WO2021054867A1 - Иммуноцитокин, включающий гетеро димерный белковый комплекс на основе il-15 и il-15rα - Google Patents
Иммуноцитокин, включающий гетеро димерный белковый комплекс на основе il-15 и il-15rα Download PDFInfo
- Publication number
- WO2021054867A1 WO2021054867A1 PCT/RU2020/050233 RU2020050233W WO2021054867A1 WO 2021054867 A1 WO2021054867 A1 WO 2021054867A1 RU 2020050233 W RU2020050233 W RU 2020050233W WO 2021054867 A1 WO2021054867 A1 WO 2021054867A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- immunocytokine
- antibody
- seq
- heavy chain
- amino acid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/19—Cytokines; Lymphokines; Interferons
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/54—Interleukins [IL]
- C07K14/5443—IL-15
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2818—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
- A61K38/1793—Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/19—Cytokines; Lymphokines; Interferons
- A61K38/20—Interleukins [IL]
- A61K38/2086—IL-13 to IL-16
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/715—Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons
- C07K14/7155—Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons for interleukins [IL]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2827—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/515—Complete light chain, i.e. VL + CL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/522—CH1 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/524—CH2 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/526—CH3 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/53—Hinge
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
Definitions
- the present invention relates to an immunocytokine comprising a heterodimeric protein complex based on IL-15 / IL-15Ra and its use as a therapeutic agent, in particular as an agent for the treatment of cancer and autoimmune disease.
- the present invention also relates to an immunocytokine comprising a heterodimeric protein complex based on IL-15 / IL-15Ra and an immunomodulatory antibody, and its use as a therapeutic agent, in particular as an agent for the treatment of cancer and autoimmune disease.
- Cytokines belong to the category of signaling proteins and glycoproteins, which, as hormones and neurotransmitters, are actively used in cellular communication. If hormones are secreted into the bloodstream by certain organs, and neurotransmitters are related to neuronal activity, then cytokines represent a more diverse class of compounds in terms of origin and destination. They are produced by a wide range of hematopoietic and non-hematopoietic cells, and they can affect both nearby cells and the entire body, sometimes showing a strong dependence on the presence of other chemical compounds.
- the cytokine family consists mainly of small water-soluble proteins and glycoproteins ranging from 8 to 30 kDa. Cytokines play a key role in the implementation of innate and acquired immune responses. They are often secreted by immune cells that have met the pathogen to activate and mobilize more cells of the immune system and enhance the immune system's response to the pathogen.
- interleukin 15 is a cytokine with structural similarity to IL-2, secreted by mononuclear phagocytes (and some other cells) in response to infection with the virus (s) or indirect stimulation by cells that are recognized as "not their own” or weakened.
- This cytokine induces the proliferation of natural killer cells; cells that provide innate immunity, the main role of which is to destroy cells infected with the virus.
- the protein encoded by this gene is a cytokine that regulates the activation and proliferation of T cells and natural killer cells.
- Interleukin 15 is a 14-15 kDa glycoprotein that simultaneously belongs to two groups as a factor for activating T cells (Grabstein, K.N. et al., Science 1994, 264, 965; Burton, JD et al. ., Proc. Natl. Acad. Sci. USA 1994, 91, 4935).
- MPHK IL-15 is widely expressed in various cells and tissues, however, it is difficult to detect the protein in these cells or in the cell supernatant due to the strong post-transcriptional control of its expression at the level of translation and intracellular transport (Bamford RN. Et al., J. Immunol. 1998, 160 : 4418-4426; Kurys G, et al., J. Biol.
- IL-15 can exist in active form as a membrane protein (Musso et al., Blood 1999, Vol. 93, No. 10 (May 15),: pp 3531- 3539), and it has recently been observed that it can function either as a ligand or as a receptor (Budalgian et al., JBC 2004, vol 279, No 40: pp 42192-42201), inducing the secretion of proinflammatory cytokines through this pathway. High levels of soluble protein expression have been associated with the pathogenesis of autoimmune and inflammatory diseases. IL-15 has been found in several diseases, including Crohn's disease (Kirman I., 1996, Am.
- IL-15Ra Binding of the ligand to the T cell receptor induces the expression of IL-15Ra and the expression of several activation antigens such as CD69, CD25 and TNFRII.
- IL-15 is a chemoattractant for human blood T lymphocytes (Wilkinson 1995, J. Exp. Med. 181, 1255-1259). All these data indicate that IL-15, expressed by antigen presenting cells, may play an important role in the early activation of T cells at the site of inflammation.
- IL-15 is a member of a small family of cytokines with a bundle of four a-helices.
- the biological effects of IL-15 are mediated through its binding to the cell membrane receptor, which consists of three subunits a, b, and y.
- IL-15Ra is a subunit specific for this cytokine, to which it binds with a very high affinity of Kd 1CK 11 , and can be found as a membrane receptor, or in a soluble form (Budagian V. et al., JBC 2004, 279, 39: 40368-40375; Mortier et al., The Journal of Immunology, 2004, 173: 1681-1688).
- IL-15Roc contains a Sushi domain that is capable of binding to IL-15 and is essential for the biological functions of IL-15 after binding.
- IL-15 has disadvantages due to its low molecular weight, short in vivo half-life, poorly controlled repeated dosing, and is likely to cause systemic immune side effects. There is an urgent need to find an approach that can increase the in vivo half-life and stimulate or enhance the biological activity of IL-15 in vivo.
- the complex formed by IL-15 and its receptor IL-15Ra can significantly enhance the biological activity of IL-15.
- the IL-15 / IL-15Ra complex is more than 10 times stronger than IL-15 alone, stimulating the proliferation of CD8 + memory T lymphocytes and supporting their survival, and the mechanism of this action may be due to cis presentation.
- the experimental data and characteristics of the superagonist in the application W02007046006 are presented only for IL-15 linked by a linker peptide through the N- and C-terminal amino acids of IL-15 with alpha IL-15R.
- the experimental data and characteristics of the superagonist in the application WO2016095642 are presented only for those linked by the chimeric SS bond formed by the Cys mutations in the IL-15 ligand and the alpha IL-15R. Both variants provide no evidence for the activity and physicochemical characteristics of IL15 superagonist variants containing fusion protein domains linked by SS bond / s or without SS bridges.
- a heterodimeric IL-15 agonist protein consisting of protein (I) and protein (II), where said protein (I) is formed by IL-15 fused with the first Fc variant , wherein the first Fc variant is linked to the C-terminus of IL-15, and said protein (II) is a second Fc variant or is formed by IL-15Ra or a variant thereof fused with the second Fc variant, wherein the second Fc variant is linked to the C-terminus of IL -15Ra.
- Protein (I) and protein (II) form a stable heterodimeric protein by interacting with the formation of a "protrusion (Knob) in the hole (Hole)" between the first Fc variant and the second Fc variant.
- immunocytokines based on IL-15 are of particular interest for combining the beneficial properties of tumor-specific antibodies targeting tumors with the immunomodulatory effect of interleukin 15.
- an immunocytokine for the treatment of cancer which contains a conjugate and an antibody or a fragment thereof, which is selected from the group consisting of a Fab fragment, Fab 'fragment, F (ab') 2 fragment, Facb, Fd, and scFv, where said the conjugate comprises a polypeptide comprising the amino acid sequence of interleukin 15 and a polypeptide comprising the amino acid sequence of the sushi domain of IL-15Ra.
- the conjugate and the antibody or its fragment are covalently linked using bifunctional cross-linking agents that allow the attachment of proteins.
- an IL-15 / IL-15Ra fusion protein which includes an IL-15Ra protein, an IL-15 protein and a first Fc domain; and an antigen binding domain monomer that binds an antigen selected from the group consisting of human CD8, human NKG2A, and human NKG2D containing a heavy chain comprising a CN-CH1-hinge-CH2-CH3 monomer, wherein VH is a heavy chain variable domain, and CH2-CH3 is a second Fc domain, and the light chain contains a variable light chain (VL) and a light constant domain (CL), wherein said first and said second Fc domains have a set of amino acid substitutions selected from the group consisting of S267K / L368D / K370S: S267K / S364K / E357Q;
- the novel immunocytokine format developed by the present inventors which includes heterodimeric molecules based on IL-15 and IL-15Ra, exhibits higher stability, increased productivity in mammalian cells, prolonged half-life in vivo and increased biological activity in vivo. In addition, they represent a universal format for a bispecific immunocytokine with the property of IL15 activity.
- the new immunocytokine format developed by the authors of this invention has reduced toxicity according to the results of preclinical studies.
- the present invention provides an immunocytokine for stimulating the activation and / or proliferation of IL-15Pbeta / gamma-positive cells, which comprises a heterodimeric protein complex based on IL-15 and IL-15Ra, comprising:
- IL-15Ra which is linked to a) the constant domain of the light chain of the antibody, or b) the constant domains of the heavy chain of the antibody, including the first (CH1) constant domain of the heavy chain and the monomer of the Fc fragment containing the second (CH2) and third (CH3) heavy chain constant domains;
- IL-15 which is associated with a) constant domains of the heavy chain of the antibody, including the first (CH1) constant domain of the heavy chain and the monomer Fc- a fragment containing the second (CH2) and third (CH3) constant domains of the heavy chain, or b) the constant domain of the light chain of an antibody; wherein the first constant domain of the heavy chain of the antibody and the constant domain of the light chain of the antibody in the heterodimeric complex have or do not have a covalent association through the natural SS bridge and, where, if IL-15 or IL-15Ra is linked to the constant domain of the light chain of the antibody, then the other a portion of the heterodimeric protein complex selected from IL-15Ra or IL-15 is linked to the constant domains of the antibody heavy chain.
- the immunocytokine comprises an antibody heavy chain first constant domain and an antibody light chain constant domain in a heterodimeric complex that are covalently associated through a natural S-S bridge.
- the immunocytokine comprises a first antibody heavy chain constant domain and an antibody light chain constant domain in a heterodimeric complex that are not covalently associated through a natural S-S bridge.
- the immunocytokine comprises an antibody light chain constant domain selected from CK or CL.
- the immunocytokine comprises an IL-15Ra with the amino acid sequence represented by SEQ ID NO: 9, or any known mutated IL-15Ra variant with similar biological activity.
- the immunocytokine comprises IL-15, which has an amino acid sequence that is represented by SEQ ID NO: 10, or any known mutated IL-15 variant with similar biological activity.
- the immunocytokine comprises IL-15Ra that is linked to an antibody light chain constant domain.
- the immunocytokine comprises an IL-15Ra linked to an antibody light chain constant domain that has an amino acid sequence that is represented by SEQ ID NO: 1 or SEQ ID NO: 19.
- the immunocytokine comprises IL-15 that is linked to an antibody light chain constant domain.
- the immunocytokine comprises IL-15 linked to an antibody light chain constant domain that has an amino acid sequence that is represented by SEQ ID NO: 3 or SEQ ID NO: 21.
- the immunocytokine comprises a first (CH1) heavy chain constant domain and an Fc fragment monomer comprising a second (CH2) and third (CH3) heavy chain constant domains that are hinged.
- the immunocytokine comprises IL-15 or IL-15Ra that is linked to antibody heavy chain constant domains in the following order CH1-hinge-CH2-CH3.
- the immunocytokine comprises IL-15Ra that is linked to the constant domains of an antibody heavy chain.
- the immunocytokine comprises IL-15Ra linked to antibody heavy chain constant domains that have an amino acid sequence that is represented by SEQ ID NO: 4 or SEQ ID NO: 22.
- the immunocytokine comprises IL-15 that is linked to the constant domains of an antibody heavy chain.
- the immunocytokine comprises IL-15 linked to antibody heavy chain constant domains that have an amino acid sequence that is represented by SEQ ID NO: 2 or SEQ ID NO: 20.
- the immunocytokine comprises:
- IL-15Ra associated with the constant domain of the light chain of antibodies that have the amino acid sequence that is represented by SEQ ID NO: 1 or SEQ ID NO: 19, and
- IL-15 linked to antibody heavy chain constant domains that have the amino acid sequence represented by SEQ ID NO: 2 or SEQ ID NO: 20.
- the immunocytokine comprises:
- IL-15Ra linked to antibody heavy chain constant domains that have the amino acid sequence represented by SEQ ID NO: 4 or SEQ ID NO: 22, and
- IL-15 associated with the constant domain of the light chain of antibodies that have the amino acid sequence that is represented by SEQ ID NO: 3 or SEQ ID NO: 21.
- the immunocytokine has mutations in the monomer of the Fc fragment, resulting in the lack of ADCC, CDC and / or ADCP properties of the specified immunocytokine.
- the immunocytokine comprises an Fc portion that is IgG.
- the immunocytokine comprises an Fc fragment selected from the group of human IgGl, IgG2, or IgG4.
- the immunocytokine comprises the above two heterodimeric protein complexes based on IL-15 and IL-15Ra.
- the immunocytokine is used as a therapeutic agent for cancer or autoimmune disease.
- the immunocytokine is used as a therapeutic agent for cancer therapy.
- the present invention relates to an immunocytokine for stimulating the activation and / or proliferation of IL-15Bbeta / gamma-positive cells, which includes a heterodimeric protein complex based on IL-15 and IL-15Ra and an immunomodulatory antibody or antigen-binding fragment thereof that specifically inhibit PD-1 pathway, where the heterodimeric protein complex based on IL-15 and IL-15Roc contains:
- IL-15Roc which is linked to a) the constant domain of the light chain of the antibody, or b) the constant domains of the heavy chain of the antibody, including the first (CH1) constant domain of the heavy chain and the monomer of the Fc fragment containing the second (CH2) and third (CH3) heavy chain constant domains;
- IL-15 which is associated with a) constant domains of the heavy chain of the antibody, including the first (CH1) constant domain of the heavy chain and the monomer of the Fc fragment containing the second (CH2) and third (CH3) constant domains of the heavy chain, or b) the constant domain of the light chain of the antibody; wherein the first constant domain of the heavy chain of the antibody and the constant domain of the light chain of the antibody in the heterodimeric complex have or do not have a covalent association through the natural SS bridge and, where, if IL-15 or IL-15Roc is linked to the constant domain of the light chain of the antibody, then the other a portion of the heterodimeric protein complex selected from IL-15Ra or IL-15 is linked to the constant domains of the antibody heavy chain.
- the immunocytokine comprises an antibody heavy chain first constant domain and an antibody light chain constant domain in a heterodimeric complex that are covalently associated through a natural S-S bridge.
- the immunocytokine comprises a first antibody heavy chain constant domain and an antibody light chain constant domain in a heterodimeric complex that are not covalently associated through a natural S-S bridge.
- the immunocytokine comprises an antibody light chain constant domain selected from CK or CL.
- the immunocytokine comprises IL-15Ra, which has the amino acid sequence that is represented by SEQ ID NO: 9, or any known mutated IL-15Ra variant with similar biological activity.
- the immunocytokine comprises IL-15, which has an amino acid sequence that is represented by SEQ ID NO: 10, or any known mutated IL-15 variant with similar biological activity.
- the immunocytokine comprises IL-15Ra that is linked to an antibody light chain constant domain.
- the immunocytokine comprises an IL-15Ra linked to an antibody light chain constant domain that has an amino acid sequence that is represented by SEQ ID NO: 1 or SEQ ID NO: 19.
- the immunocytokine comprises IL-15 that is linked to an antibody light chain constant domain.
- the immunocytokine comprises IL-15 linked to an antibody light chain constant domain that has an amino acid sequence that is represented by SEQ ID NO: 3 or SEQ ID NO: 21.
- the immunocytokine comprises a first (CH1) heavy chain constant domain and an Fc fragment monomer comprising a second (CH2) and third (CH3) heavy chain constant domains that are hinged.
- the immunocytokine comprises IL-15 or IL-15Ra that is linked to antibody heavy chain constant domains in the following order CH1-hinge-CH2-CH3.
- the immunocytokine comprises IL-15Ra that is linked to the constant domains of an antibody heavy chain. In some embodiments, the immunocytokine comprises IL-15Ra linked to antibody heavy chain constant domains that have an amino acid sequence that is represented by SEQ ID NO: b or SEQ ID NO: 24.
- the immunocytokine comprises IL-15 that is linked to the constant domains of an antibody heavy chain.
- the immunocytokine comprises IL-15 linked to antibody heavy chain constant domains that have an amino acid sequence that is represented by SEQ ID NO: 5 or SEQ ID NO: 23.
- the immunocytokine comprises an immunomodulatory antibody, or antigen-binding fragment thereof, that specifically inhibits the PD-1 pathway, and is an antibody that specifically binds to PD-1.
- the immunocytokine comprises an immunomodulatory antibody that includes: a) a light chain comprising a light chain variable domain and a light chain constant domain; b) a heavy chain containing the variable domain of the heavy chain and constant domains of the heavy chain of the antibody, including the first (CH1) constant domain of the heavy chain and the monomer of the Fc fragment containing the second (CH2) and third (CH3) constant domains of the heavy chain.
- the immunocytokine comprises a light chain variable domain that includes LCDRs 1, 2, and 3 (hypervariable regions 1, 2, and 3), which are represented by the amino acid sequences of SEQ ID NO: 14, SEQ ID NO: 15, and SEQ ID NO, respectively. : 16.
- the immunocytokine comprises a light chain variable domain that includes the amino acid sequence that is represented by SEQ ID NO: 18.
- the immunocytokine comprises a heavy chain variable domain that includes HCDRs 1, 2, and 3 (hypervariable regions 1, 2, and 3), which are represented by the amino acid sequences of SEQ ID NO: 11, SEQ ID NO: 12, and SEQ ID NO, respectively. : thirteen.
- the immunocytokine comprises a heavy chain variable domain that includes the amino acid sequence that is represented by SEQ ID NO: 17.
- the immunocytokine comprises:
- variable domain of the light chain which includes LCDRs 1, 2 and 3 (hypervariable regions 1, 2 and 3), which, respectively, are represented by the amino acid sequences of SEQ ID NO: 14, SEQ ID NO: 15 and SEQ ID NO: 16;
- variable domain of the heavy chain which includes HCDRs 1, 2 and 3 (hypervariable regions 1, 2 and 3), which, respectively, are represented by the amino acid sequences of SEQ ID NO: 11, SEQ ID NO: 12 and SEQ ID NO: 13.
- the immunocytokine comprises:
- variable domain of the light chain which includes the amino acid sequence that is represented by SEQ ID NO: 18
- variable domain of the heavy chain which includes the amino acid sequence that is represented by SEQ ID NO: 17.
- the immunocytokine comprises an immunomodulatory antibody that includes a light chain comprising the amino acid sequence that is represented by SEQ ID NO 8.
- the immunocytokine comprises an immunomodulatory antibody that comprises a heavy chain comprising the amino acid sequence represented by SEQ ID NO 7.
- the immunocytokine comprises an immunomodulatory antibody that includes: a heavy chain comprising the amino acid sequence represented by SEQ ID NO 7; light chain containing the amino acid sequence that is represented by SEQ ID NO 8.
- the immunocytokine comprises an immunomodulatory antibody, or antigen binding fragment thereof, that specifically inhibits the PD-1 pathway, which is an antibody that specifically binds to PD-L1.
- the immunocytokine comprises: a) a heterodimeric protein complex based on IL-15 and IL-15Ra, which comprises:
- IL-15Ra associated with the constant domain of the light chain of antibodies that have the amino acid sequence that is represented by SEQ ID NO: 1 or SEQ ID NO: 19, and
- IL-15 associated with constant domains of the heavy chain of an antibody that have the amino acid sequence that is represented by SEQ ID NO: 5 or SEQ ID NO: 23; b) an immunomodulatory antibody that includes: a heavy chain containing the amino acid sequence that is represented by SEQ ID NO 7; light chain containing the amino acid sequence that is represented by SEQ ID NO 8.
