WO2020205889A1 - Adeno-associated virus with engineered capsid - Google Patents

Adeno-associated virus with engineered capsid Download PDF

Info

Publication number
WO2020205889A1
WO2020205889A1 PCT/US2020/026009 US2020026009W WO2020205889A1 WO 2020205889 A1 WO2020205889 A1 WO 2020205889A1 US 2020026009 W US2020026009 W US 2020026009W WO 2020205889 A1 WO2020205889 A1 WO 2020205889A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
cardiac
capsid protein
raav virion
raav
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2020/026009
Other languages
English (en)
French (fr)
Inventor
Christopher A. Reid
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Tenaya Therapeutics Inc
Original Assignee
Tenaya Therapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to AU2020253435A priority Critical patent/AU2020253435A1/en
Priority to SG11202110607WA priority patent/SG11202110607WA/en
Priority to JP2021558819A priority patent/JP7630176B2/ja
Priority to KR1020217035010A priority patent/KR20210148232A/ko
Priority to CA3135609A priority patent/CA3135609A1/en
Priority to CN202080036330.XA priority patent/CN114450411A/zh
Priority to EP20782986.2A priority patent/EP3947700A4/en
Priority to US17/599,750 priority patent/US20220154217A1/en
Application filed by Tenaya Therapeutics Inc filed Critical Tenaya Therapeutics Inc
Publication of WO2020205889A1 publication Critical patent/WO2020205889A1/en
Priority to IL286831A priority patent/IL286831A/en
Anticipated expiration legal-status Critical
Priority to US18/493,663 priority patent/US12104165B2/en
Priority to US18/808,450 priority patent/US20250051799A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/10Processes for the isolation, preparation or purification of DNA or RNA
    • C12N15/1034Isolating an individual clone by screening libraries
    • C12N15/1055Protein x Protein interaction, e.g. two hybrid selection
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0652Cells of skeletal and connective tissues; Mesenchyme
    • C12N5/0657Cardiomyocytes; Heart cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N7/00Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011Details
    • C12N2750/14011Parvoviridae
    • C12N2750/14111Dependovirus, e.g. adenoassociated viruses
    • C12N2750/14121Viruses as such, e.g. new isolates, mutants or their genomic sequences
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011Details
    • C12N2750/14011Parvoviridae
    • C12N2750/14111Dependovirus, e.g. adenoassociated viruses
    • C12N2750/14122New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011Details
    • C12N2750/14011Parvoviridae
    • C12N2750/14111Dependovirus, e.g. adenoassociated viruses
    • C12N2750/14141Use of virus, viral particle or viral elements as a vector
    • C12N2750/14143Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011Details
    • C12N2750/14011Parvoviridae
    • C12N2750/14111Dependovirus, e.g. adenoassociated viruses
    • C12N2750/14141Use of virus, viral particle or viral elements as a vector
    • C12N2750/14145Special targeting system for viral vectors
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011Details
    • C12N2750/14011Parvoviridae
    • C12N2750/14111Dependovirus, e.g. adenoassociated viruses
    • C12N2750/14171Demonstrated in vivo effect

Definitions

  • the present disclosure relates generally to gene therapy with adeno-associated virus vectors.
  • the disclosure relates to recombinant adeno-associated virus virions having an engineered capsid protein.
  • This application is being filed electronically via EFS-Web and includes an electronically submited sequence listing in .txt format.
  • the .txt file contains a sequence listing entitled“TENA_012_02WO_SeqList_ST25.txt” created on March 31, 2020 and having a size of -2,590 kilobytes.
  • the sequence listing contained in this .txt file is part of the specification and is incorporated herein by reference in its entirety.
  • Adeno-associated virus holds promise for gene therapy and other biomedical applications.
  • AAV can be used to deliver gene products to various tissues and cells, both in vitro and in vivo.
  • the capid proteins of AAV largely determine the immunogenicity and tropism of AAV vectors.
  • AAV subtype 5 (AAV5) is a prefered AAV vector due to the low prevalence of neutralizing antibodies against AAV5 in human populations.
  • AAV5 transduces cardiac tissues less effectivey, however, than other AAV subtypes.
  • selective transduction of different cell types is desirable but difficult to achieve.
  • transduction of cardiac fibroblasts rather than cardiac myocytes, or vice-versa may be desirable.
  • the present disclosure provides variants of the AAV5 capsid that form rAAV virions capable of transducing cardiac tissues and/or cell types for more efficiently and/or with more selectivity than rAAV virions comprising wild-type AAV5 capsid proteins.
