18-week old for their weight loss and stool consistency which are clinical hallmarks of this pathology.
- Anti-CMKLR1 antibody (2G1) or isotype control (hlgG1) were injected intra-peritoneally when the weight loss was superior to 5% and the stool score was superior or equal to 1 for 2 weeks (25pg/injection, 3 times a week).
- FIG. 4 shows the analysis of the percentage of weight loss (Fig. 4A) and the score stool (Fig. 4B) when animals were treated with isotype control or anti-CMKLR1 antibody. Results show that animals lost less weight when treated with the anti-CMKLR1 antibody and had a better score stool than those receiving the isotype control. Anti-CMKLR1 antibody seems hence to present a therapeutic potential on chronic inflammatory diseases.
- EXAMPLE 4 Preclinical model of Type 1 diabetes: the mice NOD model 8 weeks-old NOD female mice were obtained from Charles River laboratory. These mice develop a spontaneous type 1 diabetes at age between 12 to 20 weeks.
- the diabetes initiation can be measured by the high glycaemia.
- the glycaemia was between 180 and 234 mg/dL, anti-CMKLR1 and isotype control were given intra-peritoneally at 20pg/injection three times a week for 2 weeks. Mice were euthanized when the glycaemia was superior to 600mg/dL corresponding to an irreversible diabetes.
- Aldara® cream which is known to induce psoriasis in mice was used on male C57BI/6 mice (8-10-week old). Mice received a daily topical dose of Aldara. Treatments (anti-CMKLR1 agonist or control compound) were injected intra-peritoneally:
- Anti-CMKLR1 agonist (2G1) reduces the thickness of the skin (Fig. 6A) after Aldara administration (see for example on day 15), while the weight of the animals is not impacted by the administration of the agonist (Fig. 6B).
- EXAMPLE 6 Therapeutic efficacy of anti-CMKLR1 antibody on preclinical model of sepsis: mice peritonitis model Common peritonitis is induced by intraperitoneal injection of Zymosan A® (1mg per mouse in 1mL). Preventive injection of anti-CMKLR1 was performed 5 minutes before Zymosan A injection: RvE1 (1pg per mouse), 2G1 antibody (10pg per mouse). Murine peritoneal polymorphonuclear neutrophil (PMN) and macrophages were collected at 2-4-8-16-24 and 48h after Zymosan A injection and numbered by flow cytometry analysis to determinate the resolution index (Bannenberg et al. , 2005).
- PMN Murine peritoneal polymorphonuclear neutrophil
- macrophages were collected at 2-4-8-16-24 and 48h after Zymosan A injection and numbered by flow cytometry analysis to determinate the resolution index (Bannenberg et al. , 2005).
- EXAMPLE 7 Therapeutic efficacy of anti-CMKLR1 antibody treatment on preclinical models of cancers:
- Example 7.1 Effect of an anti-CMKLR1 antibody on the growth of a primary tumor and its lung metastasis development in an orthotopic mammary carcinoma model.
- mice were anesthetized with 3% of isoflurane. Mice were shaved on the abdomen and 4T1 cells (0,25 millions) were injected in the mammary gland with an insulinic syringe (30 Gauges) in 50pL of PBS.
- the anti-CMKLR1 antibody (2G1) or an anti-41 BB antibody (3H3) or both antibodies were injected twice at day 4 and day 7 (1 Opg/injection); a control antibody was injected three times a week for three weeks intraperitoneally in PBS (100pg/injection).
- animals were treated with anti-CMKLR1 antibody at 0.8mg/kg or control antibody (100pg/injection) three times a week for three weeks.
- lymph node metastasis shows that no animals treated with the anti-CMKLR1 compound has metastasis while two animals in the control have metastasis (data not shown).
- Those results indicate that anti-CMLKR1 antibody with agonist activity mimicking RvE1 has an anti-metastatic effect.
- the antibody of the invention does not present any significant efficacy on primary tumor development.
- results show an improvement when animals are treated by a combination of anti- CMKLR1 and anti-41 BB antibodies.
- Example 7.2 Therapeutic effect on tumor growth in a colon carcinoma model
- mice 8-week old C57bl/6J male mice were anesthetized with 3% of isoflurane. Mice were shaved on the flank and MC38 cells (0,5.10 L 6 cells/mouse) cell lines were injected subcutaneously with an insulinic syringe (30 Gauges) in 50mI_ of PBS. Another model was used, in which 8- week old Balb/c male mice were anesthetized with 3% of isoflurane. Mice were shaved on the flank and CT26 cells (1.10 L 6 cells/mouse) were injected subcutaneously with an insulinic syringe (30 Gauges) in 50mI_ of PBS.
- the agonistic anti-CMKLR1 antibody (2G1) or an anti-SIRPa antibody (p84- anti-mouse SIRPa from Merck Millipore) (SIRPa is a new checkpoint inhibitor) were injected once a week (20pg/injection) intraperitoneally for 3 weeks starting at d4 after tumor inoculation alone or combined.
- EXAMPLE 8 Meta-analysis of the CMKLR1 expression on UC or CD human patient biopsies treated with an anti-TNFa or 8h ⁇ -a4b7 antibody therapies.
- CMKLR1 transcript are accumulated in inflamed colon tissues of severe IBD patients who were not responding to immunosuppressive/corticosteroids and immunotherapies such as anti-TNFa (infliximab) or 8h ⁇ -a4b7 integrin (vedolizumab) therapies.
- immunotherapies such as anti-TNFa (infliximab) or 8h ⁇ -a4b7 integrin (vedolizumab) therapies.
- the inventors first analyzed the mucosal CMKLR1 transcript expression by performing a meta analysis of publicly available transcriptional datasets of three cohorts of UC patients (GSE16879(Arijs et al., 2009a) and GSE12251(Arijs et al., 2009b), and GSE73661 with colon mucosa biopsies performed before anti-TNF treatment (within a week) in patients refractory to corticosteroids and/or immunosuppression.
- CMKLR1 transcript expression is significantly increased in colon biopsies of primary UC non-responder patients before and after treatment with anti- TNF therapy as compared to non-IBD controls or patients with UC before anti-TNF and who will respond to anti-TNF therapy (Figure 10A).
- CMKLR1 expression is also significantly increased in non- responders before and after treatment with Vedolizumab ( Figure 11).
- CMKLR1 is over-expressed in inflamed tissues of IBD patients, in particular in patients non-responding to current immunosuppressive or immunotherapies even before initiation of the treatment.