- the immunocytokine comprises: a) IL-15Ra linked to antibody heavy chain constant domains that have an amino acid sequence that is represented by SEQ ID NO: b or SEQ ID NO: 24, a
- IL-15 associated with the constant domain of the light chain of antibodies that have the amino acid sequence that is represented by SEQ ID NO: 3 or SEQ ID NO: 21; b) an immunomodulatory antibody that includes: a heavy chain containing the amino acid sequence that is represented by SEQ ID NO 7; light chain containing the amino acid sequence that is represented by SEQ ID NO 8.
- the immunocytokine has mutations in the constant domains of the antibody, causing heterodimerization of two different parts, one of which includes covalently or non-covalently associated IL-15Ra associated with the constant domains of the antibody, and IL-15 associated with the constant domain antibodies, and the other includes covalently or non-covalently associated light and heavy chains of antibodies.
- the immunocytokine comprises: a first Fc monomer and a second Fc monomer that are selected from the group: the first Fc monomer is Fc modified to form Knob and the second Fc monomer is Fc modified to form Hole, or when the second Fc monomer is is Fc modified to form Knob and the first monomer Fc is Fc modified to form Hole.
- the immunocytokine comprises a first Fc monomer that has S354C / T366W amino acid substitutions and a second Fc monomer that has Y349C / T366S / L368A / Y407V amino acid substitutions.
- the immunocytokine comprises a first Fc monomer that has Y349C / T366S / L368A / Y407 amino acid substitutions and a second Fc monomer that has S354C / T366W amino acid substitutions.
- the immunocytokine comprises an Fc portion that is IgG.
- an immunocytokine wherein the isotype of the Fc fragment is selected from the group: human IgGl, IgG2, or IgG4.
- the immunocytokine comprises mutations in an Fc fragment monomer resulting in the lack of ADCC, CDC, and / or ADCP properties of said immunocytokine.
- the immunocytokine is used to treat cancer or autoimmune disease.
- the immunocytokine is used to treat cancer.
- the present invention provides an isolated nucleic acid that encodes any of the above immunocytokines.
- the nucleic acid is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoe
- the present invention relates to an expression vector that contains the above nucleic acid.
- the present invention relates to a method for producing a host cell for producing the aforementioned immunocytokine, which comprises transforming the cell with the aforementioned vector.
- the present invention relates to a host cell for producing the above immunocytokine, which contains the above nucleic acid.
- the present invention relates to a method for preparing a preparation containing the above immunocytokine, which consists in culturing the above host cell in a culture medium under conditions sufficient to obtain said immunocytokine, if necessary, followed by isolation and purification of the resulting immunocytokine.
- the present invention provides a pharmaceutical composition for stimulating the activation and / or proliferation of IL-15B beta / gamma-positive cells, which contains the above immunocytokine in a therapeutically effective amount, in combination with one or more pharmaceutically acceptable excipients.
- the pharmaceutical composition is used to treat an oncological or autoimmune disease.
- the pharmaceutical composition is used to treat cancer.
- the pharmaceutical composition is used to treat an oncological disease that is selected from the group: PSCH (squamous cell carcinoma of the head and neck), cervical cancer, cancer without an identified primary source, glioblastoma, esophageal cancer, bladder cancer, TNBC (triple negative breast cancer ), Colorectal cancer (colorectal cancer), hepatocellular carcinoma, melanoma, NSCLC (non-small cell lung cancer), kidney cancer, ovarian cancer, MSI colorectal cancer with high microsatellite instability, leukemia (acute or myeloblastic), lymphoma, multiple myeloma , breast cancer, colorectal cancer, prostate cancer, bladder cancer, sarcoma, hepatocellular carcinoma, glioblastoma, Hodgkin's lymphoma, T- and B-cell acute lymphoblastic leukemia, small cell lung cancer, acute myeloblastic leukemia, refractory B-cell lymphoma ,
- PSCH
- the present invention relates to a method of treating cancer, which comprises administering to a subject in need of such treatment, the aforementioned immunocytokine or the aforementioned pharmaceutical composition in a therapeutically effective amount.
- the oncological disease is selected from the group: PRGS (squamous cell carcinoma of the head and neck), cervical cancer, cancer without an identified primary source, glioblastoma, esophageal cancer, bladder cancer, TNBC (triple negative breast cancer), CRC ( colorectal cancer), hepatocellular carcinoma, melanoma, NSCLC (non-small cell lung cancer), kidney cancer, ovarian cancer, MSI CRC (highly microsatellite instable colorectal cancer), leukemia (acute or myeloblastic), lymphoma, multiple myeloma, breast melanoma , colorectal cancer, prostate cancer, bladder cancer, sarcoma, hepatocellular carcinoma, glioblastoma, Hodgkin's lymphoma, T- and B-cell acute lymphoblastic leukemia, small cell lung cancer, acute myeloblastic leukemia, refractory B-cell lymphom
- PRGS squamous
- the present invention provides a method for activating a biological activity of a T cell population or NK cell population in a subject in need of such activation, which comprises administering to the subject an effective amount of the aforementioned immunocytokine or the aforementioned pharmaceutical composition.
- the present invention relates to the use of the aforementioned immunocytokine or the aforementioned pharmaceutical composition for treating an oncological disease in a subject in need of such treatment.
- the oncological disease is selected from the group: SCC (head and neck squamous cell carcinoma), cervical cancer, cancer without an identified primary source, glioblastoma, esophageal cancer, bladder cancer, TNBC (triple negative breast cancer), CRC (colorectal cancer), hepatocellular carcinoma, melanoma, NSCLC (non-small cell lung cancer), kidney cancer, ovarian cancer, MSI CRC (highly microsatellite instable colorectal cancer), leukemia (acute or myeloblastic), lymphoma, multiple myeloma, melanoma, breast cancer colorectal cancer, prostate cancer, bladder cancer, sarcoma, hepatocellular carcinoma, glioblastoma, Hodgkin's lymphoma, T- and B-cell acute lymphoblastic leukemia, small cell lung cancer, acute myeloblastic leukemia, refractory B-cell, non-Hodgkin's lympho
- FIG. 1 Format of immunocytokine, including a heterodimeric protein complex based on IL-15 and IL-15Ra
- FIG. 2 Format of immunocytokine, including a heterodimeric protein complex based on IL-15 and IL-15Ra
- FIG. 3 Format of immunocytokine, which includes a heterodimeric protein complex based on IL-15 and IL-15Ra and an immunomodulatory antibody that specifically inhibits the PD-1 pathway (Fab-
- knob is meant mutations to form a Knob-to-Hole structure between the first Fc variant and the second Fc variant in the CH3 domain.
- FIG. 4 Format of immunocytokine, which includes a heterodimeric protein complex based on IL-15 and IL-15R and an immunomodulatory antibody that specifically inhibits the PD-1 pathway (Fab-
- knob is meant mutations to form a Knob-to-Hole structure between the first Fc variant and the second Fc variant in the CH3 domain.
- FIG. 5 Vector pEE-IL15Ra-CK.
- AmpR - beta-lactamase gene providing ampicillin resistance, pUC origin- pUC origin of replication in bacteria
- IL15Ra gene encoding subunit a of interleukin 15 receptor
- FIG. 6 Vector pEE-IL15-CH1-Fc-LALA.
- AmpR - beta-lactamase gene providing ampicillin resistance, pUC origin- pUC origin of replication in bacteria
- CH1 - gene encoding the first constant domain of the heavy chain Fc-LALA - gene encoding an Fc fragment with LALA mutations (L234A and L235A mutations in the constant domain of CH2 Fc fragment),
- FIG. 7 Vector pEE-BCDl00-02-VL-CK.
- AmpR - beta-lactamase gene providing ampicillin resistance, pUC origin- pUC origin of replication in bacteria
- CMV-Promoter - promoter of early cytomegalovirus genes leader-leader sequence, aPDl-VL- gene encoding the light chain of an antibody that specifically binds to PD1,
- FIG. 8 Vector pEE-BCD100-02-VH-CHl-Fc-hole-LALA.
- AmpR - beta-lactamase gene providing resistance to ampicillin, pUC origin- pUC origin of replication in bacteria, promoter - promoter of early cytomegalovirus genes, leader-leader sequence, aPDl-VH- gene encoding the variable domain of the heavy chain of an antibody that specifically binds to PD1,
- CH1 is the gene encoding the first constant domain of the heavy chain
- Fc-hole-LALA is the gene encoding the Fc fragment with mutations for the formation of hole
- LALA L234A and L235A mutations in the constant CH2 domain of the Fc fragment
- FIG. 9 Vector pEE-IL15-CHl-Fc-knob-LALA.
- AmpR - beta-lactamase gene providing ampicillin resistance, pUC origin- pUC origin of replication in bacteria
- FIG. 10 A SDS-gel electrophoresis with beta-mercaptoethanol
- FIG. 10 B SDS-gel electrophoresis without beta-mercaptoethanol 1.Purified CK_IL15Ra_Hc_IL15CHlFcLALA 10 ⁇ l 2.Purified CK_IL15_Hc_IL15RaCHlFcLALA 10 ⁇ l
- FIG. 11 Test to determine the proliferation activity.
- the cell line NK-92 was used for the test. The test was carried out in a 9b-well culture plate. The suspension contained NK-92 cells, the test antibody at the concentration indicated in the graph. All components of the suspension were prepared in RPMI-1640 medium containing fetal bovine serum and glutamine. After adding all components, the plates were incubated at 37 ° C, 5% CO2. Then Alamar Blue dye was added to the wells. After incubation, the fluorescence intensity in the wells was measured.
- FIG. 12 Test to determine the proliferation activity.
- isolated natural killer cells were used, isolated from PBMCs of healthy donors by the method of negative selection. The test was carried out in a 96-well culture plate. The suspension contained natural killer cells, the studied antibody in the indicated on the graph concentration. All components of the suspension were prepared in a culture medium containing autologous human plasma. After adding all components, the plates were incubated at 37 ° C, 5% CO2. Then Alamar Blue dye was added to the wells. After incubation, the fluorescence intensity in the wells was measured.
- FIG. 13 Test to determine aPDl special, activity.
- the test used the Jurkat NFAT-FLuc PD-1 cell line, created on the basis of the Jurkat cell line, stably expressing PD-1 on the surface and containing the gene encoding firefly luciferase under the control of the NFAT promoter; and the Raji PDL1 cell line, based on the Raji cell line, stably expressing PDL1 on the surface.
- the test was carried out in a 96-well culture plate.
- the suspension in each well contained Jurkat NFAT-FLuc PD-1 cells, Raji PDL1 cells, aCD3 / aTAAl at a concentration of 1 ng / ml, the test antibody at the concentration indicated in the graph. After adding all the components, the plates were incubated at 37 ° C, 5% CO2 and then, using a kit for assessing luminescence, the intensity of Lucifer in the wells was measured.
- FIG. 14 Analysis of the specific activity of aHTH-PDLl / IL15SA antibodies on a reporter cell line.
- FIG. 15. Test to determine the effect on ADCC of natural killer cells.
- the test was carried out in a 96-well culture plate.
- the suspension contained natural killer cells and Raji cells, the effector antibody Rituximab and the test antibody at the concentration indicated in the graph. All components of the suspension were prepared in a culture medium containing fetal bovine serum and glutamine. After adding all components, the plates were incubated at 37 ° C, 5% CO2. Next, the culture fluid was collected and the content of lactate dehydrogenase was investigated using a kit for determining the LDH.
- FIG. 16 Results of testing the specific activity of immunocytokines to enhance the ADCC ability of rituximab against the TAA reporter line.
- FIG. 17 Study of cytotoxicity for variants of immunocytokine, including a heterodimeric protein complex based on IL-15 and IL-15Ra (IL15SA), on NK cells.
- immunocytokine including a heterodimeric protein complex based on IL-15 and IL-15Ra (IL15SA), on NK cells.
- results indicate the absence of a significant cytotoxic effect of the candidates, that is, no more than 10% decrease in the number of immunoreactive cells in comparison with negative control AB (absence of any exogenous antibodies).
- FIG. 18 Investigation of cytotoxicity for IL15SA variants on B cells.
- results indicate the absence of a significant cytotoxic effect of the candidates, that is, no more than 10% decrease in the number of immunoreactive cells in comparison with negative control AB (absence of any exogenous antibodies).
- FIG. 19 Study of cytotoxicity for IL15SA variants on CD3 + cells. The results indicate the absence of a significant cytotoxic effect of the candidates, that is, no more than 10% decrease in the number of immunoreactive cells in comparison with the negative control AB (absence of any exogenous antibodies).
- FIG. 20 Study of cytotoxicity for IL15SA variants on CD4 + cells.
- results indicate the absence of a significant cytotoxic effect of the candidates, that is, no more than 10% decrease in the number of immunoreactive cells in comparison with negative control AB (absence of any exogenous antibodies).
- FIG. 21 Study of cytotoxicity for IL15SA variants on CD8 + cells.
- results indicate the absence of a significant cytotoxic effect of the candidates, that is, no more than 10% decrease in the number of immunoreactive cells in comparison with negative control AB (absence of any exogenous antibodies).
- FIG. 22 Chromatogram. This chromogram demonstrates high homogeneity (the content of aggregates in the solution was no more than 5%) of immunocytokine, which includes a heterodimeric protein complex based on IL-15 and IL-15Roc (IL15 superagonist).
- FIG. 23 Scheme of an experiment to determine the antitumor activity of immunocytokine preparations, including a heterodimeric protein complex based on IL-15 and IL-15Ra (BCD-225) in an in vivo mouse tumor model.
- FIG. 24 Results of an experiment to determine the antitumor activity of variants of an immunocytokine preparation, including a heterodimeric protein complex based on IL-15 and IL-15Roc (BCD-225) (graph) in an in vivo mouse tumor model.
- FIG. 25 Results of an experiment to determine the antitumor activity of variants of an immunocytokine preparation, including a heterodimeric protein complex based on IL-15 and IL-15Roc (BCD-225) (diagram) in an in vivo mouse tumor model.
- biologically active and biological activity and “biological characteristics”, in relation to a polypeptide of this invention, mean having the ability to bind to a biological molecule.
- recombinant protein means a protein (polypeptide) that is expressed in a cell or cell line containing a nucleotide sequence (nucleotide sequences) that encodes the protein, while the specified nucleotide sequence (nucleotide sequences) is not associated with the cell in nature.
- bispecific antibody means an antibody containing an antigen binding domain or antigen binding domains that are capable of specifically binding to two different epitopes on one biological molecule or capable of specific binding to epitopes on two different biological molecules.
- a bispecific antibody is also referred to herein as being “dual specific” or as being “dual specific”.
- the term "monoclonal antibody” or “tAb” refers to an antibody that is synthesized and isolated by a separate clonal population of cells.
- the clonal population may be a clonal population of immortalized cells.
- the immortalized cells in the clonal population are hybrid cells, hybridomas, which are typically obtained by fusion of individual B lymphocytes from immunized animals with individual lymphocytic tumor cells.
- Hybridomas are a type of engineered cell and do not occur in nature.
- Ka refers to the rate of association of a particular antibody-antigen interaction.
- KB refers to the rate of dissociation of a particular antibody-antigen interaction.
- Binding affinity generally refers to the strength of the cumulative non-covalent interactions between a single binding site of a molecule (eg, an antibody) and its binding partner (eg, an antigen). Unless otherwise indicated, "binding affinity” refers to the intrinsic (intrinsic, true) binding affinity that reflects a 1: 1 interaction between members of a binding pair (eg, antibody and antigen).
- the affinity of a molecule X to its partner Y can usually be represented by a constant dissociation (KB).
- the KB value is about 200 nM, 150 nM, 100 nM, 60 nM, 50 nM, 40 nM, 30 nM, 20 nM, 10 nM, 8 nM, b nM, 4 nM, 2 nM, 1 nM or less.
- Affinity can be measured by conventional methods known in the art, including those described herein. Various methods for measuring binding affinity are known in the art, any of these methods can be used for the purposes of the present invention.
- peptide linker in this document means any peptide with the ability to connect domains with a length of depending on the domains that it binds to each other, containing any amino acid sequence.
- the peptide linker is more than 5 amino acids in length and consists of any set of amino acids selected from G, A, S, P,
- in vitro refers to a biological object, biological process or biological response outside the body, simulated under artificial conditions.
- in vitro cell growth should be understood as the growth of cells in an environment outside the body, for example, in a test tube, culture flask or microplate.
- the present invention relates to an immunocytokine for stimulating the activation and / or proliferation of IL-15beta / gamma-positive cells, which includes a heterodimeric protein complex based on IL-15 and IL-15Ra, comprising:
- IL-15Ra which is linked to a) the constant domain of the light chain of the antibody, or b) the constant domains of the heavy chain of the antibody, including the first (CH1) constant domain of the heavy chain and the monomer of the Fc fragment containing the second (CH2) and third (CH3) heavy chain constant domains;
- IL-15 which is associated with a) constant domains of the heavy chain of the antibody, including the first (CH1) constant domain of the heavy chain and the monomer of the Fc fragment containing the second (CH2) and third (CH3) constant domains of the heavy chain, or b) constant domain of the light chain of the antibody; the first constant domain of the heavy chain of the antibody and the constant domain of the light chain of the antibody in the heterodimeric complex have or do not have a covalent association through the natural S-S bridge and, where, if IL-15 or IL-15Ra is linked to the constant domain of the light chain of the antibody, then another portion of the heterodimeric protein complex, selected from IL-15Ra or IL-15, is linked to the constant domains of the antibody heavy chain.
- immunocytokine refers to a molecule containing an antibody or its fragments, directly or indirectly linked through a covalent bond with a cytokine or its derivatives.
- the specified antibody and the specified cytokine can be linked using a linker peptide.
- An immunocytokine according to the invention is intended to mean an isolated immunocytokine.
- immunocytokine as used to describe the various immunocytokines as used herein, means an immunocytokine identified and isolated and / or regenerated from the cell or cell culture in which it is expressed. Contaminants (contaminants) from the natural environment are materials that typically interfere with diagnostic or therapeutic uses for a polypeptide, and may include enzymes, hormones, and other proteinaceous or non-proteinaceous solutes.
- the immunocytokine is purified (1) to an extent sufficient to obtain at least 15 residues of the N-terminal or internal amino acid sequence using a rotating glass cup sequencer (Edman sequencer), or (2) to homogeneity by SDS-PAGE under non-reducing or reducing conditions using Coomassie brilliant blue or preferably silver staining.
- An isolated immunocytokine comprises an immunocytokine in situ within recombinant cells since at least one component of the polypeptide's natural environment is absent.
- an isolated polypeptide is obtained from at least one purification step.
- heterodimeric protein complex refers to a protein formed by the combination of IL-15 and IL-15Ra.
- IL-15 can be any IL-15 (interleukin-15) or a mutant form thereof, such as human or mammalian IL-15, different human, or non-mammalian IL-15.
- Illustrative non-human mammals include mammals such as pigs, rabbits, monkeys, chimpanzees, mice, and the like; non-mammals include chickens and the like.
- the mature human interleukin-15 molecule is found in the UniProtKB database, accession number P40933, 49-162aa.
- the term "IL-15 variant” refers to a variant molecule having increased or decreased affinity for its receptor, or increased or decreased activity when stimulating T cells or NK cells as a result of one or more amino acid substitutions, additions or divisions.
- IL-15Rco> means the a subunit of the interleukin 15 receptor and, according to the present invention, can be any IL-15Ra compound or functional fragment thereof, such as human IL-15Roc or non-human mammalian IL-15Ra, or IL-15R not a mammal.
- Illustrative non-human mammals include mammals such as pigs, rabbits, monkeys, chimpanzees, mice, and the like; non-mammals include chickens and the like.
- the preferred IL-15Ra molecule is found in the UniProt database, accession number Q13261 (https: //www,uniprot.org/uniprot/Q13261).