  • the disclosure provides a recombinant adeno-associated virus (rAAV) virion, comprising an AAV5 capsid protein, wherein the capsid protein comprises one or more substitutions selected from S651A, S651G, S651V, S651L, S651I, T578A, T578G, T578V, T578L, T578I, T582A, T582G, T582V, T582L, or T582I compared to a parental AAV5 capsid; and a heterologous nucleic acid comprising a nucleotide sequence encoding a gene product.
  • rAAV adeno-associated virus
  • the disclosure provides an AAV5 capsid protein comprising one or more substitutions selected from S651A or S651V; T578A or T578V; or T582A or T582V compared to a parental AAV5 capsid.
  • the disclosure provides recombinant adeno-associated virus (rAAV) virion, comprising an AAV5 capsid protein, wherein the capsid protein comprises an insertion with respect to a parental sequence of 5 to 11 amino acids at an insertion site in the GH loop of the parental sequence; and a heterologous nucleic acid com/prising a nucleotide sequence encoding a gene product.
  • rAAV adeno-associated virus
  • the disclosure provides an AAV5 capsid protein, wherein the capsid protein comprises an insertion with respect to a parental sequence of 5 to 11 amino acids at an insertion site in the GH loop of the parental sequence.
  • the disclosure provides a polynucleotide encoding the AAV5 capsid protein, wherein the capsid protein comprises an insertion with respect to a parental sequence of 5 to 11 amino acids at an insertion site in the GH loop of the parental sequence.
  • the disclosure provides a pharmaceutical composition
  • an rAAV virion comprising an AAV5 capsid protein
  • the capsid protein comprises an insertion with respect to a parental sequence of 5 to 11 amino acids at an insertion site in the GH loop of the parental sequence; and a heterologous nucleic acid comprising a nucleotide sequence encoding a gene product.
  • the disclosure provides method of transducing a cardiac cell, comprising contacting the cardiac cell with an rAAV virion of the disclosure, wherein the rAAV virion transduces the cardiac cell.
  • the disclosure provides a method of delivering one or more gene products to a cardiac cell, comprising contacting the cardiac cell with an rAAV virion of the disclosure, wherein the cardiac cell expresses the gene product.
  • the disclosure provides a method of treating a cardiac pathology in a subject in need thereof, comprising administering a therapeutically effective amount of a pharmaceutical composition comprising an rAAV virion of the disclosure, wherein the rAAV virion transduces cardiac tissue.
  • the disclosure provides a method of identifying AAV capsid proteins that confer on rAAV virions increased transduction efficiency in target cells, comprising providing a population of rAAV virions whose rAAV genomes comprise a library of cap polynucleotides encoding variant AAV capsid proteins; contacting the population with target cells for a time sufficient to permit transduction of the cap polynucleotide into the target cells by the rAAV virions; and sequencing the cap polynucleotides from the target cells, thereby identifying AAV capsid proteins that confer increased transduction efficiency in the target cells.
  • FIG. 1 shows an embodiment of a library screening strategy incorporating an initial negative selection step on induced pluripotent stem cell-derived cardiomyocytes (iPSC-CMs) followed by a positive selection step on human cardiac fibroblasts (hCFs).
  • iPSC-CMs induced pluripotent stem cell-derived cardiomyocytes
  • hCFs human cardiac fibroblasts
  • FIGs. 2A-2B depict generation of an AAV5 random peptide display library and mapping onto the crystal structure of AAV5.
  • FIG. 2A shows a schematic of an AAV genome comprising the rep gene of AAV2 (“Rep2”) and the cap gene of AAV (“Cap5”) flanked by 3’ and 5’ inverted terminal repeats (ITRs).
  • a random 7-mer polypeptide library flanked by alanine residues (AXXXXXXXA; SEQ ID NO: 100) is inserted at position 575 as indicated.
  • FIG. 2B shows the structure of the AAV5 capsid.
  • the approximate insertion site for polypeptide library is indicated by a black arrow.
  • FIGs. 3A-3D visualize library complexcity following each round of screening and report total number of reads and percentage of reads that are unique peptides. Each variant is represented by a different shade of gray based on the hydrophobicity of the peptide sequence, and each pixel in the image represents a single read in the library and is clustered with other reads of the same sequence. Increasing enrichment is evident based on over-abundance of reads (i.e. decrease in the percentage of reads that are unique peptides) compared to the parental library (FIG. 3A) after round 1 (FIG. 3B), after round 2 (FIG. 3C), or after round 3 (FIG. 3D).