- Our meta-analysis provide evidence that the CMKLR1 expression in the colon, or rather ileon for CD, from UC or CD patients who are treatment refractory may in contrast qualify these patients as being responsive to an agonist anti-CMKLR1 antibody treatment such as an antibody of the invention.
- CMKLR1 peptide (273NH2-PYHTLNLLELHHTAMPGSVFSLGLPLATALAIA-COOH305) (SEQ ID No: 60) was coated in borate buffer overnight. Saturation was performed with PBS- Tween 0,1%-Gelatin 0,25% for 2 hours at 37°C. Then, 2G1 or hlgG1 antibodies were added at different concentrations for 2 hours at 37°C. Then peroxidase-conjugated secondary antibody (0,8pg/ml) was added for 1 hour at 37°C and revealed by a TMB substrate. The colorimetric reaction was read with TECAN. - CMKLR1 expression by FACS ( Figure 13A)
- CMKLR1 Western blot analysis CMKLR1 ( Figure 13B) After protein migration and transfer as described previously, 2G1 antibody (10pg/membrane) was incubated overnight at 4°C and revealed with a peroxidase-conjugated secondary antibody (1:2000). The CMKLR1 expression was then detected by using Chemiluminescence and Image Reader. Western blot Images were quantified by Multi Gauge software.
- Monocytes differentiation and polarization Monocytes were collected from PBMC of buffy coat of healthy volunteers and isolated by magnetic separation or by elutriation. Then, monocytes were cultured with different cocktails of cytokines to generate differentiated unpolarized macrophages or polarized macrophages. This protocol allowed to generate polarized differentiated macrophages in order to have pro- inflammatory (M1) or pro-resolution -(M2) of inflammation macrophages in different wells. Monocytes were plated at 0,5.10 6 cells/mL in complete RPMI (RPMI with 10% FBS, 1% glutamine, 1% antibiotics) and 500pL of the cell suspension was plated per well in a 24-well plate.
- LPS-IFNg 100ng/mL of M-CSF was added with medium for differentiation of the cells. Cells were incubated 5 days and medium was replaced with fresh medium complemented with 100ng/mL of M-CSF at day 3.
- mice For pro-resolution macrophage polarization, cells were incubated with IL-4 at 20ng/mL. Following differentiation and/or polarization, phenotype and functional cytokines/chemokines release was studied by FACS analysis, ELISA and Western blot. Example 10.2. Mice macrophages and DCs isolation and differentiation -Isolation of murine bone marrow derived macrophages
- Bone marrow cells were harvested and cultured in the RPMI medium supplemented with 10% FBS, glutamine and antibiotics containing macrophages colony-stimulating factor (M-CSF) at 100ng/mL for 5 days inducing the macrophages differentiation.
- the macrophages were harvested and cultured for 2 days with either IFNg (20ng/ml) and LPS (100ng/ml) inducing the pro-inflammatory polarization or with IL-4 (20ng/ml) inducing the pro-resolution polarization. Treatments were added during macrophage polarization at 2pg/ml.
- Bone marrow cells were harvested and cultured in RPMI medium supplemented with 10% FBS, glutamine and antibiotics and the dendritic cell differentiation was induced by GM-CSF at 20ng/ml for 7 days. Then, immature dendritic cells (iDC) were collected and cultured for 24 hours with LPS (100ng/ml) to induce the maturation from iDC to mDC. Treatments were added during differentiation and maturation at 2mg/ml.
- iDC immature dendritic cells
- mice After differentiation of mice pro-inflammatory or pro-resolution macrophagesas explain above, cells were incubated in presence of medium, isotype control, anti-CMKLR1 antibodies: clones H6 and BZ194, C15 peptides, 2G1 the anti-CMKLR1 antibody of interest or RvE1 were used. Then the secretion of IL10, CCL17 and IL12p40 was assessed by ELISA. Cytokines secretion was measured in the supernatant using an ELISA kit from BD. Supernatants were diluted at 1/10 for IL10 cytokines, 1/50 for CCL17 cytokines and 1/100 for IL12p40 cytokines. - ELISA cytokines secretion study
- Cytokines secretion was detected by ELISA according to the BD manufacturer instructions. Briefly, supernatants were diluted in the appropriate buffer and incubated for 2 hours after overnight coating with capture antibody and saturation. Then, cytokines were revealed with a detection biotin-coupled antibody and the signal was amplified with the biotin-streptavidin- coupled peroxidase system. TMB supplied by BD Bioscience was used as substrate and colorimetric reaction was read with TECAN.
- Dendritic cells were resuspended in PBS-FBS-EDTA and incubated with live and dead (LIVE/DEAD® Fixable Dead Cell Stains Yellow-Life Technologies) for 30 minutes on ice. Staining of CD11c-BV711, CD11b-APCCy7, l/Ab-APC, CD103-PerCPCy5.5, CCR7-V450, CD40-PeCy7, CD80-PE, CD86-FITC (all provided by BD Pharmingen) were performed. Western blot analysis ERK/Akt
- mice pro-inflammatory macrophages were generated from bone marrow with M-CSF and polarized with IFN-gamma (IFNg) and LPS. Briefly, bone marrow cells were collected by flushing the femoral bone and cultured with 100ng/mL of mM-CSF for 5 days and then polarized with 20ng/mL of IFNg and 100ng/mL of LPS for 24h. Then, they were deprived of FBS for 24 hours with RPMI FBS 2% medium. Finally, mice pro-inflammatory macrophages were treated with 2pg/mL of 2G1 antibody at different times: 5, 10 and 30 minutes. Cells were collected in a RIPA buffer.
- the protein concentration was measured by a BCA protein kit assay. Proteins were denatured by heating at 95°C for 5 minutes and diluted in DTT and Laemmli solution. After migration and transfer, the nitrocellulose membrane was blocked with 5% BSA in TBS-T for 2 hours. Anti-phospho-ERK antibody and anti-phospho-Akt antibody (1:1000) were incubated with the membrane overnight at 4°C and revealed with a peroxidase- conjugated secondary antibody (1 :2000). Western blot Images were quantified by Multi Gauge software
- Example 10.3 CMLKR1 expression after inflammatory stimuli on Human blood monocytes and mouse bone marrow myeloid and neutrophils cells.
- Human monocytes were collected from PBMC of buffy coat of healthy volunteers and isolated by magnetic separation or by elutriation. Then the monocytes (CD14 positive cells) were cultured in medium and treated with different pro4nflammatory stimuli 16 hours or 48 hours: LPS (100 ng/ml) or TNFa (100 U/ml) or IL6 (20 ng/ml).