- a crystallizable fragment of immunoglobulin (English, fragment crystallizable region, Fc region, Fc) is the terminal part of an immunoglobulin molecule that interacts with the Fc receptor on cell surface and with some proteins of the complement system. This property allows antibodies to activate the immune system.
- Fc-region of IgG, IgA and IgD isotypes consists of two identical protein fragments, respectively, the second and third constant domains of two heavy chains; in the case of IgM and IgE isotypes, Fc contains three heavy chain constant domains (CH2, CH3 and CH4 domains) in each polypeptide chain.
- Fc fragment monomer an Fc region from the second and third constant domains of either one of the two heavy chains (for IgG, IgA and IgD isotypes); in the case of IgM and IgE isotypes, the Fc monomer contains three constant domains of one of the two heavy chains (CH2, CH3, and CH4 domains).
- the immunocytokine comprises an antibody heavy chain first constant domain and an antibody light chain constant domain in a heterodimeric complex that are covalently associated through a natural S-S bridge.
- the immunocytokine comprises a first antibody heavy chain constant domain and an antibody light chain constant domain in a heterodimeric complex that are not covalently associated through a natural S-S bridge.
- the immunocytokine comprises an antibody light chain constant domain selected from CK or CL.
- lambda l
- kappa k
- CL constant domain of the lambda light chain
- CK CK
- the immunocytokine comprises IL-15Ra with an amino acid sequence that is DTCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCI RDPALVHQRPAPPSTVASSTAGVTPQPESLSPSGK-known variant;
- IL-15Ra that contains mutations with a similar biological activity to IL-15Ra means any IL-15Ra known in the art that contains mutations and has a similar biological activity to "wild type" IL-15Ra.
- the immunocytokine comprises IL-15, which has an amino acid sequence that is represented by DNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTV ENLIILANDSLSSNGNVTESGCKECEELEEKNTSIVFLQS
- IL-15 that contains mutations with a similar biological activity to IL-15 is meant any IL-15 known in the art that contains mutations and has a similar biological activity to "wild type” IL-15.
- the immunocytokine comprises IL-15Ra that is linked to an antibody light chain constant domain.
- the immunocytokine comprises IL-15Ra linked to an antibody light chain constant domain that has an amino acid sequence that is represented by DTCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCI RDPALVHQPSGVPAPPS SGTASW CLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHK VYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 1).
- the immunocytokine includes IL-15Ra, associated with the constant domain of antibody light chain having the amino acid sequence of which is represented DTCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCI RDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSGAEGGGRTVAAPSVFIFPPSDEQLK SGTASW CLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHK VYACEVTHQGLSSPVTKSFNRGEA (SEQ ID NO: 19).
- the amino acid sequence shown by SEQ ID NO: 19 differs from the amino acid sequence shown by SEQ ID NO: 1 by one amino acid substitution of Cysteine (C) to Alanine (A) at position 216. This substitution produces an immunocytokine that includes the first constant an antibody heavy chain domain and an antibody light chain constant domain in a heterodimeric complex that do not have a covalent association through the natural SS bridge.
- the immunocytokine comprises IL-15 that is linked to an antibody light chain constant domain.
- the immunocytokine comprises IL-15 linked to an antibody light chain constant domain that has an amino acid sequence that is
- the immunocytokine comprises IL-15 linked to an antibody light chain constant domain that has an amino acid sequence that is
- the amino acid sequence shown by SEQ ID NO: 21 differs from the amino acid sequence shown by SEQ ID NO: 3 by one amino acid substitution of Cysteine (C) to Alanine (A) at position 233. This substitution produces an immunocytokine that includes the first constant an antibody heavy chain domain and an antibody light chain constant domain in a heterodimeric complex that do not have a covalent association through the natural SS bridge.
- the immunocytokine comprises a first (CH1) heavy chain constant domain and an Fc fragment monomer comprising a second (CH2) and third (CH3) heavy chain constant domains that are hinged.
- the immunocytokine comprises IL-15 or IL-15Ra that is linked to antibody heavy chain constant domains in the following order CH1-hinge-CH2-CH3.
- the immunocytokine comprises IL-15Ra that is linked to the constant domains of an antibody heavy chain.
- the immunocytokine comprises IL-15Ra linked to antibody heavy chain constant domains that have an amino acid sequence that is represented by DTCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCI RDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSGAEGGGASTKGPSVFPLAPSSKSTS GGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSW TVPSSSLGTQTYIC NVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCW V DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRW SVLTVLHQDWLNGKEYKCKVSNKAL PAPIEKTISKAKGQPREPQVYTLPPSRDELTNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT
- the immunocytokine includes IL-15Ra, associated with the constant domains of an antibody heavy chain having the amino acid sequence of which is represented DTCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCI RDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSGAEGGGASTKGPSVFPLAPSSKSTS GGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSW TVPSSSLGTQTYIC NVNHKPSNTKVDKRVEPKSADKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVW DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRW SVLTVLHQDWLNGKEYKCKVSNKAL PAPIEKTISKAKGQPREPQVYTLPPSRDELTNQVSLTCLVKGFYPSDIAVEWESNGQ
- the amino acid sequence shown by SEQ ID NO: 22 differs from the amino acid sequence shown by SEQ ID NO: 4 by one amino acid substitution of Cysteine (C) to Alanine (A) at position 212. This substitution produces an immunocytokine that includes the first constant an antibody heavy chain domain and an antibody light chain constant domain in a heterodimeric complex that do not have a covalent association through the natural SS bridge.
- the immunocytokine comprises IL-15 that is linked to the constant domains of an antibody heavy chain.
- the immunocytokine comprises IL-15 linked to antibody heavy chain constant domains that have an amino acid sequence that is represented by
- the immunocytokine includes IL-15, associated with the constant domains of an antibody heavy chain having the amino acid sequence of which is represented DNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTV ENLIILANDSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTSAGGKPGGSAGGAS TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS SW TVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSADKTHTCPPCPAPEAAGGPSVFLFPPKP KDTLMISRTPEVTCVW DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRW SVLTVLHQ DWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPS
- the amino acid sequence that is represented by SEQ ID NO: 20 differs from the amino acid sequence that shown by SEQ ID NO: 2, one amino acid substitution of Cysteine (C) for Alanine (A) at position 229. This substitution allows obtaining an immunocytokine, which includes the first constant domain of the heavy chain of the antibody and the constant domain of the light chain of the antibody in the heterodimeric complex, which are not have a covalent association through the natural SS bridge.
- the immunocytokine comprises:
- IL-15Ra associated with the constant domain of the light chain of antibodies that have an amino acid sequence that is represented by
- IL-15 linked to antibody heavy chain constant domains that have an amino acid sequence that is
- the immunocytokine includes:
- IL-15Ra associated with the constant domain of the light chain of antibodies that have an amino acid sequence that is represented by
- IL-15 linked to antibody heavy chain constant domains that have an amino acid sequence that is
- the immunocytokine comprises:
- IL-15Ra associated with the constant domain of the light chain of antibodies that have an amino acid sequence that is represented by
- IL-15 linked to antibody heavy chain constant domains that have an amino acid sequence that is
- the immunocytokine comprises:
- IL-15Ra associated with antibody heavy chain constant domains that have an amino acid sequence that is represented by
- IL-15 associated with the constant domain of the light chain of antibodies that have an amino acid sequence that is represented by
- IL-15Ra associated with antibody heavy chain constant domains that have an amino acid sequence that is represented by
- IL-15 associated with the constant domain of the light chain of antibodies that have an amino acid sequence that is represented by
- the immunocytokine comprises:
- IL-15Ra associated with antibody heavy chain constant domains that have an amino acid sequence that is represented by
- IL-15 associated with the constant domain of the light chain of antibodies that have an amino acid sequence that is represented by
- the immunocytokine has mutations in the monomer of the Fc fragment, resulting in the lack of ADCC, CDC and / or ADCP properties of the specified immunocytokine.
- modification (s) of the amino acid sequences of the antibodies described herein are proposed.
- Amino acid sequence variants of an antibody are prepared by introducing appropriate nucleotide changes into the antibody nucleic acid or by peptide synthesis. Such modifications include, for example, deletions and / or insertions and / or substitutions of residues in the amino acid sequences of the antibody. Any combination of deletion, insertion and substitution is performed to obtain the final construct, provided that the final construct has the desired characteristics.
- a variant of modification of the amino acid sequences of antibodies using amino acid substitutions is a substitution, at least one amino acid residue in the antibody molecule for another residue.
- effector function of an antibody refers to biological activities associated with the Fc region (native sequence of the Fc region or amino acid sequence variants of the Fc region) of an antibody, and varies depending on the isotype of the antibody.
- Examples of antibody effector functions are: C1 q - binding; complement dependent cytotoxicity; Fc receptor binding; antibody dependent cell mediated cytotoxicity (ADCC); phagocytosis; down-regulation of cell surface receptors (eg, B-cell receptor, BCR) and B-cell activation.
- ADCC antibody-dependent cellular cytotoxicity
- FcRs Fc receptors
- NK cells nonspecific cytotoxic cells that express Fc receptors (FcRs) (eg, natural killer (NK) cells, neutrophils, and macrophages) recognize the bound antibody on the target cell and then induce lysis or phagocytosis of the target cell.
- FcRs Fc receptors
- FcR expression on hematopoietic cells is summarized in Table 3 on page 464 in Ravetch and Kinet, Annu. Rev. Immunol 9: 457-92 (1991).
- ADCC activity of a molecule of interest can be assessed in vitro, for example, in an animal model such as that described in Clynes et al. PNAS (USA) 95: 652-656 (1998).
- Human effector cells are leukocytes that express one or more FcRs and perform effector functions. Preferably, the cells express at least FcyRIII and perform ADCC effector function. Examples of human leukocytes that mediate ADCC include peripheral blood mononuclear cells (PBMCs), natural killer (NK) cells, monocytes, cytotoxic T cells, and neutrophils; however, PBMC and NK cells are preferred.
- PBMCs peripheral blood mononuclear cells
- NK natural killer cells
- monocytes monocytes
- cytotoxic T cells cytotoxic T cells
- neutrophils neutrophils
- the effector cells can be isolated from their natural source, for example from blood or PBMC, as described in this publication.
- “Complement-dependent cytotoxicity” and “CDC” refer to the ability of a molecule to lyse a target in the presence of complement.
- the complement activation pathway is initiated by the binding of the first component of the complement system (Clq) to a molecule (for example, an antibody) in a complex with its antigen.
- a CDC assay can be performed, for example, as described in Gazzano-Santoro et al., J. Immunol. Methods 202: 163 (1996).
- the immunocytokine comprises an Fc portion that is IgG.
- the immunocytokine comprises an Fc fragment selected from the group of human IgGl, IgG2, or IgG4.
- the immunocytokine comprises the above two heterodimeric protein complexes based on IL-15 and IL-15Ra.
- IL15 superagonist also called BCD225 or IL15SA or (IL15SA) 2-Fc
- IL15 superagonist means CK_IL15Ra_Hc_IL15CH1FcLALA and CK_IL15_Hc_IL15RaCHlFcLALA.
- Designations CK, IL15Ra, IL15, CHlFcLALA have a decoding according to the text of the application.
- CK_IL15Ra_Hc_IL15CHlFcLALA is the aforementioned immunocytokine comprising two heterodimeric protein complexes based on IL-15 and IL-15Ra, which include IL15Ra, which is linked to the constant domain of the antibody light chain CK and IL15, which is linked to the constant domains of the heavy chain (CH1 ) a heavy chain constant domain and an Fc fragment monomer containing the second (CH2) and third (CH3) heavy chain constant domains, where the Fc contains LALA mutations.
- CK IL15 Hc IL15RaCHlFcLALA is the aforementioned immunocytokine comprising two heterodimeric protein complexes based on IL-15 and IL-15Ra, which include IL15, which is linked to the constant domain of the light chain of the antibody CK, and IL15Ra, which is linked to the constant domains of the heavy chain of the antibody, including the first (CHI) constant domain of the heavy chain; and a monomer of an Fc fragment containing the second (CH2) and third (CH3) constant domains of the heavy chain, where the Fc contains LALA mutations.
- the above immunocytokines can be performed both in the format, where the first constant domain of the heavy chain of the antibody and the constant domain of the light chain of the antibody in the heterodimeric complex have a covalent association through the natural SS bridge, and in the format where the first constant domain of the heavy chain of the antibody and the constant domain of the light the antibody chains in the heterodimeric complex do not have a covalent association through the natural SS bridge; in a particular case, for this, both cesteines are replaced by alanine.
- the immunocytokine is used as a therapeutic agent for cancer or autoimmune disease.
- the immunocytokine is used as a therapeutic agent for cancer therapy.
- the present invention relates to an immunocytokine for stimulating the activation and / or proliferation of IL-15Kbeta / gamma-positive cells, which includes a heterodimeric protein complex based on IL-15 and IL-15Ra and an immunomodulatory antibody or antigen-binding fragment thereof that specifically inhibits PD-1 pathway, where the heterodimeric protein complex based on IL-15 and IL-15Roc contains:
- IL-15Ra which is linked to a) the constant domain of the light chain of the antibody, or b) the constant domains of the heavy chain of the antibody, including the first (CH1) constant domain of the heavy chain and the monomer of the Fc fragment containing the second (CH2) and third (CH3) heavy chain constant domains;
- IL-15 which is linked to a) the constant domains of the heavy chain of the antibody, including the first (CH1) constant domain of the heavy chain and the monomer of the Fc fragment containing the second (CH2) and third (CH3) constant domains of the heavy chain, or b) constant domain of the light chain of the antibody; the first constant domain of the heavy chain of the antibody and the constant domain of the light chain of the antibody in the heterodimeric complex have or do not have a covalent association through the natural S-S bridge and, where, if IL-15 or IL-15Ra is linked to the constant domain of the light chain of the antibody, then the other part of the heterodimeric protein a complex selected from IL-15Ra or IL-15 is linked to the constant domains of an antibody heavy chain.
- antibody or “immunoglobulin” (Ig), as used herein, includes whole antibodies and any antigen-binding fragment (ie, "antigen-binding portion") or individual chains thereof.
- antibody refers to a glycoprotein containing at least two heavy (H) chains and two light (L) chains interconnected by disulfide bonds, or an antigen-binding portion thereof.
- Each heavy chain contains a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant region.
- VH heavy chain variable region
- the type of heavy chain present determines the class of the antibody; these chains are found in antibodies such as IgA, IgD, IgE, IgG and IgM, respectively.
- the various heavy chains differ in size and composition; a and g contain about 450 amino acids, and m and e have about 550 amino acids.
- Each heavy chain contains two regions, i.e. constant region and variable region. The constant region is identical in all antibodies of the same isotype, but differs in antibodies of different isotypes.
- Heavy chains g, a and d contain a constant region, which consists of three constant domains CHI, CH2 and CH3 (aligned) and a hinge region that confers flexibility (Woof J., Burton D., Nat Rev Immunol 4, 2004, cc.89-99); heavy chains m and e contain a constant region, which consists of four constant domains CHI, CH2, CH3 and CH4.
- K lambda
- Each light chain consists of a light chain variable region (abbreviated herein as VL) and a light chain constant region.
- the approximate length of the light chain is 211-217 amino acids.
- the light chain is a kappa (k) light chain and the CL constant domain is preferably C-kappa (k).
- an “antibody” according to the invention can be an antibody of any class (eg, IgA, IgD, IgE, IgG and IgM, preferably IgG) or subclass (eg, IgGl, IgG2, IgG3, IgG4, IgAl and IgA2, preferably IgGl).
- class e.g, IgA, IgD, IgE, IgG and IgM, preferably IgG
- subclass eg, IgGl, IgG2, IgG3, IgG4, IgAl and IgA2, preferably IgGl.
- VH and VL regions can be further subdivided into regions of hypervariability, called complementarity determining regions (CDRs), scattered between regions that are more conserved, called framework regions (FRs).
- CDRs complementarity determining regions
- FRs framework regions
- Each VH and VL consists of three CDRs and four FRs located from the amino terminus to the carboxy terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
- the variable regions of the heavy and light chains contain a binding domain that interacts with antigen.
- Antibody constant regions can mediate the binding of immunoglobulin to host tissues or factors, including various cells of the immune system (eg, effector cells) and the first component (Clq) of the classical complement system.
- antigennegative part of an antibody or antigennegative fragment refers to one or more antibody fragments that retain the ability to specifically bind to an antigen. It has been shown that the antigen-binding function of an antibody can be performed by fragments of a full-length antibody.
- binding fragments included in the term "antigen binding portion" of an antibody include (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH 1 domains; (ii) F (ab ') 2 fragment, a bivalent fragment containing two Fab fragments linked by a disulfide bridge in the hinge region; (iii) an Fd fragment consisting of the VH and CH 1 domains; (iv) an Fv fragment consisting of the VL and VH domains in a single arm of an antibody, (v) a dAb fragment (Ward et al., (1989) Nature 341: 544-546), which consists of a VH / VHH domain; and (vi) an isolated complementarity determining region (CDR).
- a Fab fragment a monovalent fragment consisting of the VL, VH, CL and CH 1 domains
- F (ab ') 2 fragment a bivalent fragment containing two Fab fragments linked by a disulf
- the two regions of the Fv fragment, VL and VH are encoded by different genes, they can be combined using recombinant methods using a synthetic linker, which makes it possible to obtain them in the form of a single protein chain, in which the VL and VH regions are paired to form monovalent molecules (known as single chain Fv (scFv); see, for example, Bird et al. (1988) Science 242: 423-426; and Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85: 5879 -5883). It is contemplated that such single-chain molecules are also included in the term "antigennegative portion" of an antibody. Such antibody fragments are obtained using conventional techniques known to those skilled in the art, and the fragments are screened in the same manner as intact antibodies.
- the CDR of the antigen binding region or all of the antigen binding region of the antibodies of the invention is of mouse, llama, or human donor library origin, or is essentially human in origin with certain amino acid residues altered, for example substituted with different amino acid residues, in order to optimize specific antibody properties, for example KD , koff, IC50, EC50, ED50.
- the antibody frameworks of the invention are of human origin or of substantially human origin (at least 80, 85, 90, 95, 96, 97, 98 or 99% human).
- the antigen binding site of an antibody of the invention may be from other non-human species, including, but not limited to, a mouse, llama, rabbit, rat, or hamster. Alternatively, the antigen binding site may be from a human species.
- variable refers to the fact that certain segments of the variable domains differ widely in sequence among antibodies.
- the V domain mediates antigen binding and determines the specificity of a particular antibody for its particular antigen.
- variability is unevenly distributed over the 110 amino acid variable domains.
- V regions are composed of invariant fragments called framework regions (FRs) of 15-30 amino acids separated by shorter regions of extreme variability called “hypervariable regions” or CDRs.
- FRs framework regions
- hypervariable regions or CDRs.
- Each variable domain of native heavy and light chains contains four FRs, mainly assuming the configuration of beta sheets, linked by three hypervariable regions, which form loops that link, and in some cases are part of the beta-sheet structure.
- hypervariable regions in each chain are held together in close proximity by FRs and, with the hypervariable regions of the other chain, contribute to the formation of the antigen-binding site of antibodies.
- Constant domains are not directly involved in the binding of an antibody to an antigen, but exhibit various effector functions, such as the participation of an antibody in antibody-dependent cellular cytotoxicity (ADCC).
- ADCC antibody-dependent cellular cytotoxicity
- hypervariable region refers to the amino acid residues of an antibody that are responsible for antigen binding.
- the hypervariable region contains amino acid residues from the "complementarity determining region" or "CDR" and / or such residues from the "hypervariable loop".
- affinity maturation it may also be preferable to alter one or more amino acid residues of the CDR regions in order to increase the binding affinity for the target epitope. This is known as "affinity maturation" and in some cases can be performed in connection with humanization, for example, in situations where humanization of an antibody leads to a decrease in the specificity or affinity of binding, and it is not possible to sufficiently improve the specificity or affinity of binding by using only reverse mutations.