  • FIGs. 4A-4D shows transduction efficiency for hCF cells of various rAAV virions identified using the library screening strategy.
  • FIG. 4A shows transduction efficiency of fifteen AAV5 variants benchmarked against unmodified AAV5 (right most bar) packaging a green fluorescent protein (GFP) reporter transgene.
  • hCFs were infected at a genomic multiplicity of infection (MOI) of 100,000 and the percentage of GFP positive cells were quantified using the Cytation 5TM cell imaging multi-mode reader. Representative fluorescent images are shown for hCFs transduced by either unmodified AAV5 (FIG. 4B) or AAV5.CR17 (FIG. 4C).
  • FIG. 4D shows transduction efficiency of unmodified AAV5 versus AAV.CR17 at MOI of 1,000.
  • FIGs.5A-5D shows transduction efficiency for iPS-CM cells of various rAAV virions identified using the library screening strategy.
  • FIG. 5A shows transduction efficiency of fifteen AAV5 variants benchmarked against unmodified AAV5 (right most bar) packaging a GFP reporter transgene.
  • hCFs were infected at a genomic multiplicity of infection (MOI) of 100,000 and the percentage of GFP positive cells were quantified using the Cytation 5TM cell imaging multi-mode reader. Representative fluorescent images are shown for hCFs transduced by either unmodified AAV5 (FIG. 5B) or AAV5.CR23 (FIG. 5C).
  • FIG. 5D shows transduction efficiency of unmodified AAV5 versus AAV.CR23 at MOI of 100,000.
  • FIGs. 6A-6E demonstrate that AAV5.CR17 has improved transduction efficiency in primary mouse cardiac fibroblasts (mCFs). mCFs were infected at a high (100,000) medium (10,000) or low (1,000) MOI with either AAV5.CAG-GFP or AAV5.CR17.CAG-GFP. 72 hours following infection, transduction was assessed using flow cytometry.
  • FIG. 6A shows a histogram and gating of“total GFP” and“high GFP” populations. Increased percent GFP+ (FIG. 6B) and GFP intensity (FIG.
  • FIGs. 7A-7H show the transduction profile of AAV5 and AAV5.CR17 in CD1 mice with and without myocardial infarction (MI).
  • Unmodifed AAV5 exhibited limited transduction of cardiac tissue in control mice (GFP - FIG. 7A; DAPI - FIG. 7B) or induced MI mice (GFP - FIG. 7C; DAPI - FIG. 7D).
  • AAV5.CR17 more effectively transduced cardiac tissue in both control mice (GFP - FIG. 7E; DAPI - FIG. 7F) and induced MI mice (GFP - FIG. 7G; DAPI - FIG. 7H).
  • 1.2xlO n vg of either AAV5.CAG-GFP or AAV5.CR17.CAG-GFP was injected into 6-week old CD1 mice via an intramyocardial injection. GFP intensity and distribution was assessed 7 days following an injection. Increased cardiomyocyte and fibroblast transduction is observed with AAV5.CR17 in both non-MI and MI animals. All heart tissue sections were imaged using a20x objective with equal gain and exposure. Anti-GFP immunostaining is shown in green and nuclei counterstaining with DAPI blue is shown in blue.
  • FIGs. 8A-8E show sequence motifs based on the sequence of the top 100 (FIG. 8A), top 50 (FIG. 8B), top 20 (FIG. 8C) sequences in Table 2 (SEQ ID NOs. 101-600), or the sequences with data reported in Table 1 (FIG. 8D) (SEQ ID NOs. 101-115).
  • FIG. 8E shows a sequence motif for all sequence reads in the library weighted by the number of sequence reads in the library after round 3 (SEQ ID NOs. 101-600).
  • FIG. 9 show AAV5 surface-exposed serine/threonine/lysine/tyrosine mutant vectors demonstrate increased transduction efficiency of hCFs in vitro.
  • hCF cells were infected with either AAV5-wt or AAV5-mutant vectors packaging a ubiquitously expressing GFP reporter.
  • Substitutions S651A, T578A, or T582A in the AAV5 capsid resulted in improved human cardiac fibroblast transduction at an multiplicity of infection of 100,000 vg/cell 72 hours following infection.