- Mouse monocytes (CD11b+ Ly6G- SSClow) and neutrophils (CD11b+ Ly6G- SSClow) were obtained from bone marrow cells harvested and cultured in RPMI medium supplemented with 10% FBS, glutamine and antibiotics. Cells were then cultured in medium and treated with different pro4nflammatory stimuli 16 hours or 48 hours: LPS (100 ng/ml) or TNFa (100 U/ml) or IL6 (20 ng/ml). The expression of CMLKR1 was measured by FACS using commercial anti-CMKLR1 antibodies (Human anti-ChemR23: clone 84939 and Mouse anti-ChemR23 : clone 477806).
- CMKLR1 in mice myeloid lineage illustrated on Figure 14 revealed a good expression of the protein on monocytes and macrophages as well as on dendritic cells.
- Figure 15 the expression of CMKLR1 on human monocyte and a mice bone marrow myeloid and neutrophil cells is illustrated. This expression is clearly increased by inflammatory stimuli such as LPS, TNFa or IL6 (at least twice as compared to the control after 48h) confirming that CMKLR1 expression on myeloid cell lineage and overexpression during inflammation could represent a therapeutic approach to downregulate and/or induce resolution of inflammation.
- inflammatory stimuli such as LPS, TNFa or IL6
- the DC activation markers were analyzed by FACS and results illustrated on Figure 16 shows a strong decrease of the expression of CD80, CD86, CD103, CD40 and lAb when cells were treated with RvE1 lipid or with 2G1 antibody compared to the excipient or isotype control. These results indicate that 2G1 antibody is as active on CMKLR1 pathway on DCs as RVE1. Then inventors analyzed the CMKLR1 activation pathway on mice macrophages by Western blot. Figure 17 shows that anti-CMKLR1 antibody 2G1 was able to induce the activation of both Akt and Erk proteins after 10 to 30 minutes of incubation. These results indicate that the 2G1 antibody is able to exhibit an agonist property against CMKLR1 receptor as does RvE1 lipid.
- CHO-K1 CMKLR1 cells (Discover’X ref 93-0313E2) were plated in pre-warmed cell reagent then plated in a 96-well plate at 100 mI/well of cells as (Discover’X ref 15-103) and incubated 48 hours at 37°C, in a 5% C02 humidified incubator.
- the anti-CMLKR1 antibody was diluted (22X in 7-point series of 3-fold dilutions from 1 mM to 1 nM) and cells were incubated 30 min at 37°C with the antibody. Then cells were stimulated with Chemerin (2 or 6 nM) according to provider protocol (Discover’x ref 92-1036) 90 min at37°C.
- the luminescence was measured after Working Detection Solution addition to the cells with a plate reader with 0,5 s integration.
- CHO-K1 CMKLR1 Gi cells (Discover’X ref 95-0080C2) were plated in pre-warmed cell reagent then plated in a 96-well plate at 100 mI/well of cells as (Discover’x ref 15-103) and incubated 24 hours at 37°C, in a 5% C02 humidified incubator for 24 hours.
- a mix of Chemerin agonist (6x in 7-point series of 3-fold dilutions from 10 7 mM to 10 10 M ) (Discover’x ref 92-1036 or 2324-CM-025 from R&D Systems) and forskolin (40mM) (a cAMP activator) (Discover’x ref 92-0005) was added to the cells during 30 min at 37°C; or cells were pre-incubated 30 min at 37°C with anti-CMKLR1 antibody (serial dilution : 6X in 7-point series of 3-fold dilutions from 1mM to 1nM). Then a mix of chemerin (2nM) + forskolin (60nM) was added to the cells 30 min at 37°C.
- cAMP For the detection cAMP, antibody reagent and cAMP working detection solution was added to the plate for 1 hour at room temperature, then cAMP solution A was added, and cells incubated 3 hours at room temperature in the dark. Bioluminescence was read with a plate reader with 0,5s integration.
- the antibodies of the invention do not have an antagonist activity of the CMLKR1- Chemerin interaction. Furthermore, the antibodies of the invention are not able to induce chemerin-induced CMKLR1 signaling pathway, confirming that these antibodies are not agonist of chemerin of the CMLKR1 pathway.
- CD45Rb hi9h T-cell transfer chronic colitis mouse model Method CD45Rb hi9h CD4 T cells were isolated from the spleen of naive mice and sorted on an ARIA FACS after a negative selection of the CD4 T cells by magnetic sorting, then injected intraperitoneally at 0,5.10 6 cells in 100pLof PBS into 6-weeks old female Rag1 knock-out mice.
- Anti-CMKLR1 antibody (2G1) or an isotype control were administered from day 32 after the CD45Rb hi9h CD4 T cell transfer for 3 weeks three times a week at 1 mg/kg. The follow-up of weight was evaluated three times a week and the weight variation was determined over the initial weight.
- Figure 19 presents the percentage of weight variation over the time of animals treated with anti-CMLKR1 antibody or an isotype control. Both groups presented the same initial weight evolution over the first 30 days are treated with anti-CMLKR1 antibody or an isotype control. Mice treated with the anti-CMKLR1 continue to gain weight while, in contrast, control mice start to lose weight indicating development of chronic colitis as anticipated in this control group (Fig. 19A). A decrease of tissue thickness corresponding to reparation of colon was observed in the mice treated with the anti-CMKLR1. A decrease of fibrotic tissue was also observed (Fig. 19B). The different scores represent anatomic pathology scores used to calculate the severity of the pathology.
- EXAMPLE 13 Anti-tumor effect on the overall survival of mice hepatocarcinoma tumor model Method: Mice were anesthetized with a cocktail of xylazine/ketamine. After a laparotomy, tumoral Hepa 1.6 cells were injected in PBS through the portal vein (2,5.10 6 cells/100 pL) in PBS. The treatment was started 4 days after tumor injection. The anti-CMKLR1 antibody (2G1clone) and the hlgG1 istotype control were injected at 0.8mg/kg three times per week during 2 weeks. The anti-PD1 monoclonal antibody was injected twice a week during 2 weeks intraperitoneally in PBS (8mg/kg). Combination anti-CMKLR1 and anti-PD1 antibodies was tested as well (0.8 mg/kg and 8mg/kg respectively). The Overall survival was followed during sixty days and the percentage of survival in each condition was reported Figure 22.