- affinity maturation methods are known in the art, for example, the in vitro scanning saturation mutagenesis method described by Burks et al., Proc Natl Acad Sci USA, 94: 412-417 (1997), and the in vitro stepwise affinity maturation method proposed by Wu et al., Proc Natl Acad Sci USA 95: 60376042 (1998).
- FR Framework regions
- each variable domain has four FRs, designated FR1, FR2, FR3, and FR4.
- FR1, FR2, FR3, and FR4 are variable domain residues other than the CDR residues.
- each variable domain has four FRs, designated FR1, FR2, FR3, and FR4.
- the FR residues of the light chain are located approximately in the region of residues 1-23 (LCFR1), 35-49 (LCFR2), 57-88 (LCFR3) and 98-107 (LCFR4)
- the FR residues of the heavy chain are located approximately in the region of residues 1-30 (HCFR1), 36-49 (HCFR2), 66-94 (HCFR3) and 103-113 (HCFR4) in the heavy chain.
- the FR residues of the light chain are located at approximately residues 1-25 (LCFR1), 33-49 (LCFR2), 53-90 (LCFR3) and 97-107 (LCFR4) in the light chain and FR residues of the heavy chain are located approximately at residues 1-25 (HCFRI), 33-52 (HCFR2), 56-95 (HCFR3) and 102-113 (HCFR4) in the residues of the heavy chain.
- the FRs are adjusted accordingly. For example, when CDRH1 includes amino acids H26-H35, the FR1 residues of the heavy chain are at positions 1-25 and the FR2 residues are at positions 36-49.
- An antibody of the invention that “binds” a target antigen is an antibody that binds an antigen with sufficient affinity such that the antibody can be used in as a diagnostic and / or therapeutic agent when targeting a protein or cell or tissue expressing an antigen, and slightly cross-reacts with other proteins.
- analytical methods sorting of fluorescently activated cells (FACS), radioimmunoprecipitation (RIA) or ELISA (ELISA), in such variants of the invention the degree of binding of the antibody to a protein that is not a “target” (with a “non-target protein”) is less than 10 % of antibody binding to a specific target protein.
- the term “specific binding” or the expression “specifically binds to” or “specific to” a particular polypeptide or epitope on a particular target polypeptide means binding that is markedly (measurably) different from a non-specific interaction.
- the immunocytokine comprises an antibody heavy chain first constant domain and an antibody light chain constant domain in a heterodimeric complex that are covalently associated through a natural S-S bridge.
- the immunocytokine comprises a first antibody heavy chain constant domain and an antibody light chain constant domain in a heterodimeric complex that are not covalently associated through a natural S-S bridge.
- the immunocytokine comprises an antibody light chain constant domain selected from CK or CL.
- the immunocytokine comprises IL-15Ra, which has an amino acid sequence that is represented by DTCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCI RDPALVHQRPAPPSTASSTTAGVTPQA
- IL-15Ra that contains mutations with a similar biological activity to IL-15Ra means any IL-15Ra known in the art that contains mutations and has a similar biological activity to "wild type" IL-15Ra.
- the immunocytokine comprises IL-15 that has an amino acid sequence that is DNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTV ENLIILANDSLSSNGNVTESGCKECEELEEKNTSIVFLQS biologically active variant;
- IL-15 that contains mutations with a similar biological activity to IL-15 is meant any IL-15 known in the art that contains mutations and has a similar biological activity to "wild type” IL-15.
- the immunocytokine comprises IL-15Ra that is linked to an antibody light chain constant domain.
- the immunocytokine includes IL-15Ra, associated with the constant domain of antibody light chain having the amino acid sequence of which is represented DTCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCI RDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSGAEGGGRTVAAPSVFIFPPSDEQLK SGTASW CLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHK VYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 1).
- the immunocytokine includes IL-15Ra, associated with the constant domain of antibody light chain having the amino acid sequence of which is represented DTCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCI RDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSGAEGGGRTVAAPSVFIFPPSDEQLK SGTASW CLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHK VYACEVTHQGLSSPVTKSFNRGEA (SEQ ID NO: 19).
- the amino acid sequence shown by SEQ ID NO: 19 differs from the amino acid sequence shown by SEQ ID NO: 1 by one amino acid substitution of Cysteine (C) to Alanine (A) at position 216. This substitution produces an immunocytokine that includes the first constant an antibody heavy chain domain and an antibody light chain constant domain in a heterodimeric complex that do not have a covalent association through the natural SS bridge.
- the immunocytokine comprises IL-15 that is linked to an antibody light chain constant domain.
- the immunocytokine comprises IL-15 linked to an antibody light chain constant domain that has an amino acid sequence that is
- the immunocytokine comprises IL-15 linked to an antibody light chain constant domain that has an amino acid sequence that is
- the amino acid sequence shown by SEQ ID NO: 21 differs from the amino acid sequence shown by SEQ ID NO: 3 by one amino acid substitution of Cysteine (C) to Alanine (A) at position 233. This substitution produces an immunocytokine that includes the first constant an antibody heavy chain domain and an antibody light chain constant domain in a heterodimeric complex that do not have a covalent association through the natural SS bridge.
- the immunocytokine comprises a first (CH1) heavy chain constant domain and an Fc monomer comprising a second (CH2) and third (CH3) heavy chain constant domains that are hinged.
- the immunocytokine comprises IL-15 or IL-15Ra that is linked to antibody heavy chain constant domains in the following order CH1-hinge-CH2-CH3.
- the immunocytokine comprises IL-15Ra that is linked to the constant domains of an antibody heavy chain.
- the immunocytokine comprises IL-15Ra linked to antibody heavy chain constant domains that have an amino acid sequence represented by DTCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCI RDPPSALTVHQTRPAPAP GGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSW TVPSSSLGTQTYIC NVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVW DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRW SVLTVLHQDWLNGKEYKCKVSNKAL PAPIEKTISKAKGQPREPQVYTLPPCRDELTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYK TTPPVLDSDGSFFLYSKLTVDKSRWQGNVFSCSVMHE
- the immunocytokine includes IL-15Ra, associated with the constant domains of an antibody heavy chain having the amino acid sequence of which is represented DTCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCI RDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSGAEGGGASTKGPSVFPLAPSSKSTS GGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSW TVPSSSLGTQTYIC NVNHKPSNTKVDKRVEPKSADKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCW V DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRW SVLTVLHQDWLNGKEYKCKVSNKAL PAPIEKTISKAKGQPREPQVYTLPPCRDELTKNQVSLWCLVKGFYPSDIAVEWESNG
- the amino acid sequence shown by SEQ ID NO: 24 differs from the amino acid sequence shown by SEQ ID NO: b by one amino acid substitution of Cysteine (C) to Alanine (A) at position 212. This substitution produces an immunocytokine that includes the first constant an antibody heavy chain domain and an antibody light chain constant domain in a heterodimeric complex that do not have a covalent association through the natural SS bridge.
- the immunocytokine comprises IL-15 that is linked to the constant domains of an antibody heavy chain.
- the immunocytokine includes IL-15, associated with the constant domains of an antibody heavy chain having the amino acid sequence of which is represented DNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTV ENLIILANDSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTSAGGKPGGSAGGAS TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS SW TVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKP KDTLMISRTPEVTCVW DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRW SVLTVLHQ DWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPCRDELTKNQVSLWCLVKGFYPS
- the immunocytokine includes IL-15, associated with the constant domains of an antibody heavy chain having the amino acid sequence of which is represented DNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTV ENLIILANDSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTSAGGKPGGSAGGAS TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS SW TVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSADKTHTCPPCPAPEAAGGPSVFLFPPKP KDTLMISRTPEVTCVW DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRW SVLTVLHQ DWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPCRDELTKNQVSLWCLVKGFYPS
- amino acid sequence shown by SEQ ID NO: 23 differs from the amino acid sequence shown by SEQ ID NO: 5 by one amino acid change from Cysteine (C) to Alanine (A) at position 229.
- immunocytokine which includes the first constant domain of the heavy chain of the antibody and the constant domain of the light chain of the antibody in the heterodimeric complex, which do not have a covalent association through the natural SS bridge.
- the immunocytokine comprises an immunomodulatory antibody, or antigen-binding fragment thereof, that specifically inhibits the PD-1 pathway, and is an antibody that specifically binds to PD-1.
- Specific binding can be quantified, for example by determining binding of a molecule versus binding of a control molecule. For example, specific binding can be determined by competitive reaction with another molecule similar to the target, for example, with an excess of unlabeled target. In this case, specific binding is indicated if the binding of the labeled target to the probe is competitively inhibited by an excess of unlabeled target.
- the term “specific binding” or the expression “specifically binds to” or “specific to” a particular polypeptide or epitope on a particular target polypeptide can be characterized by a molecule having a target Kd of at least about 200 nM, or at least at least about 150 nM, or at least about 100 nM, or at least about 60 nM, or at least about 50 nM, or at least about 40 nM, or at least about 30 nM, or at least about 20 nM, or at least about 10 nM, or at least about 8 nM, or at least about 6 nM, or at least about 4 nM, or at least about 8 nM, or at least about 6 nM, or at least about 4 nM, or at least about 8 nM, or at least about 6 nM, or at least about 4 nM, or at least about 8 nM, or at least about 6 nM, or at least about 4 nM, or at least about 8 nM
- the immunocytokine comprises an immunomodulatory antibody that includes: a) a light chain comprising a light chain variable domain and a light chain constant domain; b) a heavy chain containing the variable domain of the heavy chain and constant domains of the heavy chain of the antibody, including the first (CH1) constant domain of the heavy chain and the monomer of the Fc fragment containing the second (CH2) and third (CH3) constant domains of the heavy chain.
- the immunocytokine comprises a light chain variable domain that includes LCDRs 1, 2, and 3
- hypovariable regions 1, 2 and 3 which are respectively represented by the amino acid sequences GGNNIGSKNVH (SEQ ID NO: 14), RDSNRPS (SEQ ID NO: 15) and CQVWDSSTAV (SEQ ID NO: 16).
- the immunocytokine comprises a light chain variable domain that includes an amino acid sequence that is
- the immunocytokine comprises a heavy chain variable domain that includes HCDRs 1, 2, and 3
- hypovariable regions 1, 2 and 3 which are respectively represented by the amino acid sequences FTFSSYWMY (SEQ ID NO: 11), AIDTGGGRTYYADSVKG (SEQ ID NO: 12) and
- the immunocytokine comprises a heavy chain variable domain that includes an amino acid sequence that is
- the immunocytokine comprises:
- variable domain of the light chain which includes LCDRs 1, 2 and 3 (hypervariable regions 1, 2 and 3), which are respectively represented by the amino acid sequences GGNNIGSKNVH (SEQ ID NO: 14), RDSNRPS (SEQ ID NO: 15) and CQVWDSSTAV (SEQ ID NO: 16);
- variable domain of the heavy chain which includes HCDR 1
- the immunocytokine comprises:
- variable domain of the light chain which includes the amino acid sequence, which is represented
- variable domain of the heavy chain which includes the amino acid sequence, which is represented
- the immunocytokine comprises an immunomodulatory antibody that includes a light chain comprising an amino acid sequence that is
- the immunocytokine comprises an immunomodulatory antibody that includes a heavy chain comprising an amino acid sequence that is
- the immunocytokine comprises the immunomodulatory antibody prolgolimab (BCD100, W02018013017).
- the immunocytokine comprises an immunomodulatory antibody, or antigen binding fragment thereof, that specifically inhibits the PD-1 pathway, which is an antibody that specifically binds to PD-L1.
- the antibody that specifically binds to PD-L1 is BCD135, which is described in RU2665790 (WO2018194496).
- the immunocytokine comprises: a) a heterodimeric protein complex based on IL-15 and IL-15Ra, which comprises:
- IL-15Ra associated with the constant domain of the light chain of antibodies that have an amino acid sequence that is represented by
- IL-15 linked to antibody heavy chain constant domains that have an amino acid sequence that is
- the immunocytokine comprises: a) a heterodimeric protein complex based on IL-15 and IL-15Ra, which comprises:
- IL-15Ra associated with the constant domain of the light chain of antibodies that have an amino acid sequence that is represented by
- IL-15 linked to antibody heavy chain constant domains that have an amino acid sequence that is
- the immunocytokine comprises: a) IL-15Ra linked to antibody heavy chain constant domains that have an amino acid sequence that presented
- IL-15 associated with the constant domain of the light chain of antibodies that have an amino acid sequence that is represented by
- an immunomodulatory antibody which includes: a heavy chain containing the amino acid sequence that is
- the immunocytokine comprises: a) IL-15Ra linked to antibody heavy chain constant domains that have an amino acid sequence that is represented by
- IL-15 associated with the constant domain of the light chain of antibodies that have an amino acid sequence that is represented by
- an immunomodulatory antibody which includes: a heavy chain containing the amino acid sequence that is
- the immunocytokine has mutations in the constant domains of the antibody, causing heterodimerization of two different parts, one of which includes covalently or non-covalently associated IL-15Ra associated with the constant domains of the antibody, and IL-15 associated with the constant domain of the antibody, and the other includes covalently or non-covalently associated antibody light and heavy chains.
- the immunocytokine comprises: a first Fc monomer and a second Fc monomer that are selected from the group: the first Fc monomer is Fc modified to form Knob and the second Fc monomer is Fc modified to form Hole, or when the second Fc monomer is is Fc modified to form Knob and the first monomer Fc is Fc modified to form Hole.
- Knobs -into-holes is an approach that can work around the problem of mismatched byproducts.
- This approach aims to enhance the pairing of two different heavy chains of an antibody by introducing mutations in CH3 domains to modify the interface at the interface.
- the large amino acids were replaced with amino acids with short side chains to create a "cavity”.
- amino acids with larger side chains were introduced into another CH3 domain, creating a "bulge”.
- the percentage of heterodimer can be further increased by remodeling the interfaces of two CH3 domains using phage display technology and the introduction of a disulfide bridge to stabilize heterodimers (Merchant A.M. et al., Nature Biotech 16, 1998, pp. 677-681; Atwell S ., Ridgway JB, Wells JA, Carter P., J Mol Biol 270, 1997, pp. 26-35).
- the immunocytokine comprises a first Fc monomer that has amino acid substitutions S354C / T366W, and a second monomer Fc that has amino acid substitutions
- the immunocytokine comprises a first Fc monomer that has Y349C / T366S / L368A / Y407 amino acid substitutions and a second Fc monomer that has S354C / T366W amino acid substitutions.
- the immunocytokine comprises an Fc portion that is IgG.
- an immunocytokine wherein the isotype of the Fc fragment is selected from the group: human IgGl, IgG2, or IgG4.
- the immunocytokine comprises mutations in an Fc fragment monomer resulting in the lack of ADCC, CDC, and / or ADCP properties of said immunocytokine.
- bispecific IL15 superagonist or bispecific IL15 immunocytokine or immunocytokine anti-PDl / IL15SA bispecific monoclonal antibody containing IL-15SA and an anti-PD-1 Fab fragment is also meant:
- Immunocytokine anti-PD-Ll / IL15SA also means:
- Anti-PD-1 Fab Anti-PD-Ll Fab
- CK IL15Ra
- IL15 CHlFcknobLALA
- Anti-PD-1 Fab-CK_IL15Ra_Hc _IL15CH1FcknobLALA is the aforementioned immunocytokine comprising an antigen-binding Fab fragment of an anti-PD1 antibody, IL15Ra, which is linked to the constant domain of the light chain of the antibody CK and IL15, which is linked to the constant domains of the heavy first chain of the antibody CH1 a heavy chain constant domain and an Fc fragment monomer containing the second (CH2) and third (CH3) heavy chain constant domains, where the Fc contains mutations to generate heterodimerization (eg knob) and LALA.
- Anti-PD-1 Fab- CK_IL15_Hc_ILl5RaCHlFcknobLALA is the aforementioned immunocytokine comprising an antigen-binding Fab fragment of an anti-PD1 antibody, IL15, which is linked to the constant domain of the light chain of the antibody CK and IL15Ra, which is linked to the constant domains of the heavy first chain of the antibody CH, a heavy chain domain and a monomer of an Fc fragment containing the second (CH2) and third (CH3) heavy chain constant domains, where the Fc contains mutations to generate heterodimerization (eg, knob) and LALA.
- Anti-PD-Ll Fab-CK_IL15Ra_Hc_IL15CH1FcknobLALA is the aforementioned immunocytokine comprising an antigen-binding Fab fragment of an anti-PD-L1 antibody, IL15Ra, which is linked to the constant domain of the light chain of the antibody CK and IL15, which is linked to the constant domains of the heavy chain ( CH1) a heavy chain constant domain and an Fc fragment monomer containing the second (CH2) and third (CH3) heavy chain constant domains, where Fc contains mutations to generate heterodimerization (eg, knob) and LALA.
- Anti-PD - Ll Fab- CK_IL15_Hc_IL15RaCHlFcknobLALA is the aforementioned immunocytokine including antigen binding an anti-PD-L1 Fab fragment, IL15, which is linked to the constant domain of the light chain of the antibody CK and IL15Ra, which is linked to the constant domains of the heavy chain of the antibody, including the first (CH1) constant domain of the heavy chain and the monomer of the Fc fragment containing the second (CH2 ) and the third (CH3) heavy chain constant domains, where Fc contains mutations to form heterodimerization (eg, knob) and LALA.
- the above immunocytokines can be performed both in the format, where the first constant domain of the heavy chain of the antibody and the constant domain of the light chain of the antibody in the heterodimeric complex have a covalent association through the natural SS bridge, and in the format where the first constant domain of the heavy chain of the antibody and the constant domain of the light the antibody chains in the heterodimeric complex do not have a covalent association through the natural SS bridge; in a particular case, for this, both cesteines are replaced by alanine.
- knob as indicated above, mutations are meant to form a Knob-to-Hole pattern between the first Fc variant and the second Fc variant in the CH3 domain.
- the immunocytokine is used to treat cancer or autoimmune disease.
- the immunocytokine is used to treat cancer.
- the present invention provides an isolated nucleic acid that encodes any of the above immunocytokines.
- nucleic acid denotes a clear sequence of nucleotides, modified or not modified defining a fragment or region of nucleic acid, whether or not containing unnatural nucleotides and which is either double-stranded DNA or RNA, or single-stranded DNA or RNA, or transcription products of said DNA.
- this invention does not relate to nucleotide sequences in their natural chromosomal environment, i. E. in a natural state.
- the sequences of the present invention have been isolated and / or purified, i. E. were taken directly or indirectly, for example, by copying, while their environment has been at least partially modified.
- isolated nucleic acids obtained by genetic recombination, for example, using host cells (host cells), or obtained by chemical synthesis.
- nucleic acid molecule is a nucleic acid molecule that is identified and separated from at least one contaminant nucleic acid molecule with which it is normally associated in a natural source.
- An isolated nucleic acid molecule differs from the form or set in which it naturally occurs. Thus, the isolated nucleic acid molecule differs from the nucleic acid molecule that exists naturally in cells.
- an isolated nucleic acid molecule includes a nucleic acid molecule found in cells in which the immunocytokine is normally expressed, for example, if the nucleic acid molecule has a different localization on the chromosome from its localization in cells in natural conditions.
- the nucleic acid is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoe
- the present invention relates to a nucleic acid molecule comprising a nucleotide sequence that encodes an amino acid sequence selected from SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 , 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23 or 24.
- a nucleic acid molecule may also contain any combination of the above nucleotide sequences.
- a peptide with an amino acid sequence selected from SEQ ID NO: 1, 2, 3, 4, 5, b, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16 , 17, 18, 19, 20, 21, 22, 23 or 24, can be encoded by a wide variety of different DNA sequences, taking into account the degenerate TM genetic code. It is well known to those skilled in the art to prepare such alternative DNA sequences encoding the same amino acid sequences. Such variant DNA sequences are within the scope of the present invention.