  • FIGs. 10A-10C show transduction of human cardiac fibroblasts (hCFs) with either AAVxl vector (top lines) or AAV5 vector (bottom lines).
  • FIG. 10A shows percentage of transduced cells.
  • FIG. 10B shows GFP transgene expression.
  • FIG. 11 shows relative transduction of cardiac fibroblast (CF) cell in vivo.
  • FIG. 12 shows AAVxl vector with MyA expression cassette is efficacious against myocardial infarction by kinetic echocardiography data of % ejection fraction.
  • FIG. 13 shows a graph of the change in percent ejection fraction of treated and untreated pigs with ischemic injury, up to nine weeks post-injection.
  • the present disclosure relates generally to recombinant adeno-associated virus (rAAV) virions for use as viral vectors having capsid proteins with (1) substitutions at selected surface-exposed amino acid residues; (2) insertions in the GH loop; or (3) both.
  • the rAAV virions may transduce cardiac tissues, e.g. cardiac fibroblasts, at least as well or better than rAAV virions having parental capsid proteins without these substitutions and/or insertions.
  • the disclosure provides recombinant adeno-associated virus (rAAV) virions.
  • rAAV adeno-associated virus
  • the disclosure provides new capsid proteins, methods of identifying them, and methods of using them.
  • the methods of identifying new capsid proteins disclosed herein have wide applicability for any serotype of AAV, including hybrid capsid proteins.
  • they can be applied to iteratively improve capsid proteins that have mutations from this or other methods.
  • the methods of the disclosure relate to preparation of randomized or semi- randomized libraries of AAV capsids in the form of cap gene polynucleotides, preparation of AAV virions comprising such capsids (either by incorporating the cap gene library into an AAV genome or providing it in trans such as on a plasmid transfected into the packaging line), positively or negatively selecting the AAV virions, and recovering the cap gene for sequencing.
  • the recovery and sequencing include nanopore sequencing.
  • Other high- throughput or next-generation-sequencing (NGS) methods can be used.
  • the rAAV virions disclosed herein comprise an AAV5 capsid protein, wherein the capsid protein comprises an insertion with respect to a parental sequence of 5 to 11 amino acids at an insertion site in the GH loop of the parental sequence.
  • the rAAV virions generally comprise a heterologous nucleic acid comprising a nucleotide sequence encoding a gene product.
  • Suitable insertion sites for the insertion can be determined by various methods, including but not limited to modeling the GH loop based on the crystal structure of the AAV5 capsid; by selecting flexible residues; or by screening various insertion sites.
  • the insertion may be between two adjacent amino acids residues, or non-adjacent residues may be selected, in which case the insertion causes a deletion of one or more intervening residues.
  • the AAV5 capsid protein comprises subsitutions of residues that are either rationally designed; introduced by mutagenesis; or randomized through generating a library of sequences with random codon usage at one or more sites.
  • Exemplary non-limiting substitutions that inflect transfection efficiency include, but are not limited to S651A, T578A or T582A.
  • the substituted residues may be incorporated into AAV5 capsid proteins that further comprise insertions at one or more insertion sites, e.g. the GH loop or other loops.
  • the capsid proteins of the disclosure include any insertion identified as enriched by directed evolution followed by sequence, as shown in, but not limited to, the Examples. Without being limited to any particular insertion site, in some embodiments, the insertion is between about residues 574 and 575 in the AAV5 capsid protein (SEQ ID NO: 1). In some embodiments, the insertion site is between any two, optionally adjacent, amino acids at positions in the parental sequence corresponding to 560 to 594 of SEQ ID NO: 1. In some embodiments, the insertion site is between adjacent amino acids in the parental sequence corresponding to 574 and 575 of SEQ ID NO: 1. The N-terminal residue of VP1, VP2, and VP3 are indicated above the sequence of full-length VP1.
  • an insertion at this insertion site divides the VP3 capsid protein into an N-terminal segment (SEQ ID NO: 2) and a C-terminal segment (SEQ ID NO: 3), disclosed as distinct sequences herein for clarity, which may joined by any of the insertions of the disclosure.
  • the capsid protein comprises a sequence at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1 (for clarity, with a gap in the alignment at the insertion site).
  • the capsid protein comprises a sequence that shares at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identity to SEQ ID NO: 2 and that shares at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identity to SEQ ID NO: 3, where SEQ ID NO: 2 and SEQ ID NO: 3 are linked by an insertion of 5 to 11 amino acids.