- CDR of 2G1 heavy chain were grafted in three human germlines framework, named IGHV3- 23*04 (corresponding to SEQ ID No. 41), IGHV1-46*01 and IGHV7-4-1.
- CDR of 2G1 light chain were grafted in three human germlines framework, named IGKV1-13*02 (corresponding to SEQ ID No. 50), IGKV6-21*01 and IGKV3-11*01 (IMGT nomenclature). Each sequence was fused to constant fragment of human immunoglobulin and co-transfected in mammalian cells to produce humanized antibody.
- variable domain VH sequences were synthetized and cloned by EcoRV in pFUSE-CHIg-hG1 expression plasmid containing Fc of human lgG1 (pFUSE-CHIg-hG1 vector from Invivogen, Toulouse).
- variable domain VL were synthetized and cloned by BsiWI in pFuse2CLIg-hk expression plasmid containing human CLkappa (pFuse2CLIg-hk from Invivogen, Toulouse).
- HEK or CHO cells In mammalian HEK or CHO cells, we have co-transfected, by lipofectamine method, plasmids containing VH-hFcG1 with plasmid containing VL-CLkappa. After 3-7 days incubation, supernatant was recovered and quantified by sandwich ELISA assay. Supernatant could be purified by affinity on Protein A chromatography (HiTrap, GeHealthcare) with citric acid 0.1M pH 3 elution buffer. Purified antibody was dialyzed in PBS and concentrated. They were quantified by UV (A280nm) and tested in activity assay against C7 antigen-specific peptides. Results.
- the human germline IGHV3-23*04 for heavy chain was more efficient to produce the antibody in mammalian cells. Mutations implicated in the other framework induced less productive chains.
- the human germline IGKV1 -13*02 was the best to produce humanized antibody, the other germline decreased 1-log the productivity.
- the combination of both humanized IGHV3-23*04 and IGKV1-13*02 is suitable for the production in high yield of humanized anti-CMKLR1 antibodies. As shown on Fig. 22, this combination indeed allows the production of sufficient quantities of antibody, with a satisfactory yield.
- the germline IGHV3-23*04 and the germline IGKV1-13*02 were therefore selected for further humanization of antibodies.
- EXAMPLE 15 Recognition capability of anti-CMKLR1 antibodies produced in vitro and issued from specific germlines of heavy chain variable domain and light chain variable domain.
- ELISA assay For quantitation ELISA assay, donkey anti-human IgG, Fc specific (Jackson Immunoresearch; USA; reference 709-005-098) was immobilized on plastic at 1 3pg/ml in borate buffer (pH9) and supernatants containing antibody were added to measure binding, compared to standard antibody. After incubation and washing, mouse anti-human kappa antibody (Ose Immunotherapeutics, reference NaM76-5F3) was added and detected by peroxidase-labeled donkey anti-mouse IgG antibody (Jackson Immunoresearch; USA; reference 715-036-151). Revelation of ELISA was made by conventional methods.
- HC corresponds to SEQ ID No. 42
- HD corresponds to SEQ ID No. 43
- C7 peptide All combinations bound antigen-specific peptides (C7 peptide) with at least the same activity as wild-type antibody 2G1. In some cases (the combinations of HCLC, HCLD, HDLC and HDLD), binding is even better than the germline antibody HALA and the wild type antibody 2G1 (Fig. 23). As illustrated on Fig. 24, the ED50 (ng/ml) of humanized antibodies is at least equivalent to the ED50 of 2G1 antibody, and better in most of the cases. EXAMPLE 16. Biological effect on CCR7 internalization
- Macrophages were generated from monocytes of healthy volunteers with 100ng/mL of M-CSF for 5 days. Then, macrophages were collected and incubated with coated mAb at 10mg/ml_ in presence of 20ng/ml_ of IFNy in order to obtain M1 inflammatory macrophages. Then, M1 were phenotyped for CXCR4 and CCR7 by flow cytometry and cytokines released in the supernatant were dosed by ELISA. Dendritic cells were generated from monocytes of healthy volunteers with 50 ng/mL of GM-CSF and 20 ng/mL of IL-4 for 6 days. Then DC were phenotyped for CCR7 by flow cytometry.
- 2G1 and all humanized 2G1 variants were immobilized on plate. Isotype control was added as controls. Two isotypes which prevent FcRy binding, i.e., 2G1-N297A (2G1wt mutated in N297A to reduce FcyR binding), and 2G4 (wt with isotype lgG4mutated in S228P to stabilise hinge region) were also added. Pro- inflammatory macrophages M1 were added on coated plate for 48h, and CCR7 expression at the surface of the macrophages was measured by flow cytometry.
- Neutrophils are usually located at the site of inflammation and their presence sustain the inflammatory process, thereby preventing the resolution of the inflammation to be initiated or to be actively sustained which may lead to chronic inflammation. Neutrophil apoptosis prevents the release of neutrophil histotoxic contents and exerts an anti-inflammatory effect.
- neutrophils life/death ratio is higher in cells treated with an antibody of the invention, thereby illustrating the effect on these cells of the agonist of the invention.
- CASPASE-3 expression MATERIAL AND METHODS:
- RESULTS As illustrated on Fig. 26B, the administration of an anti-CMKLR1 agonist enhances caspase-3 activity, as compared to cells treated with a control antibody.
- the antibody HALA exhibits higher effect on caspase 3 activity as compared to the 2G1 antibody.
- 2G1 WT and HALA increases caspase-3 cleavage, which means that ChemR23 triggering leads to Caspase-3-dependent apoptosis.
- Fig. 26C Percentage of dead PMN and ROS test.
- PMN from healthy volunteers were incubated in culture medium with coated Ab at 10pg/mL for 24h or 5h and stained either with a dead/viability kit (LIVE/DEAD (Invitrogen)) or a specific marker of reactive oxygen species (ROS) respectively.
- LIVE/DEAD Invitrogen
- ROS reactive oxygen species
- 2G1 and all humanized variants of 2G1 increase the mortality of PMN after 24 hours. At 48 hours, the percentage of dead cells incubated with lgG1 control and HALA variant is similar indicating that antibodies by triggering CMKLR1 signaling only accelerate programmed cell death in PMN. 2G1 and all humanized variants of 2G1 accelerate the death of PMN and so the humanized variants preserve pro-resolutive properties. 2G1 and HALA variants increase the ROS production by PMN after 5h.