- the present invention relates to an expression vector that contains the above nucleic acid.
- vector means a nucleic acid molecule capable of transporting another nucleic acid to which it is linked.
- the vector is a plasmid, i. E. a circular double-stranded portion of DNA into which additional DNA segments can be ligated.
- the vector is a viral vector in which additional DNA segments can be ligated into the viral genome.
- vectors are capable of autonomous replication in the host cell into which they are introduced (e.g., bacterial vectors, having a bacterial origin of replication and episomal mammalian vectors).
- vectors eg, non-episomal mammalian vectors
- vectors can be integrated into the genome of a host cell upon introduction into a host cell, and thus replicate with the host genome.
- some vectors are capable of directing the expression of genes to which they are operably linked. Such vectors are referred to herein as “recombinant expression vectors” (or simply “expression vectors”).
- the present invention relates to vectors containing the above nucleic acid molecules that encode any of the amino acid sequences of the above immunocytokine or its constructive parts as described herein.
- an immunocytokine of this invention is expressed by inserting DNA encoding part or all of the sequence of the first and second immunocytokine domains (e.g., a domain comprising IL15 or IL15Ra linked to antibody constant domain (s) and / or antibody light and heavy chain), obtained as described above, in expression vectors such that the genes are operably linked to the desired expression control sequences, such as transcriptional and translational control sequences.
- Expression vectors include plasmids, retroviruses, adenoviruses, adeno-associated viruses (AAV), plant viruses such as cauliflower mosaic virus, tobacco mosaic viruses, cosmids, YACs, EBV derived episomes, and the like.
- DNA molecules can be ligated into a vector such that the sequences that control transcription and translation in the vector perform their intended function of regulating DNA transcription and translation.
- the expression vector and expression control sequences can be selected to be compatible with the expression host cell used.
- DNA molecules encoding part or all of the first and second binding domain sequences eg, heavy and light chain sequences, where the binding domain contains the heavy and light chain sequences
- DNA molecules can be introduced into separate vectors. In one embodiment, any combination of the above DNA molecules is introduced into the same expression vector.
- DNA molecules can be introduced into the expression vector by standard methods (for example, ligation of complementary restriction sites on the fragment of the antibody gene and the vector, or blunt-end ligation if restriction sites are absent).
- a suitable vector is one that encodes functionally complete human immunoglobulin CH or CL / CK sequences with appropriate restriction site construction such that any VH or VL or IL15 or IL15Ra sequence can be readily incorporated and expressed as described above.
- HC- and LC-coding of genes in such vectors may contain intron sequences, which leads to an overall increase in antibody protein products by stabilization corresponding mRNA.
- Intron sequences are flanked by splice donor and splice acceptor sites that determine where RNA splicing will occur. The location of the intron sequences can be either in the variable or constant regions of the antibody chains, or in both variable and constant regions when multiple introns are used.
- Termination of polyadenylation and transcription can occur downstream of the native chromosome site of the encoded regions.
- a recombinant expression vector can also encode a signal peptide that facilitates the production of an antibody chain by a host cell.
- An antibody chain gene or a chain gene comprising IL15 or IL15Ra can be cloned into a vector such that the signal peptide is linked to the reading frame of the amino terminus of the immunoglobulin chain.
- the signal peptide can be an immunoglobulin signal peptide or a heterologous signal peptide (ie, a signal peptide of a non-immunoglobulin protein).
- the recombinant expression of the vectors of this invention may carry regulatory sequences that control gene expression in the host cell.
- regulatory sequences that control gene expression in the host cell.
- the design of the expression vector including the choice of regulatory sequences, may depend on factors such as the selection of the host cell for transformation, the level of expression of the desired protein, etc.
- Preferred mammalian host cell expression control sequences include viral elements for high expression of proteins in mammalian cells, such as promoters and / or enhancers derived from retroviral LTR, cytomegalovirus (CMV) (e.g., CMV promoter / enhancer), simian virus 40 (SV40) (e.g.
- CMV cytomegalovirus
- SV40 simian virus 40
- SV40 promoter / enhancer adenovirus (e.g., adenovirus large late promoter (AdMLP)), polyoma virus, and strong mammalian promoters such as the native immunoglobulin promoter or actin promoter.
- AdMLP adenovirus large late promoter
- strong mammalian promoters such as the native immunoglobulin promoter or actin promoter.
- the recombinant expression vectors of the invention may carry additional sequences, such as sequences that regulate replication of the vector in host cells (eg, origin of replication) and selectable marker genes.
- the selectable marker gene facilitates the selection of host cells into which the vector has been introduced (see, for example, US patents 4,399,216, 4,634,665 and 5,179,017).
- typically a selectable marker gene confers resistance to drugs such as G418, hygromycin, or methotrexate to the host cell into which the vector has been introduced.
- selectable marker genes include a dihydrofolate reductase (DHFR) gene (for use in dhfr host cells for methotrexate selection / amplification), a neo gene (for G418 selection), and a glutamate synthetase gene.
- DHFR dihydrofolate reductase
- expression control sequence means polynucleotide sequences that are required to influence the expression and processing of the coding sequences to which they are ligated.
- Expression control sequences include the corresponding transcription initiation, termination, promoter and enhancer sequences; efficient RNA processing signals such as splicing and polyadenylation signals; sequences that stabilize cytoplasmic mRNA; sequences that enhance translation efficiency (i.e., Kozak consensus sequence); sequences that increase protein stability; and, if desired, sequences that enhance protein secretion.
- the nature of such control sequences differs depending on the host organism; in prokaryotes, such control sequences typically include a promoter, a ribosome binding site, and transcription termination sequences; in eukaryotes, such control sequences generally include promoters and transcription termination sequences.
- control sequences includes at least all components that are essential for expression and processing, and may also include additional components whose presence is useful, such as leader sequences and fusion cell sequences.
- control sequences refers to DNA sequences necessary for the expression of an operably linked coding sequence in a particular host organism.
- Suitable prokaryotic control sequences are, for example, a promoter, optionally an operator, and a ribosome binding site.
- eukaryotic cells contain promoters, polyadenylation signals, and enhancers.
- a nucleic acid is “operably linked” if it is in a functional relationship with another nucleotide sequence.
- DNA of a presequence or secretory leader is operably linked to DNA of a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide;
- a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence;
- the ribosome binding site is operably linked to a coding sequence if located so that it can facilitate translation.
- "operably linked” means that the linked DNA sequences are contiguous, and in the case of a secretory leader sequence, are contiguous and in readout phase. However, enhancers do not have to be contiguous.
- the present invention relates to a method for producing a host cell for producing the aforementioned immunocytokine, which comprises transforming the cell with the aforementioned vector.
- Nucleic acid molecules encoding the immunocytokines of the invention and vectors containing these nucleic acid molecules can be used to transfect a suitable mammal or its cell, plant or cell, bacterial or yeast host cell. Conversion can occur by any known method for introducing polynucleotides into a host cell.
- Methods for introducing heterologous polynucleotides into mammalian cells include dextran-mediated transfection, transfection with a nucleic acid-positively charged polymer complex, transfection with nucleic acid and calcium phosphate precipitate, polybrene-mediated transfection, protoplast fusion, and lipid encapsulation transfection. direct microinjection of DNA into the nucleus.
- nucleic acid molecules can be introduced into mammalian cells by viral vectors.
- Methods for transfecting cells are well known in the art. See, for example, U.S. Patent Nos. 4,399,216, 4,912,040, 4,740,461, and 4,959,455.
- Methods for transforming plant cells are well known in the art, including, for example, Agrobacterium-mediated transformation, biolistic transformation, direct injection, electroporation, and viral transformation. Methods for transforming bacterial and yeast cells are also well known in the art.
- the present invention relates to a host cell for producing the above immunocytokine, which contains the above nucleic acid.
- the present invention relates to a method for preparing a preparation containing the above immunocytokine, which consists in culturing the above host cell in a culture medium under conditions sufficient to obtain said immunocytokine, if necessary, followed by isolation and purification of the resulting immunocytokine.
- recombinant host cell means a cell into which a recombinant expression vector has been introduced.
- the present invention relates to host cells, which may include, for example, a vector in accordance with the present invention described above.
- the present invention also relates to host cells which include, for example, a nucleotide sequence encoding an immunocytokine or portions thereof of the present invention. It should be understood that “recombinant host cell” and “host cell” mean not only the specific cell claimed, but also the progeny of such a cell. Since modifications may occur in subsequent generations due to mutation or environmental influences, such offspring may not actually be identical to the parent cell, but such cells are still included within the scope of the term "host cell” as used herein.
- Mammalian cell lines used as hosts for transformation are well known in the art and include many immortal cell lines available. These include, for example, Chinese hamster ovary (CHO) cells, NS0 cells, SP2 cells, HEK-293T cells, 293 Freestyle cells (Invitrogen), NIH-3T3 cells, HeLa cells, hamster kidney (BHK) cells, African green monkey kidney (COS) cells, human hepatocellular carcinoma cells (eg, Hep G2), A549 cells, and several other cell lines. Cell lines are selected by determining which cell lines have high levels of expression and provide the desired characteristics of the produced protein. Other cell lines that can be used are insect cell lines such as Sf9 or Sf21 cells.
- immunocytokines are produced by culturing the host cells for a time sufficient to express the immunocytokine or a portion thereof of the invention in the host cells or, more preferably, release the immunocytokine into the nutrient medium in which the host cells are grown.
- Immunocytokines can be isolated from culture media using standard protein purification methods.
- Plant host cells include Nicotiana, Arabidopsis, duckweed, corn, wheat, potatoes, etc.
- Host bacterial cells include Escherichia and Streptomyces species.
- Yeast host cells include Schizosaccharomyces pombe, Saccharomyces cerevisiae, and Pichia pastoris.
- an immunocytokine of the present invention from a producing cell line can be enhanced by a number of known methods.
- the glutamine synthetase gene expression system (GS system) is common enough to enhance expression under certain conditions.
- the GS system is discussed in whole or in part in connection with EP 0216846, 0256055, 0323997 and 0338841.
- an immunocytokine or a portion thereof according to the invention in different cell lines or host cells will differ from each other in the glycosylation profile.
- the immunocytokine described herein, or a portion (domain) thereof, containing the amino acid sequences disclosed herein are part of this invention, regardless of the glycosylation state of the binding molecules, and in general, regardless of the presence or absence of post-translational modifications.
- the present invention relates to a pharmaceutical composition for stimulating the activation and / or proliferation of 1b-15Kbeta / gamma-positive cells, which contains the aforementioned immunocytokine in a therapeutically effective amount, in combination with one or more pharmaceutically acceptable excipients.
- “Pharmaceutical composition” means a composition comprising an immunocytokine according to the invention and at least one of the components selected from the group consisting of pharmaceutically acceptable and pharmacologically compatible excipients such as fillers, solvents, diluents, carriers, auxiliary, dispensing , delivery vehicles, preservatives, stabilizers, emulsifiers, suspending agents, thickeners, regulators of prolonged delivery, the choice and ratio of which depends on the nature and method of administration and dosage.
- the pharmaceutical compositions of the present invention and methods of making them will be undeniably obvious to those skilled in the art.
- the production of pharmaceutical compositions should preferably be in accordance with GMP (Good Manufacturing Practice) requirements.
- the composition may include a buffering composition, tonic agents, stabilizers, and solubilizers.
- the prolonged action of the composition can be provided by agents that delay the absorption of the active pharmaceutical ingredient, for example, aluminum monostearate and gelatin.
- suitable carriers, solvents, diluents and delivery vehicles are water, ethanol, polyalcohols, as well as mixtures thereof, oils and injectable organic esters.
- a “therapeutically effective amount” is an amount of a therapeutic agent administered during treatment that will relieve to some extent one or more symptoms of the disease being treated.
- Medical product - a substance or a mixture of substances in the form of a pharmaceutical composition in the form of tablets, capsules, powders, lyophilisates, injections, infusions, ointments and other ready-made forms, intended for the restoration, correction or change of physiological functions in humans and animals , as well as for the treatment and prevention of diseases, diagnostics, anesthesia, contraception, cosmetology and others. Any method of administering peptides, proteins or antibodies accepted in the art can be suitably used for the immunocytokine of this invention.
- pharmaceutically acceptable means one or more compatible liquid or solid components that are suitable for administration to a mammal, preferably a human.
- excipient or “excipient” is used herein to describe any component other than those previously described in this invention. These are substances of inorganic or organic origin used in the production process, the manufacture of drugs to give them the necessary physical and chemical properties.
- buffer means a solution capable of maintaining the pH value due to the interaction of acid and alkaline components that make up its composition, which enables the immunocytokine preparation according to the invention to show resistance to pH changes.
- the pH of the pharmaceutical composition is preferably from 4.0 to 8.0.
- buffering agents for example, acetate, phosphate, nitrate, histidine, succinate and the like can be used. buffer solutions, but not limited to.
- tonic agent refers to an excipient that can apply the osmotic pressure of a liquid antibody preparation.
- An "isotonic” drug is a drug that has an osmotic pressure equivalent to that of human blood. Isotonic drugs usually have osmotic pressure from about 250 to 350 mOsm / kg.
- isotonic agents polyols, mono- and disaccharides, amino acids, metal salts, for example, sodium chloride, and the like, can be used, but are not limited to them.
- stabilizer an excipient or a mixture of two or more excipients that provide the physical and / or chemical stability of the active agent.
- Amino acids can be used as stabilizers, for example, but not limited to arginine, histidine, glycine, lysine, glutamine, proline; surfactants such as polysorbate 20 (trade name Tween 20), polysorbate 80 (trade name Tween 80), polyethylene-polypropylene glycol and its copolymers (trade names Poloxaner, Pluronic), sodium dodecyl sulfate (SDS ), but not limited to them; antioxidants, for example, but not limited to methionine, acetylcysteine, ascorbic acid, monothioglycerol, sulfuric acid salts, and the like; chelating agents, for example, but not limited to ethylenediaminetetraacetic acid (EDTA), diethylenetriaminepentaacetic acid (DTPA), sodium citrate, and
- a pharmaceutical composition is "stable" if the active agent maintains its physical stability and / or chemical stability and / or biological activity during the stated shelf life at a storage temperature, for example, at 2-8 ° C. It is preferred that the active agent retains both physical and chemical stability as well as biological activity.
- the storage period is selected based on the results of stability studies with accelerated and natural storage.
- the pharmaceutical composition of the present invention can be manufactured, packaged or marketed in a single unit dose or a plurality of unit dose units in a finished dosage form.
- unit dosage means a discrete amount of a pharmaceutical composition containing a predetermined amount of an active ingredient.
- the amount of active ingredient is usually equal to the dosage of the active ingredient that will be administered to the subject, or a convenient part of such dosage, for example, half or a third of such dosage.
- compositions of the present invention are generally suitable for parenteral administration in the form of sterile medicaments intended for administration to the human body in violation of the integrity of the skin or mucous membranes, bypassing the gastrointestinal tract by injection, infusion or implantation.
- parenteral administration is contemplated to include, but is not limited to, subcutaneous, intraperitoneal, intramuscular, intravenous, intraarterial, intrathecal, intraventricular, intraurethral, intracranial, intraarticular, transdermal injection or infusion; and renal dialysis infusion techniques.
- Intratumoral delivery, such as intratumoral injection may also be useful. Regional perfusion is also provided.
- Preferred embodiments of the invention include intravenous and subcutaneous routes. Any method of administration of peptides or proteins, adopted in the art can be suitably used for the immunocytokine of this invention.
- Injectable drugs can be manufactured, packaged or sold in unit dosage form, for example, in ampoules, vials, polymer containers, pre-filled syringes, autoinjection devices, but not limited to them.
- Medicines for parenteral administration include, but are not limited to, suspensions, solutions, emulsions in oily or aqueous bases, pastes, and the like.
- Another embodiment of the invention is a medicament for parenteral administration, where the pharmaceutical composition is provided in dry form, that is, a powder or granules for dissolution in a suitable solvent (eg sterile pyrogen-free water) prior to administration.
- a suitable solvent eg sterile pyrogen-free water
- Such a drug can be obtained, for example, by lyophilization, i. E. a process known in the art as freeze drying, which includes freezing the preparation and then removing the solvent from the frozen contents.
- the immunocytokine of this invention can also be administered intranasally or by inhalation, alone, as a mixture with a suitable pharmaceutically acceptable excipient from an inhaler, such as a pressurized aerosol container, pump, spray, nebulizer) or nebulizer, which uses or does not use a suitable propellant, or in the form of nasal drops or spray.
- an inhaler such as a pressurized aerosol container, pump, spray, nebulizer) or nebulizer, which uses or does not use a suitable propellant, or in the form of nasal drops or spray.
- the drug for parenteral administration can be immediate or modified release.
- Modified release drugs include delayed, sustained, pulsed, controlled, targeted and programmed release.
- the pharmaceutical composition is used to treat an oncological or autoimmune disease.
- the pharmaceutical composition is used to treat an autoimmune disease.
- autoimmune disease in the context of the present description means a non-malignant disease or disorder arising and directed against the self (auto) antigens and / or tissues of an individual.
- autoimmune disease includes, but is not limited to, rheumatoid arthritis, arthrosis, juvenile chronic arthritis, septic arthritis, Lyme arthrosis, psoriatic arthritis, reactive arthritis, spondyloarthropathy, systemic lupus erythematosus, Crohn's disease, ulcerative colitis, inflammatory bowel disease, diabetes mellitus , thyroiditis, asthma, allergic diseases, psoriasis, atopic dermatitis, scleroderma, graft versus host disease, graft rejection, acute or chronic immune diseases associated with transplantation, sarcoidosis, Kawasaki disease, Graves disease, nephrotic syndrome, chronic fatigue syndrome, Wegener's granulomatosis, Henoch-Schönlein purpura, microscopic renal vasculitis, chronic active hepatitis, uvenita, septic shock, toxic shock syndrome, septic syndrome, cachexia, syndrome acquired immunodefici
- the pharmaceutical composition is used to treat cancer.
- cancer refers to or describe a physiological condition in mammals that is typically characterized by unregulated cell growth / proliferation.
- cancers include, but are not limited to, carcinoma, lymphoma, blastoma, sarcoma and leukemia.
- cancers include squamous cell carcinoma, small cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, squamous cell carcinoma of the lung, peritoneal cancer, hepatocellular carcinoma, stomach cancer including gastrointestinal cancer, pancreatic cancer, glioblastoma, glioma, cervical cancer, cancer ovarian cancer, liver cancer, bladder cancer, breast cancer, colon cancer, colorectal cancer, carcinoma of the endometrium and uterus, carcinoma of the salivary glands, kidney cancer (renal cell carcinoma), prostate cancer (prostate cancer), cancer of the external female genital organs, thyroid cancer, hepatic carcinoma, anal carcinoma, penile carcinoma, melanoma, and various types of head and neck cancer.
- stomach cancer including gastrointestinal cancer, pancreatic cancer, glioblastoma, glioma, cervical cancer, cancer ovarian cancer, liver cancer, bladder cancer, breast cancer, colon cancer, colorectal cancer, carcinoma of the endometrium and
- the pharmaceutical composition is used to treat an oncological disease that is selected from the group: PSCH (squamous cell carcinoma of the head and neck), cervical cancer, cancer without an identified primary source, glioblastoma, esophageal cancer, bladder cancer, TNBC (triple negative breast cancer ), Colorectal cancer (colorectal cancer), hepatocellular carcinoma, melanoma, NSCLC (non-small cell lung cancer), kidney cancer, ovarian cancer, MSI colorectal cancer with high microsatellite instability, leukemia (acute or myeloblastic), lymphoma, multiple myeloma , breast cancer, colorectal cancer, prostate cancer, bladder cancer, sarcoma, hepatocellular carcinoma, glioblastoma, Hodgkin's lymphoma, T- and B-cell acute lymphoblastic leukemia, small cell lung cancer, acute myeloblastic leukemia, refractory B-cell lymphoma ,
- PSCH
- antiproliferative action means stopping or inhibiting the growth of proliferating cells, such as cancer cells.