  • the insertion is selected from SEQ ID NOs: 101-600.
  • the flanking alanine (A) residues of SEQ ID NOs: 101-600 are substituted with other residues, such as flexible residues serine (S) or glycine (G), the flanking A residues are absent.
  • the capsid protein comprising a sequence at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 4, where X represents any amino acid. In some embodiments, the capsid protein comprising a sequence at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 5, where X represents any amino acid.
  • the insertion is a peptide of formula:
  • n is 5-9, and wherein X 0 and X10 are each independently A, S, G, or absent (SEQ ID NO: 1101).
  • the insertion is a peptide of formula:
  • X 0 and X8 are each independently A, S, G, or absent (SEQ ID NO: 1102).
  • the insertion is a peptide of formula:
  • X1 is P, R, or G
  • X2 is K, L, or R
  • X3 is any amino acid
  • X4 is N, H, K, or Q
  • X5 is any amino acid, or optionally X5 is G, K, or S
  • Xo is any amino acid, or optionally Xo is T or V
  • X7 is any amino acid, or optionally X7 is K or V (SEQ ID NO: 1103).
  • the insertion is a peptide of formula:
  • X1 is P, R, or G
  • X2 is K, L, or R
  • X3 is any amino acid
  • X4 is N, H, K, or Q
  • X5 is any amino acid, or optionally X5 is G, K, or S
  • Xo is any amino acid
  • X7 is any amino acid (SEQ ID NO: 1104).
  • the insertion is a peptide of formula:
  • X1 is P, R, or G
  • X2 is K, L, or R
  • X3 is any amino acid
  • X4 is N, H, K, or Q
  • Xs is any amino acid, or optionally
  • X5 is G, K, or S
  • X6 is T or V
  • X7 is any amino acid (SEQ ID NO: 1105).
  • the insertion is a peptide of formula:
  • X1 is P, R, or G
  • X2 is K, L, or R
  • X3 is any amino acid
  • X4 is N, H, K, or Q
  • X5 is any amino acid, or optionally X5 is G, K, or S
  • X6 is T or V
  • X7 is K or V (SEQ ID NO: 1106).
  • X1 through X7 are any amino acid, wherein the insertion is defined by one or more of the following criteria: X1 is P, R, or G; X2 is K, L, or R; X3 is any amino acid; X4 is N, H, K, or Q; X5 is X5 is G, K, or S; X6 is T or V; and/or X7 is X7 is K or V (SEQ ID NO: 1107).
  • the insertion is selected from SEQ ID NOs: 101-600.
  • the capsid protein comprises, in N-terminal to C-terminal order, one polypeptide having sequence at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 2 and at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 3; one polypeptide selected from SEQ ID NOs 101-600; and one polypeptide having sequence at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 2 and at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 2.
  • the capsid protein comprises, in N-terminal to C-terminal order, one polypeptide having sequence at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 2 and at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 3; one polypeptide selected from SEQ ID NOs: 101-200; and one polypeptide having sequence at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 2 and at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 2.
  • the capsid protein comprises, in N-terminal to C-terminal order, one polypeptide having sequence at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 2 and at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 3; one polypeptide selected from SEQ ID NOs: 101-150; and one polypeptide having sequence at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 2 and at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 2.
  • the capsid protein comprises, in N-terminal to C-terminal order, one polypeptide having sequence at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 2 and at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 3; one polypeptide selected from SEQ ID NOs: 101-120; and one polypeptide having sequence at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 2 and at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 2.
  • the capsid protein comprises, in N-terminal to C-terminal order, one polypeptide having sequence at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 2 and at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 3; one polypeptide selected from SEQ ID NOs: 101-115; and one polypeptide having sequence at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 2 and at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 2.
  • the capsid protein comprises, in N-terminal to C-terminal order, one polypeptide having sequence at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 2 and at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 3; one polypeptide selected from SEQ ID NOs: 103 or 110; and one polypeptide having sequence at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 2 and at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 2.
  • the capsid protein comprises, consists essentially of, or consists of a polypeptide having sequence at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to one of SEQ ID NOs 601-1100, or a functional fragment thereof.
  • the capsid protein comprises, consists essentially of, or consists of a polypeptide having sequence at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to one of SEQ ID NOs 601-615, or a functional fragment thereof.