- Fig. 27B the percentage of ChemR23-positive cells (macrophages and neutrophils) is increased when inflammation is induced. But, the percentage of neutrophils in exudates is not significantly decreased in animals treated with the anti-CMKLR1 antibody (Fig. 27C; black square), while the overall percentage of macrophages in exudates is slightly enhanced (Fig. 27D). This indicates that the administration of the CMKLR1 agonist does not reduce the overall number of myeloid cells in the exudates, and has an effect on apoptosis of the neutrophils mainly at the site of inflammation. As illustrated on Fig. 27E and Fig.
- EXAMPLE 18 Transmigration of neutrophils Neutrophils migrate after recruitment to the inflammatory site, thereby initiating, enhancing and/or sustaining the inflammatory process.
- HDMEC Human endothelial cells
- Neutrophil treated with 2G1 have a lower transmigration capability compared to cells treated with control compounds (Fig. 28A).
- 2G1 avoids PMN transmigration through endothelial monolayer especially under inflammatory condition when PMN and endothelial cells were activated with TNFa in healthy volunteers and in AIDs’ patients (Fig. 28B).
- the antibody of the invention has the capability to reduce the transmigration capability of neutrophils.
- mice treated according to the method explained in the description of the figure with an agonist of CMKLR1 have a higher survival rate than mice treated with a control antibody, thereby illustrating the positive effect of a compound according to the invention for treating mesothelioma (Fig. 30).
- the tumor volume is reduced in animals treated with the anti- CMKLR1 antibody of the invention, as compared to the control antibody. In several cases, complete remission is also observed, thereby illustrating the positive effect of a compound according to the invention for treating CRC.
- the curative administration of the antibody of the invention in EAE model does not lead to the reduction of the weight (Fig. 32A), as compared to animals treated with a control antibody.
- the illness score is significantly reduced when the treatment is performed with the anti-CMKLR1 antibody (Fig. 32B).
- the anti-CMKLR1 antibody leads to a great improvement of the illness score as soon as ten-day post treatment as compared to the control, since the score is approximately 30 % lower in animals treated with the agonist compound. It is therefore illustrated that a treatment with an anti-CMKLR1 compound is effective for treating autoimmune encephalomyelitis.
- EXAMPLE 23 Optimization of CDR amino acid residue Few mutations were added in heavy chain or light chain of HDLD variant to substitute amino- acid implicated in immunogenicity predicted with in silico with IEDB software and HLA-II prediction software (NetMHCpanll method).
- amino acids substitution D61E in CDR2 (HD-61 E, SEQ ID NO: 89), R52G in CDR2 (HD-R52G, SEQ ID NO: 90), or R52aG, A49S, N52S and Y53S in CDR2 (HEF, SEQ ID NO: 91) were achieved to reduce immunogenicity.
- amino acid N92 in CDR3 was substituted with amino acid S (LD-N92S, SEQ ID NO: 92) or Q (LD-T52S, SEQ ID NO: 93) to prevent post-translational modification.
- T52S in CDR2 was also substituted to reduce immunogenicity in LD-N92S variant.
- N92Q in CDR3 and T52S, T55E in CDR2, and W47L in Framework 2 were substituted to reduce immunogenicity in LEF variant (SEQ ID NO: 55).
- the sequences are indicated in the table below:
- antibodies comprising light chain LDT52S, and in particular HEF-LDT52S variant are particularly advantageous.
- HEF-LDT52S optimized to reduce immunogenicity present high binding activity and stability while maintaining biological functions.
- EXAMPLE 24 Recognition capability of anti-CMKLR1 antibodies produced in vitro For activity ELISA assay, donkey anti-human IgG, Fc specific (Jackson Immunoresearch; USA; reference 709-005-098) was immobilized on plastic at 1 3pg/ml in borate buffer (pH9) and purified antibody was added to measure binding in BSA1% buffer, compared to wild-type 2G1. After incubation and washing, biotinylated antigen-specific peptide (Biot-C7 peptide: biotinylated NH2 -PYHTLNLLELHHTAMPGSVFSLGLPLATALAIA -COOH, synthetized by synpeptide, SEQ ID No. 60) then, peroxidase-streptavidin (Jackson Immunoresearch; USA; reference 016-030-084) was added and revealed by conventional methods.
- biotinylated antigen-specific peptide Biot-C7 peptide: biotinyl
- Fig. 33 the combinations of humanized antibody variable domain chains derived from 2G1 (For the heavy variable domain: HD corresponds to SEQ ID No. 43 and HEF correspond to SEQ ID NO: 91 ;
- LD-T52S corresponds to SEQ ID No. 93 and
- LEF corresponds to SEQ ID NO: 55) generated a humanized antibody with better binding activity than the germline antibody HALA and the wild type antibody 2G1 to antigen-specific peptides (C7 peptide).
- Each purified humanized anti-ChemR23 antibody (HALA, HDLD, HD-LDT52S, HEF-LDT52S, HEF-LEF) were incubated for 7 days at 4°C or 37°C. After 7 days, the binding of purified antibodies was analyzed by ELISA assay and the aggregate formation was analyzed by gel filtration (Superdex 200 10/300GL, GeHealthcare).
- the humanized 2G1 variant HEF-LD-T52S was immobilized on plate. Isotype control was added as control. Pro-inflammatory macrophages M1 were added on coated plate for 48h , and CCR7 expression at the surface of the macrophages was measured by flow cytometry. As illustrated on Fig. 35 , the humanized 2G1 variant HEF-LD-T52S was able to decrease expression of CCR7 at the surface of pro-inflammatory macrophages (M1) compared to isotype control.
- the humanized 2G1 variant HEF-LD-T52S optimized to reduce immunogenicity conserved functional properties of 2G1 antibody.
- EXAMPLE 27 Biological effect on PMN viability PMN from healthy volunteers were incubated in culture medium with coated HEF-LDT52S, HEF-LEF and HDLD antibody variants at 10pg/mL for 24h and stained either with a dead/viability kit (LIVE/DEAD (Invitrogen)). The percentages of positive cells were obtained by analyzing the pictures with Fiji software. Isotype control was added as control. A mutated version of HEF-LDT52S antibody which does not bind to Fc receptors (FcR) (HEF-LDT52S N297A) were also added. As illustrated in Fig. 36 , 2G1 and all HEF-LDT52S, HEF-LEF and HDLD humanized variants of 2G1 accelerate the death of PMN and so the humanized variants preserve pro-resolutive properties.
- LIVE/DEAD Invitrogen
- the humanized HEF-LDT52S variant was optimized to reduce immunogenicity. This optimized variant maintains high binding activity and stability while maintaining biological functions.