- IC50 50% inhibitory concentration refers to concentrations of a drug at which a measurable activity or response, eg, the growth or proliferation of cells, such as tumor cells, is inhibited by 50%.
- the IC50 value can be estimated using appropriate log dose response curves using special statistical programs for curve processing.
- GI50 50% growth inhibition refers to drug concentrations at which cell proliferation, such as tumor cells, is inhibited by 50%.
- ED50 50% effective dose / concentration refers to drug concentrations at which a measurable biological effect is achieved by 50% (may include cytotoxicity).
- the present invention relates to a method for treating cancer, which comprises administering a subject in need of such treatment, the above immunocytokine or the above pharmaceutical composition in a therapeutically effective amount.
- Treatment refers to a method of alleviating or eliminating a biological disorder and / or at least one of its attendant symptoms.
- alleviate means reducing the severity and / or frequency of the symptoms of a disease, disorder, or condition.
- references herein to “treatment” include references to curative, palliative and prophylactic therapy.
- the subject of treatment or patient is a mammal, preferably a human subject.
- the above subject can be male or female of any age.
- disease means any condition that can be improved as a result of the treatment of the present invention.
- the definition of this term includes chronic and acute disorders or diseases.
- the cancer is selected from the group: PRGPI (squamous cell carcinoma of the head and neck), cervical cancer, cancer without an identified primary source, glioblastoma, esophageal cancer, bladder cancer, TNBC (triple negative breast cancer), CRC ( colorectal cancer), hepatocellular carcinoma, melanoma, NSCLC (non-small cell lung cancer), kidney cancer, ovarian cancer, MSI CRC (highly microsatellite instable colorectal cancer), leukemia (acute or myeloblastic), lymphoma, multiple myeloma, breast melanoma , colorectal cancer, prostate cancer, bladder cancer, sarcoma, hepatocellular carcinoma, glioblastoma, Hodgkin's lymphoma, T- and B-cell acute lymphoblastic leukemia, small cell lung cancer, acute myeloblastic leukemia, refractory B-cell lymphoma,
- PRGPI squam
- the present invention relates to a method for activating a biological activity of a T cell population or NK cell population in a subject in need of such activation, which method comprises administering to the subject an effective amount of the aforementioned immunocytokine or the aforementioned pharmaceutical composition.
- the present invention relates to the use of the aforementioned immunocytokine or the aforementioned pharmaceutical composition for treating an oncological disease in a subject in need of such treatment.
- the oncological disease is selected from the group: SCC (head and neck squamous cell carcinoma), cervical cancer, cancer without an identified primary source, glioblastoma, esophageal cancer, bladder cancer, TNBC (triple negative breast cancer), CRC (colorectal cancer), hepatocellular carcinoma, melanoma, NSCLC (non-small cell lung cancer), kidney cancer, ovarian cancer, MSI CRC (highly microsatellite instable colorectal cancer), leukemia (acute or myeloblastic), lymphoma, multiple myeloma, melanoma, breast cancer, colorectal cancer, cancer prostate cancer, bladder cancer, sarcoma, hepatocellular carcinoma, glioblastoma, Hodgkin's lymphoma, T- and B-cell acute lymphoblastic leukemia, small cell lung cancer, acute myeloid leukemia, refractory B-cell non-Hodgkin's lymphom
- a therapeutically effective amount of an immunocytokine of the invention can reduce the number of cancer cells; reduce the initial size of the tumor; inhibit (ie, to some extent slow down and, preferably, stop) the infiltration of cancer cells of peripheral organs; inhibit (i.e., slow to some extent and preferably stop) tumor metastasis; inhibit, to some extent, tumor growth; and / or alleviate, to some extent, one or more of the symptoms associated with the disorder.
- the immunocytokine of the invention can, to some extent, prevent the growth and / or kill existing cancer cells, it can cause a cytostatic and / or cytotoxic effect.
- efficacy in vivo can be determined, for example, by assessing lifespan, time to disease progression (TTP), tumor response rate (RR), duration of response, and / or quality of life.
- the immunocytokines of this invention can be administered without additional therapeutic treatment, i. E. as an independent therapy.
- treatment with an immunocytokine of this invention may include at least one additional therapeutic treatment (combination therapy).
- the immunocytokine can be co-administered or formulated with another drug / drug for the treatment of cancer.
- co-administration refers to an immunocytokine of the invention, with one or more other therapeutic agents being intended to mean, refer to, or include:
- the immunocytokine of this invention can be combined with a therapeutic agent selected from the group consisting of a cytotoxic agent, a chemotherapeutic agent, an anti-hormonal agent, or another therapeutic antibody.
- cytotoxic agent refers to a substance that inhibits or prevents cell function and / or causes cell destruction.
- the term is understood to include radioactive isotopes (e.g., At 211 , I 131 , I 125 , Y 90 , Re 186 , Re 188 , Sm 153 , Bi 212 , P 32, and radioactive isotopes Lu), chemotherapeutic agents, and toxins such as low molecular weight toxins or enzymatically active toxins derived from bacteria, fungi, plants or animals, including fragments and / or variants thereof.
- radioactive isotopes e.g., At 211 , I 131 , I 125 , Y 90 , Re 186 , Re 188 , Sm 153 , Bi 212 , P 32, and radioactive isotopes Lu
- chemotherapeutic agents e.g., chemotherapeutic agents, and toxins such as low molecular weight toxins
- chemotherapeutic agent is a chemical compound useful in the treatment of cancer.
- examples of chemotherapeutic agents include alkylating agents such as thiotepa and cyclophosphamide (CYTOXAN ®); alkyl sulfonates such as busulfan, improsulfan, and piposulfan; aziridines such as benzodopa, carboquinone, meturedopa, and uredopa; ethyleneimines and methylmelamines, including altretamine, triethylenemelamine, triethylenephosphoramide, triethylenethiophosphoramide, and trimethylmelamine; acetogenins (eg bullatacin and bullatacinone); delta-9- tetrahydrocannabinol (dronabinol, MARIN0L ®); beta lapachone; lapachol; colchicines; betulinic acid; a camptothecin (including the synthetic analogue topotecan (HYCAMTIN
- calicheamicin e.g. calicheamicin gamma II and calicheamicin omega II (see, e.g., Agnew, Chem. Inti. Ed. Engl., 33: 183-186 (1994)); dynemycin, including dynemycin A; esperamycin; as well as the neocarcinostatin chromophore and related chromoprotein chromophores enediin antibiotics, aclacinomisins, actinomycin, autramycin, azaserin, bleomycins, cactinomycin, carbicin, carminomycin, carzinomycin-oxo-dycin, dyacinomycin-5 b-norleucine, doxorubicin (including ADRIAMICIN ®, morfolinodoksorubitsin, tsianomorfolinodoksorubitsin, 2- pyrrolino, doksorubi
- topoisomerase 1 inhibitor e.g., LURTOTECAN ®
- rmRH e.g., ABARELIX ®
- BAY439006 sorafenib; Bayer
- SU-11248 Pfizer
- perifosin a COX-2 inhibitor (eg, celecoxib or etoricoxib), a proteosome inhibitor (eg, PS341); bortezomib (VELCADE ®); CCI-779; typifarnib (811577); orafenib, AVT510; Vs1-2 inhibitor such as oblimersen sodium (GENASENSE ®); pixantrone; EGFR inhibitors (see definition below); tyrosine kinase inhibitors (see definition below); and pharmaceutically acceptable salts, acids or derivatives of any of the above agents; as well as combinations of two or more of the above
- protivogormonalnye agents that act to regulate or inhibit hormone action on tumors such as anti-estrogens with mixed profile agonist / antagonist, including, tamoxifen (NOLVADEX ®), 4- hydroxytamoxifen, trioxifene, toremifene (FAREST0N ®); idoxifene, droloxifene, raloxifene (EVISTA ®), trioxifene, keoxifene, and selective estrogen receptor modulators (SERM), such as SERM3; pure anti-estrogens without agonist properties, such as fulvestrant (FASLODEX ®), and EM800 (such agents may block estrogen receptor dimerization (ER), inhibit DNA binding, metabolism ER amplify and / or reduce the levels of ER); aromatase inhibitors, including steroidal aromatase inhibitors such as formestane and exemestane (AROMASIN ®), and nonsteroidal
- Another therapeutic agent that can be used in combination with the immunocytokine of this invention may be a therapeutic antibody selected from the group of anti-PD1 antibodies (e.g., prolgolimab, pembrolizumab or nivolumab), anti-PD-L1 antibodies, anti-CTLA4 antibodies, anti-antibodies 4-1BB, anti-0X40 antibodies, anti-GITR antibodies, anti-CD20 antibodies (e.g. rituximab), anti-HER2 antibodies (e.g. trastuzumab or pertuzumab), anti-VEGF antibodies (e.g. bevacizumab), or combinations thereof.
- anti-PD1 antibodies e.g., prolgolimab, pembrolizumab or nivolumab
- anti-PD-L1 antibodies e.g., anti-CTLA4 antibodies, anti-antibodies 4-1BB, anti-0X40 antibodies, anti-GITR antibodies, anti-CD20 antibodies (e.g. ritux
- Another therapeutic agent that can be used in combination with the immunocytokine of this invention may be a therapeutically active antitumor compound selected from the group of innate or acquired immunity activators.
- the immunocytokine of this invention can be used in the methods of treatment as described above, can be used in the treatment as described above and / or can be used in the manufacture of medicaments for treatment as described above.
- the immunocytokine of this invention will be administered in an amount effective to treat the condition in question, i. E. in doses and for periods of time necessary to achieve the desired result.
- the therapeutically effective amount may vary depending on factors such as the particular condition being treated, the age, sex, and weight of the patient, and whether the administration of the immunocytokine is self-medication or in combination with one or more additional drugs or treatments. ...
- the dosage regimens can be adjusted to provide the optimal desired response. For example, a single bolus can be administered, several divided doses can be administered over time, or the dose can be proportionally reduced or increased depending on the severity of the therapeutic situation. It is particularly useful to formulate parenteral compositions in unit dosage form for ease of administration and uniformity of dosage.
- Unit dosage form refers to physically discrete units suitable as unitary doses for patients / subjects to be treated; each unit contains a predetermined amount of active compound calculated to produce the desired therapeutic effect in combination with the required pharmaceutical carrier.
- unit dosage forms of the present invention is generally dictated by and directly dependent on (a) the unique characteristics of the chemotherapeutic agent and the particular therapeutic or prophylactic effect to be achieved, and (b) the limitations inherent in the compounding technique of such an active compound for treating sensitivity in subjects.
- dosages and dosage regimen are adjusted in accordance with methods well known in the therapeutic field. This means that the maximum tolerated dose can be readily established and the effective amount can also be determined to provide a detectable therapeutic effect for the patient, as well as the time requirements for administration of each agent to achieve a visible therapeutic effect for the patient.
- dosages and regimens of administration are given as examples in this document, these examples in no way limit the dosages and regimes of administration that may be needed for a patient in the practice of using the present invention.
- dosage values may vary depending on the type and severity of the condition to be alleviated, and may include one or more doses.
- specific administration regimens should be adjusted over time according to the individual need and at the discretion of the healthcare professional who administers or monitors the administration of the compositions, and that the concentration ranges given in this description are given only by way of example and are not intended to limit the scope or practice of the claimed compositions.
- the dosage regimen with the compositions of this invention may be based on various factors including the type of disease, age, weight, sex, health status of the patient, severity of the condition, route of administration, and the particular immunocytokine of the invention. Thus, the dosage regimen can vary widely, but can be determined regularly using standard methods.
- doses can be adjusted based on pharmacokinetic and pharmacodynamic parameters, which can include clinical effects such as toxic effects or laboratory values.
- the present invention encompasses individual dose escalation as determined by the skilled artisan. Determination of the required dose and regimens are well known in the relevant art and will be clear to the person skilled in the art upon reading the ideas disclosed herein.
- a suitable dose of the immunocytokine of this invention will be in the range of 0.1-200 mg / kg, preferably 0.1-100 mg / kg, including about 0.5-50 mg / kg, for example about 1- 20 mg / kg.
- the immunocytokine can be administered, for example, in a dose of at least 0.25 mg / kg, for example, at least 0.5 mg / kg, including at least 1 mg / kg, for example, at least 1.5 mg / kg, for example, as well as at least 2 mg / kg, for example, at least 3 mg / kg, including at least 4 mg / kg, for example at least 5 mg / kg; and for example up to a maximum of 50 mg / kg, including up to a maximum of 30 mg / kg, for example up to a maximum of 20 mg / kg, including up to a maximum of 15 mg / kg.
- the introduction will be repeated, usually at appropriate intervals, for example, once a week, once every two weeks, once every three weeks or once every four weeks, and for as long as deemed appropriate by the responsible physician, who may, in some cases, increase or decrease the dose as needed.
- the required gene segments were obtained from oligonucleotides created by chemical synthesis. Gene segments ranging in length from 300 to 4000 bp, which are flanked by unique restriction sites, were collected by annealing and ligation of oligonucleotides, including PCR amplification and subsequent cloning through these restriction sites. The DNA sequences of the subcloned gene fragments were confirmed by DNA sequencing.
- DNA sequences were determined by Sanger sequencing.
- Infomax's Vector NTI Advance suite, version 8.0 and SnapGene Viewer were used to create, map, analyze, annotate and illustrate sequences.
- IL15SA CK_IL15Ra_Hc_IL15CH1FcLALA in FIG. 1
- CK_IL15_Hc_IL15RaCHlFcLALA in FIG. 2 CK_IL15_Hc_IL15RaCHlFcLALA in FIG. 2
- IL15SA CK_IL15_Hc_IL15RaCHlFcLALA in FIG. 2
- these genes were cloned into plasmids in the form of an N-terminus fusion (fusion protein) with the first constant domain of the kappa light chain of the antibody into the vector pEE-IL15Ra-CK (or pEE-IL15-CK) according to restriction sites Sall / BsiWI (Fig.
- Fab-CK_IL15Ra_Hc_IL15CHlFcknobLALA (hereinafter referred to as IL15SA / PD1 or anti-PDl / IL15SA or IL15SA / PDL1 or anti-PDL1 / IL15SA) in FIG. 4 and Fab- CK_IL15_Hc_IL15RaCHlFcknobLALA in FIG. 4
- the IL15 ligand and receptor genes were cloned into plasmids in the form of an N-terminus fusion with the first constant domain of the kappa light chain of the antibody into the vector pEE-IL15Ra-CK (or pEE-IL15-CK) at the Sall / BsiWI restriction sites (Fig. 5 ) and with the first constant domain of the heavy chain of the antibody into the vector pEE-IL15-CHl-Fc-knob-LALA (or pEE-IL15Ra-CHl-Fc-knob-LALA) IgGl at the Sall / Nhel restriction sites (Fig. 9).
- the Fab portion of the asymmetric antibody as shown in FIG.
- the genes of the variable domains of anti-PDl (prolgolimab) antibodies (hereinafter referred to as IL15SA / PD1 or anti-PDl / IL15SA) or anti-PDLl (BCD-135) (hereinafter referred to as IL15SA / PDL1 or anti-PDLl / IL15SA) were cloned into plasmids in the form of N-terminus fusion with the first constant domain of the kappa light chain of the antibody into the vector pEE-BCD100-02-VL-CK at the Sall / BsiWI restriction sites (Fig.
- Recombinant proteins containing IL15SA were transiently produced in the cells of the Chinese hamster ovary cell line (CHO-K1 line) obtained according to published protocols [Biotechnol Bioeng. 2005 Sep 20; 91 (6): 670-677, Liao Metal. 2004; Biotechnol Lett. 2006 Jun; 28 (11): 843-848; Biotechnol Bioeng. 2003 Nov 5; 84 (3): 332-342].
- Cells constitutively expressing the EBNA1 protein gene (Epstein-Barrvirus nuclear antigen 1) were used. Suspension culture was performed in flasks on an orbital shaker using serum-free media from Life Technologies Corporation and according to the manufacturer's instructions.
- Recombinant proteins were isolated and purified from the culture broth using a protein A affinity chromatography column.
- the clarified culture broth was passed through a 5 ml HiTrap rProtein A Sepharose FF column (GE Healthcare) equilibrated with phosphate buffered saline (PBS, pH 7.4).
- PBS phosphate buffered saline
- the column was then washed with 5 column volumes of PBS to wash out non-specific binding components.
- the bound antigen was eluted using 0.1 M glycine buffer pH 3.
- the main protein elution peak was collected and its pH adjusted to neutrality with 1 M Tris buffer (pH 8). All stages were carried out at a flow rate of 110 cm / h.
- the protein was converted into PBS (pH 7.4) by dialysis using the SnakeSkin Dialysis Tubing technology, filtered (0.22 ⁇ m), transferred into tubes, and stored at -70 ° C.
- the binding affinity constants (IL15SA) 2-Fc (hereinafter referred to as CK IL15Ra Hc IL15CHlFcLALA in Fig. 1 and CK IL15 Hc IL15RaCHlFcLALA in Fig. 2) with human IL2py were obtained using the OctetRed 96 device according to the instructions of ForteBio. AR2G biosensors were pre-rehydrated for an hour in mQ. After activation of biosensors, (IL15SA) 2-Fc preparations at a concentration of 25 ⁇ g / ml in acetate buffer pH4 were nonspecifically (by NH2 groups) immobilized on the biosensor surface.
- the sensors were immersed in wells with Human CD122 / IL-2RB Protein (Fc Tag) solutions (1 and 0.5 ⁇ g / ml) at 30 ° C in PBS buffer containing 0.1% Tween-20 and 0.1% BSA ... In this solution, the association of the IL15SA complex and IB2py took place. After that, the sensors were immersed in a buffer solution for the subsequent stage of dissociation. The analysis was performed at 30 ° C using PBS containing 0.1% Tween-20 and 0.1% BSA as a working buffer.
- Fc Tag Human CD122 / IL-2RB Protein
- Binding affinity constants for IL15SA bispecific immunocytokines (hereinafter referred to as anti-PDl-Fab- CK_IL15Ra_Hc_IL15CHlFcknobLALA anti-PD-Ll-Fab- CK_IL15Ra_Hc_IL15CHlFcknobLALA) with human PD-1 and PD-L1 receptors were generated using an OctetRed 96 instrument according to ForteBio instructions.
- AR2G biosensors were pre-rehydrated for an hour in mQ. After the activation of biosensors, bispecific ones at a concentration of 25 ⁇ g / ml in acetate buffer pH4 were nonspecifically (by IIIb-groups) immobilized on the surface of the biosensor.
- the sensors were immersed in wells with Human CD122 / IL-2RB Protein (Fc Tag) or PD-1-Fc or PD-L1-Fc receptor (1 and 0.5 ⁇ g / ml) in PBS buffer containing 0.1% Tween-20 and 0.1% BSA for the association of the bispecific superagonist and the investigated receptor. After that, the sensors were immersed in a buffer solution for the subsequent stage of dissociation.
- Fc Tag Human CD122 / IL-2RB Protein
- PD-1-Fc or PD-L1-Fc receptor 1 and 0.5 ⁇ g / ml
- the instrumental data was analyzed minus the baseline signal using Octet Data Analysis (version 8.0) according to a standard procedure using a 1: 1 interaction model.
- the cell line NK-92 was used for the test.
- the test was carried out in a 96-well culture plate.
- the suspension contained NK-92 cells and the test antibody at the concentration indicated on the graph. All components of the suspension were prepared in RPMI-160 medium containing fetal bovine serum and glutamine. After adding all the components, the plates were incubated at 37 ° C, 5% CO2. Next, the Alamar Blue dye was added to the wells. After incubation, the fluorescence intensity in the wells was measured.