  • the insertion comprises an amino acid sequence selected from RKVHIEV (SEQ ID NO: 81), RKYQSDL (SEQ ID NO: 82), PLTNTVK (SEQ ID NO: 83), LKYHGPP (SEQ ID NO: 84), RKYQGDM (SEQ ID NO: 85), RKFHSTD (SEQ ID NO: 86), RKHHGLE (SEQ ID NO: 87), PGTNVTK (SEQ ID NO: 88), RKMHMPD (SEQ ID NO: 89), PLKKIVQ (SEQ ID NO: 90), PLGKKTS (SEQ ID NO: 91), PRGVKVT (SEQ ID NO: 92), PLAKSKS (SEQ ID NO: 93), PRTKGAV (SEQ ID NO: 94), and PSGRKAT (SEQ ID NO: 95).
  • RKVHIEV SEQ ID NO: 81
  • RKYQSDL SEQ ID NO: 82
  • PLTNTVK SEQ ID NO:
  • the insertion comprises an amino acid sequence selected from ARKVHIEVA (SEQ ID NO: 101), ARKYQSDLA (SEQ ID NO: 102), APLTNTVKA (SEQ ID NO: 103), ALKYHGPPA (SEQ ID NO: 104), ARKYQGDMA (SEQ ID NO: 105), ARKFHSTDA (SEQ ID NO: 106), ARKHHGLEA (SEQ ID NO: 107), APGTNVTKA (SEQ ID NO: 108), ARKMHMPDA (SEQ ID NO: 109), APLKKIVQA (SEQ ID NO: 110), APLGKKTSA (SEQ ID NO: 111), APRGVKVTA (SEQ ID NO: 112), APLAKSKSA (SEQ ID NO: 113), APRTKGAVA (SEQ ID NO: 114), APSGRKATA (SEQ ID NO: 115).
  • ARKVHIEVA SEQ ID NO: 101
  • ARKYQSDLA SEQ ID NO:
  • the insertion comprises any one of SEQ ID NOs: 101-600. In some embodiments, a sequence comprising at most 1, 2, 3, or 4 amino-acid substitutions relative to any one of SEQ ID NOs: 101-600.
  • the insertion comprises the amino acid sequence PLTNTVK (SEQ ID NO: 83) ⁇ clone CR17 ⁇ or a sequence comprising at most 1, 2, 3, or 4 amino-acid substitutions relative to PLTNTVK (SEQ ID NO: 83).
  • the insertion comprises the amino acid sequence PLKKIVQ (SEQ ID NO: 90) ⁇ clone CR23 ⁇ or a sequence comprising at most 1, 2, 3, or 4 amino-acid substitutions relative to PLKKIVQ (SEQ ID NO: 90).
  • the insertion comprises the amino acid sequence APLTNTVKA (SEQ ID NO: 103) ⁇ clone CR17 ⁇ or a sequence comprising at most 1, 2, 3, or 4 amino-acid substitutions relative to APLTNTVKA (SEQ ID NO: 103).
  • the insertion comprises the amino acid sequence APLKKIVQA (SEQ ID NO: 110) ⁇ clone CR23 ⁇ , wherein the insertion further comprises 1, 2, 3, or 4 conservative amino-acid substitutions.
  • the insertion comprises the amino acid sequence PLTNTVK (SEQ ID NO: 83) ⁇ clone CR17 ⁇ , wherein the insertion further comprises 1, 2, 3, or 4 conservative amino-acid substitutions.
  • the insertion comprises the amino acid sequence PLKKIVQ (SEQ ID NO: 90) ⁇ clone CR23 ⁇ , wherein the insertion further comprises 1, 2, 3, or 4 conservative amino-acid substitutions.
  • the insertion comprises the amino acid sequence APLTNTVKA (SEQ ID NO: 103) ⁇ clone CR17 ⁇ , wherein the insertion further comprises 1, 2, 3, or 4 conservative amino-acid substitutions.
  • the insertion comprises the amino acid sequence at least APLKKIVQA (SEQ ID NO: 110) ⁇ clone CR23 ⁇ , wherein the insertion further comprises 1, 2, 3, or 4 conservative amino-acid substitutions.
  • Conservative substutions include polar for polar resiudes, non-polar for non-polar residues, hydrophobic for hydrophobic resides, small for small residues, and large for large residues.
  • Conservative substitutions further comprise substitutions within the following groups:
  • Transduction efficienty can be determined using methods known in the art or those described in the Examples.
  • the rAAV virion exhibits increased transduction efficiency in cardiac cells compared to an AAV virion comprising the parental sequence.