- ChemR23 a putative chemoattractant receptor, is expressed in monocyte-derived dendritic cells and macrophages and is a coreceptor for SIV and some primary HIV-1 strains. Eur. J. Immunol. 28, 1689-1700.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Pain & Pain Management (AREA)
- Rheumatology (AREA)
- Mycology (AREA)
- Microbiology (AREA)
- Epidemiology (AREA)
- Transplantation (AREA)
- Biomedical Technology (AREA)
- Oncology (AREA)
- Endocrinology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Priority Applications (14)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US17/767,606 US12534533B2 (en) | 2019-10-09 | 2020-10-09 | Anti-chemokine like receptor 1 humanized antibodies and their therapeutic applications |
| JP2022521452A JP7701915B2 (ja) | 2019-10-09 | 2020-10-09 | 抗ケモカイン様受容体1ヒト化抗体及びその治療適用 |
| AU2020365034A AU2020365034A1 (en) | 2019-10-09 | 2020-10-09 | Anti-chemokin like receptor 1 humanized antibodies and their therapeutic applications |
| PH1/2022/550844A PH12022550844A1 (en) | 2019-10-09 | 2020-10-09 | Anti-chemokin like receptor 1 humanized antibodies and their therapeutic applications |
| EP20789120.1A EP4041302A1 (en) | 2019-10-09 | 2020-10-09 | Anti-chemokin like receptor 1 humanized antibodies and their therapeutic applications |
| KR1020227015533A KR20220087466A (ko) | 2019-10-09 | 2020-10-09 | 항-케모킨(anti-chemokin) 유사 수용체 1 사람화된 항체 및 이의 치료학적 적용 |
| IL292029A IL292029A (en) | 2019-10-09 | 2020-10-09 | Humanized antibodies against chemokin like receptor 1 and their therapeutic uses |
| PE2022000588A PE20221413A1 (es) | 2019-10-09 | 2020-10-09 | Anticuerpos humanizados anti-receptor tipo quimiocina 1 y sus aplicaciones terapeuticas |
| CA3156835A CA3156835A1 (en) | 2019-10-09 | 2020-10-09 | Anti-chemokin like receptor 1 humanized antibodies and their therapeutic applications |
| MX2022004312A MX2022004312A (es) | 2019-10-09 | 2020-10-09 | Anticuerpos humanizados anti-receptor tipo quimiocina 1 y sus aplicaciones terapeuticas. |
| CN202080084501.6A CN114786722B (zh) | 2019-10-09 | 2020-10-09 | 抗类趋化因子受体1人源化抗体及其治疗应用 |
| CR20220155A CR20220155A (es) | 2019-10-09 | 2020-10-09 | Anticuerpos humanizados anti-receptor tipo quimiocina 1 y sus aplicaciones terapéuticas |
| CONC2022/0004545A CO2022004545A2 (es) | 2019-10-09 | 2022-04-08 | Anticuerpos humanizados anti-receptor tipo quimiocina 1 y sus aplicaciones terapéuticas |
| JP2025103497A JP2025134864A (ja) | 2019-10-09 | 2025-06-19 | 抗ケモカイン様受容体1ヒト化抗体及びその治療適用 |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP19306323.7A EP3804754A1 (en) | 2019-10-09 | 2019-10-09 | Cmklr1 agonists having a resolvin e1-like capability and their therapeutic applications |
| EP19306323.7 | 2019-10-09 | ||
| EP19306322 | 2019-10-09 | ||
| EP19306322.9 | 2019-10-09 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2021069709A1 true WO2021069709A1 (en) | 2021-04-15 |
Family
ID=72811872
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2020/078488 Ceased WO2021069709A1 (en) | 2019-10-09 | 2020-10-09 | Anti-chemokin like receptor 1 humanized antibodies and their therapeutic applications |
Country Status (14)
| Country | Link |
|---|---|
| US (1) | US12534533B2 (https=) |
| EP (1) | EP4041302A1 (https=) |
| JP (2) | JP7701915B2 (https=) |
| KR (1) | KR20220087466A (https=) |
| CN (1) | CN114786722B (https=) |
| AU (1) | AU2020365034A1 (https=) |
| CA (1) | CA3156835A1 (https=) |
| CO (1) | CO2022004545A2 (https=) |
| CR (1) | CR20220155A (https=) |
| IL (1) | IL292029A (https=) |
| MX (1) | MX2022004312A (https=) |
| PE (1) | PE20221413A1 (https=) |
| PH (1) | PH12022550844A1 (https=) |
| WO (1) | WO2021069709A1 (https=) |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2024028509A2 (en) | 2022-08-05 | 2024-02-08 | Ose Immunotherapeutics | Treatment of an inflammation-associated disease in a patient expressing high chemerin level |
| WO2024028508A2 (en) | 2022-08-05 | 2024-02-08 | Ose Immunotherapeutics | Anti-chemokin like receptor 1 antibody or antigen-binding fragment thereof for use in the treatment of conditions associated with netosis |
| WO2024200826A1 (en) | 2023-03-30 | 2024-10-03 | Ose Immunotherapeutics | Lipid-based nanoparticle targeted at activated immune cells for the expression of immune cell inhibiting molecule and use thereof |
| WO2025242836A1 (en) | 2024-05-22 | 2025-11-27 | Ose Immunotherapeutics | Molecules comprising masking linkers and uses thereof for the treatment of auto-immune or inflammatory diseases and disorders |
Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2003006996A2 (en) * | 2001-07-09 | 2003-01-23 | Euroscreen Sa | Natural ligand of gpcr chemr23 and uses thereof |
| WO2005000875A2 (en) * | 2003-06-25 | 2005-01-06 | Euroscreen S.A. | Compositions and methods comprising a ligand of chemerin receptor |
| US20050202029A1 (en) * | 2003-10-03 | 2005-09-15 | The Board Of Trustees Of The Leland Stanford Junior University | Family of cystatin-related chemoattractant proteins |
| US20070286863A1 (en) * | 2006-05-17 | 2007-12-13 | Christopher Sinal | CMKLR regulation of adipogenesis and adipocyte metabolic function |
| US20090280113A1 (en) * | 2008-05-10 | 2009-11-12 | Kareem Graham | Target for regulating multiple sclerosis |
| WO2012172336A2 (en) * | 2011-06-13 | 2012-12-20 | Ith Immune Therapy Holdings | Treating inflammatory skin diseases |
| WO2019193029A1 (en) * | 2018-04-03 | 2019-10-10 | Ose Immunotherapeutics | Anti-chemokin like receptor 1 antibodies and their therapeutic applications |