- IL15SA CK_IL15Ra_Hc_ILl5CH1FcLALA
- IL15SA / PD1 Anti-PD-1 Fab-CK_IL15Ra_Hc _IL15CHlFcLALA
- IL15SA / PDL1 Anti-PDL-1 Fab-CK_IL_IL15Ra_H
- isolated natural killer cells were used, isolated from PBMCs of healthy donors by the method of negative selection. The test was carried out in a 96-well culture plate. The suspension contained natural killer cells, the test antibody at the concentration indicated on the graph. All components of the suspension were prepared in a culture medium containing autologous human plasma. After adding all components, the plates were incubated at 37 ° C, 5% CO2. Then Alamar Blue dye was added to the wells.
- the test used the Jurkat NFAT-FLuc PD-1 cell line, created on the basis of the Jurkat cell line, stably expressing PD-1 on the surface and containing the gene encoding firefly luciferase under the control of the NFAT promoter; and the Raji PDL1 cell line, based on the Raji cell line, stably expressing PDL1 on the surface.
- IL15SA CK_IL15Ra_Hc_IL15CHlFcLALA
- anti-PDl / IL15SA Anti-PD-1 Fab- CK_IL15Ra_Hc _IL15CH1FcknobLALA
- anti-PDl antagonist prolgolimab
- the test was carried out in a 96-well culture plate.
- the suspension in each well contained Jurkat NFAT-FLuc PD-1 cells, Raji PDL1 cells, aCD3 / aTAAl at a concentration of 1 ng / ml, the test antibody at the concentration indicated in the graph.
- the plates were incubated at 37 ° C, 5% CO2, and then, using a kit for assessing luminescence, the intensity of Lucifer in the wells was measured.
- the test used the Jurkat NFAT-FLuc PD-1 cell line, created on the basis of the Jurkat cell line, stably expressing PD-1 on the surface and containing the gene encoding firefly luciferase under the control of the NFAT promoter; and the Raji PDL1 cell line, based on the Raji cell line, stably expressing PDL1 on the surface.
- IL15SA CK_IL15Ra_Hc_IL15CHlFcLALA
- anti-PDLl / IL15SA Anti-PD-Ll Fab- CK_IL15Ra_Hc _IL15CHlFcknobLALA
- anti-PDLl antagonist atezolizumab
- the test was carried out in a 9b-well culture plate.
- the suspension in each well contained Jurkat NFAT-FLuc PD-1 cells, Raji PDL1 cells, aCD3 / aTAAl at a concentration of 1 ng / ml, the test antibody at the concentration indicated in the graph.
- the plates were incubated at 37 ° C, 5% CO2, and then, using a kit for assessing luminescence, the intensity of Lucifer in the wells was measured.
- TAA tumor associated antigen
- ADCC antibody-dependent cellular cytotoxicity
- the test we used natural killer cells isolated from PBMCs of healthy donors by the method of negative selection. The test was carried out in a 9b-well culture plate. The suspension contained natural killer cells and Raji cells, the effector antibody Rituximab and the test antibody at the concentration indicated in the graph. All components of the suspension were prepared in a culture medium containing fetal bovine serum and glutamine. After adding all the components, the plates were incubated at 37 ° C, 5% CO2. Next, the culture broth was collected and the content of lactate dehydrogenase was investigated using a kit for determining LDH.
- IL15SA CK_IL15Ra_Hc_ILl5CH1FcLALA
- anti-PDl / IL15SA Anti-PD-1 Fab-CK_IL15Ra_Hc _IL15CHlFcknobLALA preparations
- PBMCs were isolated from whole blood of healthy donors by Ficoll density gradient centrifugation.
- the test was carried out in a 96-well culture plate.
- the suspension in each well contained freshly isolated PBMCs and the plotted antibody at 0.1 ⁇ g / ml. After mixing PBMCs and antibodies, the plate was incubated for 16 h at 37 ° C, 5% CO2. Further, the proportion of CD56 +, CD19 +, CD3 +, CD4 +, and CD8 + subpopulations of PBMCs in suspensions was assessed by direct staining of suspensions with fluorescently labeled antibodies against the corresponding CDs and subsequent analysis of cells on a flow cytometer. For CD56 +, CD19 +, CD3 + cells, the graphs show the proportion of all cells of the analyzed suspension, for CD4 +, CD8 + - the proportion of CD3 + cells. The cytotoxic effect of IL15SA preparations was comparatively studied
- CK_IL15Ra_Hc_IL15CHlFcLALA anti-PDl / IL15SA
- Anti-PD-1 Fab- CK IL15Ra He IL15CHlFcknobLALA anti-PDl
- prolgolimab anti-PDl mixtures + IL15SA
- results shown in FIG. 17-21 indicate the absence of a significant cytotoxic effect of candidates, that is, no more than 10% decrease in the number of immunoreactive cells in comparison with negative control AB (those without any exogenous antibodies).
- the control antibody anti-CD20 showed a consistently complete depletion of the CD20 + B cell population. Thus, all the candidates under consideration do not exhibit significant nonspecific cytotoxicity in vitro on human blood cells.
- the preparation IL15 superagonist with a concentration of 9 mg / ml in PBS buffer was heated for 12 hours at a temperature of 50 " C.
- the determination of aggregation after thermal stress was carried out by gel filtration high-performance chromatography. Chromatography was performed on an HPLC (Agilent) 1100 system on a Tosoh TSK-Gel column G3000SWXL, 7.8 mm x 30 cm, cat. DO 08541 with a Tosoh TSKgel Guard SWXL, 6.0 mm x 4.0 cm, with a particle diameter of 7 ⁇ m, cat.P 08543.
- Elution was carried out in isocratic mode with a mobile phase: 50 mM aPb, 0, 3 M NaCl, pH 7.0 at a flow rate of 0.5 ml / min Detection was carried out at wavelengths of 214 and 280 nm.
- Antibody samples were diluted with PBS buffer, pH 7.5, to a concentration of ⁇ 1 mg / ml.
- the volume of injected sample _ 10 ⁇ l The calibration mixture Gel filtration standard (from Bio-Rad), cat P 151-1901 was pre-chromatographed. in which the IL15 superagonist demonstrates high homogeneity (the content of aggregates in the solution was no more than 5%).
- mice of the C57BL / 6 line were used, which were inoculated with the B16F10 tumor line.
- Each animal in the group was injected subcutaneously in the right flank with 1.5> ⁇ 10 5 tumor cells.
- day 7 after cell inoculation day 1 of the experiment, the animals were divided into groups as shown in Table 3. Evaluation of efficacy was carried out using a single dose of BCD-225, IL15SA / a-mPD-1- bispecific monoclonal antibody containing IL-15SA and an anti-mouse PD-1 Fab fragment derived from the mouse RMP1-14 antibody.
- variable domains of the RMP1-14 antibody was kindly provided by Hideo Yagita, PhD, Juntendo University School of Medicine. Genes and preparations of antibodies RMP1-14 variable domains were synthesized according to example 1. In addition, a reference preparation ALT-803 was synthesized [Han KP et al,
- Preparations BCD-225 (IL15SA), IL15SA / a-mPD-1 and ALT-803 were injected intraperitoneally in a volume of 0.2 ml on days 1, 4, 8, and 11 of the experiment.
- the anti-mPD-1 drug was injected intraperitoneally in a volume of 0.2 ml on days 2, 5, 9, and 12 of the experiment.
- the negative control group was injected with sodium acetate buffer on days 1, 2, 4, 5, 8, 9, 11 and 12 of the experiment in a volume of 0.2 ml ( Figure 23).
- the indicator of tumor growth inhibition (TPO) was used as a criterion for the effectiveness of the study drug, which is calculated taking into account the median value of the tumor volume in the negative control group (V c ) and the drug group (V t ) according to the formula: 100
- TPO in the BCD-225 group was 52%, in the ALT-803 group - 53%.
- TPO in the IL15SA / anti-mPD-1 bispecific antibody group was 58% on the 11th day of the experiment.
- TPO values in the groups of the combination of drugs BCD-225 + anti-mPD-1 and ALT-803 + anti-mPD-1 were equal to 72% on the 11th day of the experiment, in the group of the combination IL15SA / a-mPD-ln anti-mPD-1 - 69%.
- the obtained TPO values indicate a more pronounced antitumor activity of the combination of the studied drugs with anti-mPD-1 compared with the activity of these drugs in monotherapy.
- mice For a comparative assessment of the mortality of mice as a result of the use of preparations of IL15 superagonists used the model and a series of animals described in example 11. The assessment of survival was carried out by counting the dead or euthanized in agonizing state of animals.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Immunology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Toxicology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Cell Biology (AREA)
- Engineering & Computer Science (AREA)
- Epidemiology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Priority Applications (16)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| PE2022000447A PE20220603A1 (es) | 2019-09-19 | 2020-09-20 | Inmunocitoquina que comprende un complejo de proteina heterodimerico basado en il-15/il-15ra y su uso |
| JP2022518285A JP2022549276A (ja) | 2019-09-19 | 2020-09-20 | Il-15/il-15raに基づくヘテロ二量体タンパク質複合体を含む、イムノサイトカイン |
| MA56286A MA56286B1 (fr) | 2019-09-19 | 2020-09-20 | Immunocytokine comprenant un complexe protéinique hétéro-dimère à base de il-15 et il-15r? |
| CA3151780A CA3151780A1 (en) | 2019-09-19 | 2020-09-20 | Immunocytokine comprising heterodimeric protein complex based on il-15/il-15ra |
| BR112022005173A BR112022005173A2 (pt) | 2019-09-19 | 2020-09-20 | Imunocitocina compreendendo complexo de proteína heterodimérica baseado em il-15/il-15ra, ácidos nucleicos, vetor, método célula hospedeira, composições e usos associados |
| AU2020351560A AU2020351560A1 (en) | 2019-09-19 | 2020-09-20 | Immunocytokine comprising heterodimeric protein complex based on IL-15/IL-15Rα |
| KR1020227013100A KR20220145323A (ko) | 2019-09-19 | 2020-09-20 | Il-15/il-15ra에 기반한 이형이량체 단백질 복합체를 포함하는 면역사이토카인 |
| PH1/2022/550688A PH12022550688A1 (en) | 2019-09-19 | 2020-09-20 | Immunocytokine comprising heterodimeric protein complex based on il-15/il-15r# |
| CN202080080165.8A CN115297885A (zh) | 2019-09-19 | 2020-09-20 | 包含基于IL-15/IL-15Rα的异二聚体蛋白质复合物的免疫细胞因子 |
| US17/761,838 US20230011234A1 (en) | 2019-09-19 | 2020-09-20 | Immunocytokine comprising heterodymeric protein complex based on il-15/il-15ra |
| MX2022003306A MX2022003306A (es) | 2019-09-19 | 2020-09-20 | Inmunocitoquina que comprende un complejo de proteina heterodimerico basado en il-15/il-15ra y su uso. |
| EP20865705.6A EP4032539A4 (en) | 2019-09-19 | 2020-09-20 | Immunocytokine comprising heterodimeric protein complex based on il-15/il-15r alpha |
| JOP/2022/0071A JOP20220071A1 (ar) | 2019-09-19 | 2022-03-17 | سيتوكين مناعي يشمل معقد بروتين دايمري غير متجانس على أساس IL-15/IL-15Ra |
| CONC2022/0003156A CO2022003156A2 (es) | 2019-09-19 | 2022-03-18 | Inmunocitoquina que comprende un complejo de proteína heterodimérico basado en il-15/il-15rα y su uso |
| ZA2022/03254A ZA202203254B (en) | 2019-09-19 | 2022-03-18 | Immunocytokine comprising heterodimeric protein complex based on il-15/il-15rα |
| JP2025118407A JP2025182218A (ja) | 2019-09-19 | 2025-07-14 | Il-15/il-15raに基づくヘテロ二量体タンパク質複合体を含む、イムノサイトカイン |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| RU2019129569A RU2753282C2 (ru) | 2019-09-19 | 2019-09-19 | ИММУНОЦИТОКИН, ВКЛЮЧАЮЩИЙ ГЕТЕРОДИМЕРНЫЙ БЕЛКОВЫЙ КОМПЛЕКС НА ОСНОВЕ IL-15/IL-15Rα, И ЕГО ПРИМЕНЕНИЕ |
| RU2019129569 | 2019-09-19 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2021054867A1 true WO2021054867A1 (ru) | 2021-03-25 |
Family
ID=74873995
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/RU2020/050233 Ceased WO2021054867A1 (ru) | 2019-09-19 | 2020-09-20 | Иммуноцитокин, включающий гетеро димерный белковый комплекс на основе il-15 и il-15rα |
Country Status (21)
| Country | Link |
|---|---|
| US (1) | US20230011234A1 (https=) |
| EP (1) | EP4032539A4 (https=) |
| JP (2) | JP2022549276A (https=) |
| KR (1) | KR20220145323A (https=) |
| CN (1) | CN115297885A (https=) |
| AR (1) | AR120011A1 (https=) |
| AU (1) | AU2020351560A1 (https=) |
| BR (1) | BR112022005173A2 (https=) |
| CA (1) | CA3151780A1 (https=) |
| CO (1) | CO2022003156A2 (https=) |
| JO (1) | JOP20220071A1 (https=) |
| MA (1) | MA56286B1 (https=) |
| MX (1) | MX2022003306A (https=) |
| PE (1) | PE20220603A1 (https=) |
| PH (1) | PH12022550688A1 (https=) |
| PY (1) | PY2056649A (https=) |
| RU (1) | RU2753282C2 (https=) |
| TW (1) | TWI891660B (https=) |
| UY (1) | UY38889A (https=) |
| WO (1) | WO2021054867A1 (https=) |
| ZA (1) | ZA202203254B (https=) |
Cited By (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN115141283A (zh) * | 2022-03-10 | 2022-10-04 | 厦门柏慈生物科技有限公司 | 一种融合蛋白、制备方法及其应用 |
| CN116178572A (zh) * | 2022-02-28 | 2023-05-30 | 厦门柏慈生物科技有限公司 | 构建嵌合蛋白的嵌合区域、构建方法、嵌合蛋白及其应用 |
| WO2023133595A2 (en) | 2022-01-10 | 2023-07-13 | Sana Biotechnology, Inc. | Methods of ex vivo dosing and administration of lipid particles or viral vectors and related systems and uses |
| WO2023193015A1 (en) | 2022-04-01 | 2023-10-05 | Sana Biotechnology, Inc. | Cytokine receptor agonist and viral vector combination therapies |
| US11866476B2 (en) | 2018-09-27 | 2024-01-09 | Xilio Development, Inc. | Masked IL-2-Fc fusion polypeptides |
| WO2024037322A1 (zh) * | 2022-08-15 | 2024-02-22 | 海徕科(北京)生物技术有限公司 | 一种IL-15突变体-Fc/IL-15Rα亚基-Fc异源二聚体及其用途 |
| US12280120B2 (en) | 2020-11-25 | 2025-04-22 | Xilio Development, Inc. | Tumor-specific cleavable linkers |
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN121241063A (zh) * | 2023-08-04 | 2025-12-30 | 上海艾乐晞生物科技有限公司 | Sushi结构域突变体、融合蛋白、药物组合物和用途 |
| WO2025140627A1 (zh) * | 2023-12-28 | 2025-07-03 | 南通壹宸生物医药科技有限公司 | 融合抗体及其应用 |
| WO2026037415A1 (zh) * | 2024-08-16 | 2026-02-19 | 北京清辉联诺生物科技有限责任公司 | 一种IL15/IL15Rα复合物及其在细胞疗法领域的应用 |
Citations (26)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4399216A (en) | 1980-02-25 | 1983-08-16 | The Trustees Of Columbia University | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US4510245A (en) | 1982-11-18 | 1985-04-09 | Chiron Corporation | Adenovirus promoter system |
| US4634665A (en) | 1980-02-25 | 1987-01-06 | The Trustees Of Columbia University In The City Of New York | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| EP0216846A1 (en) | 1985-04-01 | 1987-04-08 | Celltech Ltd | Transformed myeloma cell-line and a process for the expression of a gene coding for a eukaryotic polypeptide employing same. |
| EP0256055A1 (en) | 1986-01-23 | 1988-02-24 | Celltech Ltd | RECOMBINANT DNA SEQUENCES, THESE VECTORS, AND METHODS OF USE THEREOF. |
| US4740461A (en) | 1983-12-27 | 1988-04-26 | Genetics Institute, Inc. | Vectors and methods for transformation of eucaryotic cells |
| EP0323997A1 (en) | 1987-07-23 | 1989-07-19 | Celltech Limited | Recombinant dna expression vectors |
| EP0338841A1 (en) | 1988-04-18 | 1989-10-25 | Celltech Limited | Recombinant DNA methods, vectors and host cells |
| US4912040A (en) | 1986-11-14 | 1990-03-27 | Genetics Institute, Inc. | Eucaryotic expression system |
| US4959455A (en) | 1986-07-14 | 1990-09-25 | Genetics Institute, Inc. | Primate hematopoietic growth factors IL-3 and pharmaceutical compositions |
| US4968615A (en) | 1985-12-18 | 1990-11-06 | Ciba-Geigy Corporation | Deoxyribonucleic acid segment from a virus |
| US5168062A (en) | 1985-01-30 | 1992-12-01 | University Of Iowa Research Foundation | Transfer vectors and microorganisms containing human cytomegalovirus immediate-early promoter-regulatory DNA sequence |
| US5179017A (en) | 1980-02-25 | 1993-01-12 | The Trustees Of Columbia University In The City Of New York | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US5500362A (en) | 1987-01-08 | 1996-03-19 | Xoma Corporation | Chimeric antibody with specificity to human B cell surface antigen |
| WO1996027011A1 (en) | 1995-03-01 | 1996-09-06 | Genentech, Inc. | A method for making heteromultimeric polypeptides |
| US5821337A (en) | 1991-06-14 | 1998-10-13 | Genentech, Inc. | Immunoglobulin variants |