  • the rAAV virion exhibits increased transduction efficiency in human cardiac fibroblast (hCF) cells compared to an AAV virion comprising the parental sequence.
  • the rAAV virion exhibits at least 2-, 3-, 4-, 5-, 6, 7-, 8-, 9-, 10, 11-, 12-, 13-, 14, or 15-fold increased transduction efficiency in hCF cells at a multiplicity of infection (MOI) of 100,000.
  • MOI multiplicity of infection
  • the rAAV virion exhibits about 2- to about 16-fold, about 2- to about 14-fold, about 2- to about 12-fold, about 2- to about 10-fold, about 2- to about 8-fold, about 2- to about 6-fold, about 2- to about 4-fold, or about 2- to about 3 -fold increased transduction efficiency in hCF cells at a multiplicity of infection (MOI) of 100,000.
  • the rAAV virion exhibits at least 2-, 3-, 4-, 5-, 6, 7-, 8-, 9-, 10, 11-, 12-, 13-, 14, or 15-fold increased transduction efficiency in hCF cells at a multiplicity of infection (MOI) of 100,000.
  • MOI multiplicity of infection
  • the rAAV virion exhibits about 20% to 30%, about 30% to 40%, about 40% to 50%, about 50% to 80%, about 80% to 100%, about 100% to 125%, about 125% to 150%, about 150% to 175%, or about 175% to 200% increased transduction efficiency in hCF cells at a multiplicity of infection (MOI) of 100,000.
  • the rAAV virion exhibits at least 2-, 3-, 4-, 5-, 6, 7-, 8-, 9-, 10, 11-, 12-, 13-, 14, or 15-fold increased transduction efficiency in hCF cells at a multiplicity of infection (MOI) of 1,000.
  • MOI multiplicity of infection
  • the rAAV virion exhibits about 2- to about 16-fold, about 2- to about 14-fold, about 2- to about 12-fold, about 2- to about 10-fold, about 2- to about 8-fold, about 2- to about 6-fold, about 2- to about 4-fold, or about 2- to about 3-fold increased transduction efficiency in hCF cells at a multiplicity of infection (MOI) of 1,000.
  • the rAAV virion exhibits about 20% to 30%, about 30% to 40%, about 40% to 50%, about 50% to 80%, about 80% to 100%, about 100% to 125%, about 125% to 150%, about 150% to 175%, or about 175% to 200% increased transduction efficiency in hCF cells at a multiplicity of infection (MOI) of 1,000.
  • MOI multiplicity of infection
  • the rAAV virion exhibits increased transduction efficiency in induced pluripotent stem cell-derived cardiomyocyte (iPS-CM) cells compared to an AAV virion comprising the parental sequence.
  • iPS-CM induced pluripotent stem cell-derived cardiomyocyte
  • the rAAV virion exhibits at least 2-, 3-, 4-, 5-, 6, 7-, 8-, 9-, 10, 11-, 12-, 13-, 14, or 15-fold increased transduction efficiency in iPS-CM cells at a multiplicity of infection (MOI) of 100,000.
  • MOI multiplicity of infection
  • the rAAV virion exhibits about 2- to about 16-fold, about 2- to about 14-fold, about 2- to about 12-fold, about 2- to about 10-fold, about 2- to about 8-fold, about 2- to about 6-fold, about 2- to about 4-fold, or about 2- to about 3-fold increased transduction efficiency in iPS-CM cells at a multiplicity of infection (MOI) of 100,000.
  • the rAAV virion exhibits about 20% to 30%, about 30% to 40%, about 40% to 50%, about 50% to 80%, about 80% to 100%, about 100% to 125%, about 125% to 150%, about 150% to 175%, or about 175% to 200% increased transduction efficiency in iPS-CM cells at a multiplicity of infection (MOI) of 100,000.
  • MOI multiplicity of infection
  • the rAAV virion exhibits at least 2-, 3-, 4-, 5-, 6, 7-, 8-, 9-, 10, 11-, 12-, 13-, 14, or 15-fold increased transduction efficiency in iPS-CM cells at a multiplicity of infection (MOI) of 1,000.
  • MOI multiplicity of infection
  • the rAAV virion exhibits about 2- to about 16-fold, about 2- to about 14-fold, about 2- to about 12-fold, about 2- to about 10-fold, about 2- to about 8-fold, about 2- to about 6-fold, about 2- to about 4-fold, or about 2- to about 3-fold increased transduction efficiency in iPS-CM cells at a multiplicity of infection (MOI) of 1,000.