Family Cites Families (22)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| US5567610A (en) | 1986-09-04 | 1996-10-22 | Bioinvent International Ab | Method of producing human monoclonal antibodies and kit therefor |
| GB8823869D0 (en) | 1988-10-12 | 1988-11-16 | Medical Res Council | Production of antibodies |
| US5175384A (en) | 1988-12-05 | 1992-12-29 | Genpharm International | Transgenic mice depleted in mature t-cells and methods for making transgenic mice |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5859205A (en) | 1989-12-21 | 1999-01-12 | Celltech Limited | Humanised antibodies |
| US6150584A (en) | 1990-01-12 | 2000-11-21 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US5229275A (en) | 1990-04-26 | 1993-07-20 | Akzo N.V. | In-vitro method for producing antigen-specific human monoclonal antibodies |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5565332A (en) | 1991-09-23 | 1996-10-15 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
| US5573905A (en) | 1992-03-30 | 1996-11-12 | The Scripps Research Institute | Encoded combinatorial chemical libraries |
| EP0690452A3 (en) | 1994-06-28 | 1999-01-07 | Advanced Micro Devices, Inc. | Electrically erasable memory and method of erasure |
| DE19742706B4 (de) | 1997-09-26 | 2013-07-25 | Pieris Proteolab Ag | Lipocalinmuteine |
| EP1930342B1 (en) | 2006-12-04 | 2012-01-25 | Institut Pasteur | OB-fold used as scaffold for engineering new specific binders |
| JP2010229093A (ja) | 2009-03-27 | 2010-10-14 | Banyu Pharmaceut Co Ltd | 新規ChemerinRアゴニスト |
| US9726666B2 (en) | 2011-06-13 | 2017-08-08 | Tla Targeted Immunotherapies Ab | Diagnosing and treating inflammatory diseases |
| WO2013109543A1 (en) | 2012-01-20 | 2013-07-25 | The Board Of Trustees Of The Leland Stanford Junior University | Small molecule cmklr1 antagonists in demyelinating disease |
| JP5883515B2 (ja) | 2012-02-06 | 2016-03-15 | エーエスエムエル ネザーランズ ビー.ブイ. | 対象物を保持するための支持構造を備えるリソグラフィ装置及びそれに用いられる支持構造 |
| WO2018213592A1 (en) | 2017-05-19 | 2018-11-22 | J. Craig Venter Institute | Compositions and methods for resolution of inflammation |
| CN109942676B (zh) | 2017-12-20 | 2021-06-11 | 深圳先进技术研究院 | 一种cmklr1拮抗多肽及其衍生物与应用 |
| EP3804754A1 (en) | 2019-10-09 | 2021-04-14 | OSE Immunotherapeutics | Cmklr1 agonists having a resolvin e1-like capability and their therapeutic applications |
-
2020
- 2020-10-09 PH PH1/2022/550844A patent/PH12022550844A1/en unknown
- 2020-10-09 WO PCT/EP2020/078488 patent/WO2021069709A1/en not_active Ceased
- 2020-10-09 MX MX2022004312A patent/MX2022004312A/es unknown
- 2020-10-09 IL IL292029A patent/IL292029A/en unknown
- 2020-10-09 EP EP20789120.1A patent/EP4041302A1/en active Pending
- 2020-10-09 CN CN202080084501.6A patent/CN114786722B/zh active Active
- 2020-10-09 AU AU2020365034A patent/AU2020365034A1/en active Pending
- 2020-10-09 KR KR1020227015533A patent/KR20220087466A/ko active Pending
- 2020-10-09 PE PE2022000588A patent/PE20221413A1/es unknown
- 2020-10-09 US US17/767,606 patent/US12534533B2/en active Active
- 2020-10-09 CR CR20220155A patent/CR20220155A/es unknown
- 2020-10-09 JP JP2022521452A patent/JP7701915B2/ja active Active
- 2020-10-09 CA CA3156835A patent/CA3156835A1/en active Pending
-
2022
- 2022-04-08 CO CONC2022/0004545A patent/CO2022004545A2/es unknown
-
2025
- 2025-06-19 JP JP2025103497A patent/JP2025134864A/ja active Pending
Patent Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2003006996A2 (en) * | 2001-07-09 | 2003-01-23 | Euroscreen Sa | Natural ligand of gpcr chemr23 and uses thereof |
| WO2005000875A2 (en) * | 2003-06-25 | 2005-01-06 | Euroscreen S.A. | Compositions and methods comprising a ligand of chemerin receptor |
| US20050202029A1 (en) * | 2003-10-03 | 2005-09-15 | The Board Of Trustees Of The Leland Stanford Junior University | Family of cystatin-related chemoattractant proteins |
| US20070286863A1 (en) * | 2006-05-17 | 2007-12-13 | Christopher Sinal | CMKLR regulation of adipogenesis and adipocyte metabolic function |
| US20090280113A1 (en) * | 2008-05-10 | 2009-11-12 | Kareem Graham | Target for regulating multiple sclerosis |
| WO2012172336A2 (en) * | 2011-06-13 | 2012-12-20 | Ith Immune Therapy Holdings | Treating inflammatory skin diseases |
| WO2019193029A1 (en) * | 2018-04-03 | 2019-10-10 | Ose Immunotherapeutics | Anti-chemokin like receptor 1 antibodies and their therapeutic applications |
Non-Patent Citations (5)
| Title |
|---|
| DATABASE Geneseq [online] 28 November 2019 (2019-11-28), "Anti-CMKLR1 antibody VH region (23_VHvD), SEQ 23.", retrieved from EBI accession no. GSP:BGV89670 Database accession no. BGV89670 * |
| DATABASE Geneseq [online] 28 November 2019 (2019-11-28), "Anti-CMKLR1 antibody VH region (23_VHvE), SEQ 24.", retrieved from EBI accession no. GSP:BGV89671 Database accession no. BGV89671 * |
| DATABASE Geneseq [online] 28 November 2019 (2019-11-28), "Anti-CMKLR1 antibody VL region (13VLvC), SEQ 45.", retrieved from EBI accession no. GSP:BGV89692 Database accession no. BGV89692 * |
| DATABASE Geneseq [online] 28 November 2019 (2019-11-28), "Anti-CMKLR1 antibody VL region (13VLvE), SEQ 47.", retrieved from EBI accession no. GSP:BGV89694 Database accession no. BGV89694 * |
| PEYRASSOL XAVIER ET AL: "Development by Genetic Immunization of Monovalent Antibodies (Nanobodies) Behaving as Antagonists of the Human ChemR23 Receptor", JOURNAL OF IMMUNOLOGY,, vol. 196, no. 6, 1 March 2016 (2016-03-01), pages 2893 - 2901, XP002782559, DOI: 10.4049/JIMMUNOL.1500888 * |