| WO2007046006A2 (en) | 2005-10-20 | 2007-04-26 | Institut National De La Sante Et De La Recherche Medicale (Inserm) | Il-15ralpha sushi domain as a selective and potent enhancer of il-15 action through il-15rbeta/gamma, and hyperagonist (ilralpha sushi-il 15) fusion proteins |
| WO2012040323A2 (en) * | 2010-09-21 | 2012-03-29 | Altor Bioscien Corporation | Multimeric il-15 soluble fusion molecules and methods of making and using same |
| WO2012175222A1 (en) | 2011-06-24 | 2012-12-27 | Cytune | AN IL-15 AND IL-15Rα SUSHI DOMAIN BASED IMMUNOCYTOKINES |
| WO2015018528A1 (en) | 2013-08-08 | 2015-02-12 | Cytune Pharma | Il-15 and il-15raplha sushi domain based modulokines |
| WO2015103928A1 (zh) | 2014-01-08 | 2015-07-16 | 上海恒瑞医药有限公司 | Il-15异源二聚体蛋白及其用途 |
| WO2016095642A1 (zh) | 2014-12-19 | 2016-06-23 | 江苏恒瑞医药股份有限公司 | 白细胞介素15蛋白复合物及其用途 |
| WO2018013017A1 (ru) | 2016-07-13 | 2018-01-18 | Закрытое Акционерное Общество "Биокад" | Анти-pd-1-антитела, способ их получения и способ применения |
| WO2018071918A1 (en) | 2016-10-14 | 2018-04-19 | Xencor, Inc. | Bispecific heterodimeric fusion proteins containing il-15/il-15ralpha fc-fusion proteins and pd-1 antibody fragments |
| RU2665790C1 (ru) | 2017-04-17 | 2018-09-04 | Закрытое Акционерное Общество "Биокад" | Моноклональное антитело к pd-l1 |
| WO2019006472A1 (en) | 2017-06-30 | 2019-01-03 | Xencor, Inc. | TARGETED HETETRODIMERIC FUSION PROTEINS CONTAINING IL-15 / IL-15RA AND ANTIGEN-BINDING DOMAINS |
Family Cites Families (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| ES2221065T3 (es) * | 1996-08-16 | 2004-12-16 | The President And Fellows Of Harvard College | Proteinas de fusion de clase ii del mhc, solubles, monovalentes o polivalentes, y sus usos. |
| NZ506071A (en) * | 1998-02-19 | 2003-05-30 | Harvard College | Monovalent, multivalent, and multimeric major histocompatibility complex (MHC) binding domain fusion proteins and conjugates, and uses therefore |
| WO2001046261A1 (en) * | 1999-12-23 | 2001-06-28 | Zymogenetics, Inc. | Method for treating inflammation |
| DK2160401T3 (da) * | 2007-05-11 | 2014-10-20 | Altor Bioscience Corp | Fusionsmolekyler og il-15-varianter |
| RU2687043C2 (ru) * | 2013-04-29 | 2019-05-06 | Ф. Хоффманн-Ля Рош Аг | МОДИФИЦИРОВАННЫЕ АСИММЕТРИЧНЫЕ АНТИТЕЛА, СВЯЗЫВАЮЩИЕ Fc-РЕЦЕПТОР, И СПОСОБЫ ИХ ПРИМЕНЕНИЯ |
| CA3151221C (en) * | 2014-06-30 | 2026-01-13 | Altor Bioscience Corporation | Il-15-based molecules and methods of use thereof |
| CN118562016A (zh) * | 2016-10-21 | 2024-08-30 | 艾尔特生物科技公司 | 基于多聚体il-15的分子 |
| CN117986384A (zh) * | 2017-03-06 | 2024-05-07 | 艾尔特生物科技公司 | 与il-12和il-18的基于il-15的融合物 |
| US20210017247A1 (en) * | 2017-07-03 | 2021-01-21 | Torque Therapeutics, Inc. | Fusion Molecules Targeting Immune Regulatory Cells and Uses Thereof |
-
2019
- 2019-09-19 RU RU2019129569A patent/RU2753282C2/ru active
-
2020
- 2020-09-18 AR ARP200102607A patent/AR120011A1/es unknown
- 2020-09-20 MA MA56286A patent/MA56286B1/fr unknown
- 2020-09-20 WO PCT/RU2020/050233 patent/WO2021054867A1/ru not_active Ceased
- 2020-09-20 CA CA3151780A patent/CA3151780A1/en active Pending
- 2020-09-20 EP EP20865705.6A patent/EP4032539A4/en active Pending
- 2020-09-20 KR KR1020227013100A patent/KR20220145323A/ko active Pending
- 2020-09-20 JP JP2022518285A patent/JP2022549276A/ja active Pending
- 2020-09-20 PE PE2022000447A patent/PE20220603A1/es unknown
- 2020-09-20 US US17/761,838 patent/US20230011234A1/en active Pending
- 2020-09-20 BR BR112022005173A patent/BR112022005173A2/pt unknown
- 2020-09-20 MX MX2022003306A patent/MX2022003306A/es unknown
- 2020-09-20 PH PH1/2022/550688A patent/PH12022550688A1/en unknown
- 2020-09-20 CN CN202080080165.8A patent/CN115297885A/zh active Pending
- 2020-09-20 AU AU2020351560A patent/AU2020351560A1/en active Pending
- 2020-09-21 TW TW109132634A patent/TWI891660B/zh active
- 2020-09-21 PY PY202002056649A patent/PY2056649A/es unknown
- 2020-09-22 UY UY0001038889A patent/UY38889A/es unknown
-
2022
- 2022-03-17 JO JOP/2022/0071A patent/JOP20220071A1/ar unknown
- 2022-03-18 ZA ZA2022/03254A patent/ZA202203254B/en unknown
- 2022-03-18 CO CONC2022/0003156A patent/CO2022003156A2/es unknown
-
2025
- 2025-07-14 JP JP2025118407A patent/JP2025182218A/ja active Pending
Patent Citations (30)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4634665A (en) | 1980-02-25 | 1987-01-06 | The Trustees Of Columbia University In The City Of New York | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US4399216A (en) | 1980-02-25 | 1983-08-16 | The Trustees Of Columbia University | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US5179017A (en) | 1980-02-25 | 1993-01-12 | The Trustees Of Columbia University In The City Of New York | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US4510245A (en) | 1982-11-18 | 1985-04-09 | Chiron Corporation | Adenovirus promoter system |
| US4740461A (en) | 1983-12-27 | 1988-04-26 | Genetics Institute, Inc. | Vectors and methods for transformation of eucaryotic cells |
| US5168062A (en) | 1985-01-30 | 1992-12-01 | University Of Iowa Research Foundation | Transfer vectors and microorganisms containing human cytomegalovirus immediate-early promoter-regulatory DNA sequence |
| EP0216846A1 (en) | 1985-04-01 | 1987-04-08 | Celltech Ltd | Transformed myeloma cell-line and a process for the expression of a gene coding for a eukaryotic polypeptide employing same. |
| US4968615A (en) | 1985-12-18 | 1990-11-06 | Ciba-Geigy Corporation | Deoxyribonucleic acid segment from a virus |
| EP0256055A1 (en) | 1986-01-23 | 1988-02-24 | Celltech Ltd | RECOMBINANT DNA SEQUENCES, THESE VECTORS, AND METHODS OF USE THEREOF. |
| US4959455A (en) | 1986-07-14 | 1990-09-25 | Genetics Institute, Inc. | Primate hematopoietic growth factors IL-3 and pharmaceutical compositions |
| US4912040A (en) | 1986-11-14 | 1990-03-27 | Genetics Institute, Inc. | Eucaryotic expression system |
| US5500362A (en) | 1987-01-08 | 1996-03-19 | Xoma Corporation | Chimeric antibody with specificity to human B cell surface antigen |
| EP0323997A1 (en) | 1987-07-23 | 1989-07-19 | Celltech Limited | Recombinant dna expression vectors |
| EP0338841A1 (en) | 1988-04-18 | 1989-10-25 | Celltech Limited | Recombinant DNA methods, vectors and host cells |
| US5821337A (en) | 1991-06-14 | 1998-10-13 | Genentech, Inc. | Immunoglobulin variants |
| WO1996027011A1 (en) | 1995-03-01 | 1996-09-06 | Genentech, Inc. | A method for making heteromultimeric polypeptides |
| WO2007046006A2 (en) | 2005-10-20 | 2007-04-26 | Institut National De La Sante Et De La Recherche Medicale (Inserm) | Il-15ralpha sushi domain as a selective and potent enhancer of il-15 action through il-15rbeta/gamma, and hyperagonist (ilralpha sushi-il 15) fusion proteins |
| WO2012040323A2 (en) * | 2010-09-21 | 2012-03-29 | Altor Bioscien Corporation | Multimeric il-15 soluble fusion molecules and methods of making and using same |
| WO2012175222A1 (en) | 2011-06-24 | 2012-12-27 | Cytune | AN IL-15 AND IL-15Rα SUSHI DOMAIN BASED IMMUNOCYTOKINES |
| RU2644671C2 (ru) * | 2011-06-24 | 2018-02-13 | Ситюн Фарма | ИММУНОЦИТОКИНЫ НА ОСНОВЕ IL-15 И IL-R[альфа] ДОМЕНА SUSHI |
| WO2015018528A1 (en) | 2013-08-08 | 2015-02-12 | Cytune Pharma | Il-15 and il-15raplha sushi domain based modulokines |
| RU2689717C2 (ru) * | 2014-01-08 | 2019-05-28 | Шанхай Хэнжуй Фармасьютикал Ко., Лтд. | Гетеродимерный белок il-15 и его применения |
| WO2015103928A1 (zh) | 2014-01-08 | 2015-07-16 | 上海恒瑞医药有限公司 | Il-15异源二聚体蛋白及其用途 |
| WO2016095642A1 (zh) | 2014-12-19 | 2016-06-23 | 江苏恒瑞医药股份有限公司 | 白细胞介素15蛋白复合物及其用途 |
| WO2018013017A1 (ru) | 2016-07-13 | 2018-01-18 | Закрытое Акционерное Общество "Биокад" | Анти-pd-1-антитела, способ их получения и способ применения |
| WO2018071919A1 (en) | 2016-10-14 | 2018-04-19 | Xencor, Inc. | IL15/IL15Rα HETERODIMERIC FC-FUSION PROTEINS |
| WO2018071918A1 (en) | 2016-10-14 | 2018-04-19 | Xencor, Inc. | Bispecific heterodimeric fusion proteins containing il-15/il-15ralpha fc-fusion proteins and pd-1 antibody fragments |
| RU2665790C1 (ru) | 2017-04-17 | 2018-09-04 | Закрытое Акционерное Общество "Биокад" | Моноклональное антитело к pd-l1 |
| WO2018194496A2 (ru) | 2017-04-17 | 2018-10-25 | Закрытое Акционерное Общество "Биокад" | Моноклональное антитело к pd-l1 |
| WO2019006472A1 (en) | 2017-06-30 | 2019-01-03 | Xencor, Inc. | TARGETED HETETRODIMERIC FUSION PROTEINS CONTAINING IL-15 / IL-15RA AND ANTIGEN-BINDING DOMAINS |
Non-Patent Citations (31)
| Title |
|---|
| "UniProtKB", Database accession no. Q13261 |
| AGNEW, CHEM. INTL. ED. ENGL., vol. 33, 1994, pages 183 - 186 |
| ATWELL, SRIDGWAY, J. B.WELLS, J. A.CARTER, P, J MOL BIOL, vol. 270, 1997, pages 26 - 35 |
| BAMFORD RN ET AL., J. IMMUNOL., vol. 160, 1998, pages 4418 - 4426 |
| BIOTECHNOL BIOENG, vol. 84, no. 3, 5 November 2003 (2003-11-05), pages 332 - 342 |
| BIOTECHNOL BIOENG, vol. 91, no. 6, 20 September 2005 (2005-09-20), pages 670 - 677 |
| BIOTECHNOL LETT, vol. 28, no. 11, June 2006 (2006-06-01), pages 843 - 848 |
| BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426 |
| BUDAGIAN V ET AL., JBC, vol. 279, no. 39, 2004, pages 40368 - 40375 |
| BURKS ET AL., PROC NATL ACAD SCI USA, vol. 94, 1997, pages 412 - 417 |
| BURTON, J.D. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 91, 1994, pages 4935 |
| CLYNES ET AL., PNAS (USA, vol. 95, 1998, pages 652 - 656 |
| GAZZANO-SANTORO ET AL., J. IMMUNOL. METHODS, vol. 202, 1996, pages 163 |
| GRABSTEIN, K.H. ET AL., SCIENCE, vol. 264, 1994, pages 965 |
| HAN KP ET AL., CYTOKINE, vol. 56, no. 3, December 2011 (2011-12-01), pages 804 - 10 |
| HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883 |
| KIRMAN I, AM. J. GASTROENTEROL., vol. 91, 1996, pages 1789 |
| KURYS G ET AL., J. BIOL. CHEM., vol. 275, 2000, pages 30653 - 30659 |
| LIAO, METAL., 2004 |
| MCLNNES I.B., IMMUNOLOGY TODAY, vol. 19, 1998, pages 75 - 79 |
| MERCHANT, A. M. ET AL., NATURE BIOTECH, vol. 16, 1998, pages 677 - 681 |
| MORTIER ET AL., THE JOURNAL OF IMMUNOLOGY, vol. 173, 2004, pages 1681 - 1688 |
| MUSSO ET AL., BLOOD, vol. 93, no. 10, 15 May 1999 (1999-05-15), pages 3531 - 3539 |
| RAVETCHKINET, ANNU. REV. IMMUNOL, vol. 9, 1991, pages 457 - 92 |
| SAMBROOK J ET AL.: "Molecular cloning: A laboratory manual", 1989, COLD SPRING HARBOR LABORATORY PRESS |
| See also references of EP4032539A4 |
| WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 546 |
| WILKINSON, J. EXP. MED., vol. 181, 1995, pages 1255 - 1259 |
| WOOF J.BURTON D, NAT REV IMMUNOL, vol. 4, 2004, pages 89 - 99 |
| WU ET AL., PROC NATL ACAD SCI USA, vol. 95, no. 6037, 1998, pages 6042 |
| YAMADA Y, LEUKEMIA AND LYMPHOMA, vol. 35, no. 1-2, 1999, pages 37 - 45 |
Cited By (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11866476B2 (en) | 2018-09-27 | 2024-01-09 | Xilio Development, Inc. | Masked IL-2-Fc fusion polypeptides |
| US12280120B2 (en) | 2020-11-25 | 2025-04-22 | Xilio Development, Inc. | Tumor-specific cleavable linkers |
| WO2023133595A2 (en) | 2022-01-10 | 2023-07-13 | Sana Biotechnology, Inc. | Methods of ex vivo dosing and administration of lipid particles or viral vectors and related systems and uses |
| CN116178572A (zh) * | 2022-02-28 | 2023-05-30 | 厦门柏慈生物科技有限公司 | 构建嵌合蛋白的嵌合区域、构建方法、嵌合蛋白及其应用 |
| CN115141283A (zh) * | 2022-03-10 | 2022-10-04 | 厦门柏慈生物科技有限公司 | 一种融合蛋白、制备方法及其应用 |
| WO2023169349A1 (zh) * | 2022-03-10 | 2023-09-14 | 厦门柏慈生物科技有限公司 | 一种融合蛋白、制备方法及其应用 |
| WO2023193015A1 (en) | 2022-04-01 | 2023-10-05 | Sana Biotechnology, Inc. | Cytokine receptor agonist and viral vector combination therapies |
| WO2024037322A1 (zh) * | 2022-08-15 | 2024-02-22 | 海徕科(北京)生物技术有限公司 | 一种IL-15突变体-Fc/IL-15Rα亚基-Fc异源二聚体及其用途 |
Also Published As
| Publication number | Publication date |
|---|---|
| MA56286A1 (fr) | 2023-05-31 |
| AR120011A1 (es) | 2022-01-26 |
| TWI891660B (zh) | 2025-08-01 |
| CA3151780A1 (en) | 2021-03-25 |
| UY38889A (es) | 2021-04-30 |
| RU2753282C2 (ru) | 2021-08-12 |
| CN115297885A (zh) | 2022-11-04 |
| PH12022550688A1 (en) | 2023-05-29 |
| KR20220145323A (ko) | 2022-10-28 |
| ZA202203254B (en) | 2025-10-29 |
| US20230011234A1 (en) | 2023-01-12 |
| EP4032539A1 (en) | 2022-07-27 |
| PY2056649A (es) | 2021-06-17 |
| PE20220603A1 (es) | 2022-04-25 |
| TW202124420A (zh) | 2021-07-01 |
| MX2022003306A (es) | 2022-04-26 |
| CO2022003156A2 (es) | 2022-04-19 |
| AU2020351560A1 (en) | 2022-11-24 |
| EP4032539A4 (en) | 2023-09-13 |
| JP2025182218A (ja) | 2025-12-12 |
| RU2019129569A (ru) | 2021-03-19 |
| JOP20220071A1 (ar) | 2022-03-17 |
| RU2019129569A3 (https=) | 2021-03-19 |
| BR112022005173A2 (pt) | 2022-08-16 |
| MA56286B1 (fr) | 2023-09-27 |
| JP2022549276A (ja) | 2022-11-24 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| RU2753282C2 (ru) | ИММУНОЦИТОКИН, ВКЛЮЧАЮЩИЙ ГЕТЕРОДИМЕРНЫЙ БЕЛКОВЫЙ КОМПЛЕКС НА ОСНОВЕ IL-15/IL-15Rα, И ЕГО ПРИМЕНЕНИЕ | |
| AU2019301204B2 (en) | Antibody molecules that bind PD-L1 and CD137 | |
| KR102937863B1 (ko) | Cd47 및 pd-l1에 특이적인 항체 | |
| AU2019407814B2 (en) | Bifunctional anti-PD-1/IL-7 molecule | |
| EP3820899B1 (en) | Antibody molecules | |
| AU2019303080B2 (en) | Fc binding fragments comprising an OX40 antigen-binding site | |
| KR102679554B1 (ko) | Pd-l1에 대한 단일클론 항체 | |
| CN105753986B (zh) | 一类抗cd20靶向抗体及用途 | |
| JP7695200B2 (ja) | Gitrに特異的に結合するモノクローナル抗体 | |
| CN110072553B (zh) | 在抗pd-l1/pd1治疗失败之后抗csf-1r抗体与抗pd-l1抗体组合对肿瘤的治疗 | |
| EA043937B1 (ru) | ИММУНОЦИТОКИН, ВКЛЮЧАЮЩИЙ ГЕТЕРОДИМЕРНЫЙ БЕЛКОВЫЙ КОМПЛЕКС НА ОСНОВЕ IL-15 И IL-15Rα, И ЕГО ПРИМЕНЕНИЕ | |
| CA3201656A1 (en) | Immunocytokine for activating human il-10ra receptor and use thereof | |
| HK40082956A (en) | IMMUNOCYTOKINE COMPRISING HETERODIMERIC PROTEIN COMPLEX BASED ON IL-15/IL-15Rα | |
| OA21960A (en) | Isolated bispecific antibody that specifically binds to CD47 and PD-L1. | |
| EA047872B1 (ru) | ИММУНОЦИТОКИН ДЛЯ АКТИВАЦИИ IL-10Rα РЕЦЕПТОРА ЧЕЛОВЕКА И ЕГО ПРИМЕНЕНИЕ | |
| EA044786B1 (ru) | Моноклональное антитело, которое специфически связывается с gitr | |
| EA041915B1 (ru) | Моноклональное антитело к pd-l1 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20865705 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3151780 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: NC2022/0003156 Country of ref document: CO |
|
| ENP | Entry into the national phase |
Ref document number: 2022518285 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112022005173 Country of ref document: BR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: DZP2022000195 Country of ref document: DZ |
|
| WWP | Wipo information: published in national office |
Ref document number: NC2022/0003156 Country of ref document: CO |
|
| ENP | Entry into the national phase |
Ref document number: 2020865705 Country of ref document: EP Effective date: 20220419 |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: 112022005173 Country of ref document: BR Free format text: TENDO EM VISTA QUE HA 4 (QUATRO) SERVICOS PRESENTES NA PETICAO NO 870220041443 ? PROCURACAO, LISTAGEM DE SEQUENCIAS, TRADUCAO E DECLARACAO DE DADOS DA PRIORIDADE -, E NECESSARIO RECOLHER 3 GUIAS REFENTES AOS DEMAIS SERVICOS, BEM COMO A RELATIVA A ESTA EXIGENCIA. ALEM DISSO, COM BASE NA PORTARIA 405 DE 21/12/2020, SOLICITA-SE QUE SEJA APRESENTADO, EM ATE 60 (SESSENTA) DIAS, NOVO CONTEUDO DE LISTAGEM DE SEQUENCIA POIS O CONTEUDO APRESENTADO NA PETICAO SUPRACITADA ESTA COM O CAMPO 140 / 141 AUSENTE. RESSALTE-SE QUE PELO ART. 5O, DA PORTARIA 56, DE 27/12/2021, E FACULTADO OPTAR PELA ENTREGA DO CONTEUDO DA LISTAGEM DE SEQUENCIAS NO FORMATO ST.25 ATE 30/06/2022. APOS ESSA DATA, O UNICO FORMATO A |
|
| ENP | Entry into the national phase |
Ref document number: 112022005173 Country of ref document: BR Kind code of ref document: A2 Effective date: 20220318 |
|
| ENP | Entry into the national phase |
Ref document number: 2020351560 Country of ref document: AU Date of ref document: 20200920 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 522431990 Country of ref document: SA |