Cited By (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2024028509A2 (en) | 2022-08-05 | 2024-02-08 | Ose Immunotherapeutics | Treatment of an inflammation-associated disease in a patient expressing high chemerin level |
| WO2024028508A2 (en) | 2022-08-05 | 2024-02-08 | Ose Immunotherapeutics | Anti-chemokin like receptor 1 antibody or antigen-binding fragment thereof for use in the treatment of conditions associated with netosis |
| WO2024028509A3 (en) * | 2022-08-05 | 2024-04-18 | Ose Immunotherapeutics | Treatment of an inflammation-associated disease in a patient expressing high chemerin level |
| WO2024028508A3 (en) * | 2022-08-05 | 2024-04-18 | Ose Immunotherapeutics | Anti-chemokin like receptor 1 antibody or antigen-binding fragment thereof for use in the treatment of conditions associated with netosis |
| WO2024200826A1 (en) | 2023-03-30 | 2024-10-03 | Ose Immunotherapeutics | Lipid-based nanoparticle targeted at activated immune cells for the expression of immune cell inhibiting molecule and use thereof |
| WO2024200820A1 (en) | 2023-03-30 | 2024-10-03 | Ose Immunotherapeutics | Method of synthesis of targeted lipid nanoparticle and uses thereof |
| WO2025242836A1 (en) | 2024-05-22 | 2025-11-27 | Ose Immunotherapeutics | Molecules comprising masking linkers and uses thereof for the treatment of auto-immune or inflammatory diseases and disorders |
Also Published As
| Publication number | Publication date |
|---|---|
| CA3156835A1 (en) | 2021-04-15 |
| JP7701915B2 (ja) | 2025-07-02 |
| US12534533B2 (en) | 2026-01-27 |
| MX2022004312A (es) | 2022-08-16 |
| KR20220087466A (ko) | 2022-06-24 |
| CN114786722B (zh) | 2026-04-07 |
| JP2022552490A (ja) | 2022-12-16 |
| JP2025134864A (ja) | 2025-09-17 |
| AU2020365034A1 (en) | 2022-04-21 |
| PE20221413A1 (es) | 2022-09-20 |
| CO2022004545A2 (es) | 2022-07-08 |
| US20240084019A1 (en) | 2024-03-14 |
| IL292029A (en) | 2022-06-01 |
| CR20220155A (es) | 2022-12-15 |
| EP4041302A1 (en) | 2022-08-17 |
| PH12022550844A1 (en) | 2023-06-14 |
| CN114786722A (zh) | 2022-07-22 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20240400698A1 (en) | Anti-chemokin like receptor 1 antibodies and their therapeutic applications | |
| JP6609724B1 (ja) | 抗ヒト4−1bb抗体およびその使用 | |
| EP3297672B1 (en) | Trispecific binding proteins and methods of use | |
| JP7324565B2 (ja) | Cd127に対する抗体 | |
| CN107683289B (zh) | IL13Rα2结合剂和其在癌症治疗中的用途 | |
| US12534533B2 (en) | Anti-chemokine like receptor 1 humanized antibodies and their therapeutic applications | |
| KR20220121850A (ko) | 항-cd73 항체 및 이의 용도 | |
| MX2015002337A (es) | Anticuerpos y vacunas para utilizarse en el tratamiento de canceres por ror1 y para inhibir la metastasis. | |
| WO2011040565A1 (ja) | 抗ポドプラニン抗体、及び抗ポドプラニン抗体を含む医薬組成物 | |
| WO2020063660A1 (zh) | 抗ox40抗体、其抗原结合片段及其医药用途 | |
| KR20230166120A (ko) | 새로운 tnfr2 결합 분자 | |
| CN104093741B (zh) | 小鼠抗Aggrus单克隆抗体 | |
| JP2025519056A (ja) | Klrb1結合剤及びその使用方法 | |
| OA21239A (en) | Anti-chemokin like receptor 1 humanized antibodies and their therapeutic applications. | |
| CN110339364A (zh) | Lgr4/rspo阻断剂与抗免疫检查点抑制剂联合用于肿瘤的免疫治疗 | |
| EA049261B1 (ru) | Гуманизированные антитела против хемокин-подобного рецептора 1 и их терапевтические применения | |
| BR112022006760B1 (pt) | Anticorpo anti-receptor semelhante a quemerina 1 ou fragmentos de ligação ao antígeno do mesmo e usos preventivos ou terapêuticos do mesmo | |
| WO2024028509A2 (en) | Treatment of an inflammation-associated disease in a patient expressing high chemerin level | |
| RU2777573C2 (ru) | Антитела против 4-1bb человека и их применение | |
| WO2023158431A1 (en) | Anti-tnfr2 antibody and application thereof | |
| HK40064939A (en) | Trispecific binding proteins and methods of use | |
| HK40005045B (zh) | 用於治疗ror1癌症并抑制转移的抗体和疫苗 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20789120 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3156835 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: DZP2022000216 Country of ref document: DZ |
|
| ENP | Entry into the national phase |
Ref document number: 2022521452 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: NC2022/0004545 Country of ref document: CO Ref document number: 17767606 Country of ref document: US |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112022006760 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2020365034 Country of ref document: AU Date of ref document: 20201009 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20227015533 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2020789120 Country of ref document: EP Effective date: 20220509 |
|
| ENP | Entry into the national phase |
Ref document number: 112022006760 Country of ref document: BR Kind code of ref document: A2 Effective date: 20220407 |
|
| WWP | Wipo information: published in national office |
Ref document number: NC2022/0004545 Country of ref document: CO |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 522432191 Country of ref document: SA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 522432191 Country of ref document: SA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 522432191 Country of ref document: SA |
|
| WWG | Wipo information: grant in national office |
Ref document number: 202291105 Country of ref document: EA |
|
| WWG | Wipo information: grant in national office |
Ref document number: 522432191 Country of ref document: SA |
|
| WWD | Wipo information: divisional of initial pct application |
Ref document number: 825617 Country of ref document: NZ |
|
| WWG | Wipo information: grant in national office |
Ref document number: 17767606 Country of ref document: US |