  • the rAAV virion exhibits about 20% to 30%, about 30% to 40%, about 40% to 50%, about 50% to 80%, about 80% to 100%, about 100% to 125%, about 125% to 150%, about 150% to 175%, or about 175% to 200% increased transduction efficiency in iPS- CM cells at a multiplicity of infection (MOI) of 1,000.
  • MOI multiplicity of infection
  • Selectivity for a cell type is increased when the ratio of the transduction efficiencies for one cell type over another is increased by the capsid protein compared to a parental sequence.
  • the rAAV virion exhibits increased selectivity of the rAAV virion for hCF cells over iPS-CM cells.
  • the rAAV virion exhibits increased selectivity of the rAAV virion for iPS-CM cells over hCF cells.
  • the capsid protein comprises a mutation selected from S651A, T578A, T582A, K251R, Y709F, Y693F, or S485A. In some embodiments, the capsid protein comprises a mutation selected from K251R, Y709F, Y693F, or S485A.
  • the polynucleotide encoding the capsid protein can comprise a sequence comprising either the native codons of the wild-type cap gene, or alternative codons selected to encode the same protein. The codon usage of the insertion can be varied.
  • Representative nucleotide sequences for cap genes encoding capsid proteins of the disclosure are provided as SEQ ID NOs 51-72.
  • the disclosure provides a polynucleotide encoding an AAV5 capsid protein comprising a sequence at least 95%, 99%, or 100% identical to one of SEQ ID NOs 51-72.
  • the disclosure provides a polynucleotide encoding an AAV5 capsid protein comprising a sequence at least 95%, 99%, or 100% identical to SEQ ID NO: 51 ⁇ CR2 polynucleotide sequence ⁇ , wherein the AAV5 capsid protein comprises SEQ ID NO: 101 or a sequence comprising at most 1, 2, 3, or 4 amino-acid substitutions relative to ARKVHIEVA (SEQ ID NO: 101).
  • the disclosure provides a polynucleotide encoding an AAV5 capsid protein comprising a sequence at least 95%, 99%, or 100% identical to SEQ ID NO: 52 ⁇ CR5 polynucleotide sequence ⁇ , wherein the AAV5 capsid protein comprises SEQ ID NO: 102 or a sequence comprising at most 1, 2, 3, or 4 amino-acid substitutions relative to ARKYQSDLA (SEQ ID NO: 102).
  • the disclosure provides a polynucleotide encoding an AAV5 capsid protein comprising a sequence at least 95%, 99%, or 100% identical to SEQ ID NO: 53 ⁇ CR8 polynucleotide sequence ⁇ , wherein the AAV5 capsid protein comprises SEQ ID NO: 107 or a sequence comprising at most 1, 2, 3, or 4 amino-acid substitutions relative to ARKHHGLEA (SEQ ID NO: 107).
  • the disclosure provides a polynucleotide encoding an AAV5 capsid protein comprising a sequence at least 95%, 99%, or 100% identical to SEQ ID NO: 54 ⁇ CR17 polynucleotide sequence ⁇ , wherein the AAV5 capsid protein comprises SEQ ID NO:
  • the disclosure provides a polynucleotide encoding an AAV5 capsid protein comprising a sequence at least 95%, 99%, or 100% identical to SEQ ID NO: 55 ⁇ CR18 polynucleotide sequence ⁇ , wherein the AAV5 capsid protein comprises SEQ ID NO:
  • the disclosure provides a polynucleotide encoding an AAV5 capsid protein comprising a sequence at least 95%, 99%, or 100% identical to SEQ ID NO: 56 ⁇ CR19 polynucleotide sequence ⁇ , wherein the AAV5 capsid protein comprises SEQ ID NO:
  • 105 or a sequence comprising at most 1, 2, 3, or 4 amino-acid substitutions relative to ARKYQGDMA (SEQ ID NO: 105).
  • the disclosure provides a polynucleotide encoding an AAV5 capsid protein comprising a sequence at least 95%, 99%, or 100% identical to SEQ ID NO: 57 ⁇ CR20 polynucleotide sequence ⁇ , wherein the AAV5 capsid protein comprises SEQ ID NO:
  • 106 or a sequence comprising at most 1, 2, 3, or 4 amino-acid substitutions relative to ARKFHSTDA (SEQ ID NO: 106).
  • the disclosure provides a polynucleotide encoding an AAV5 capsid protein comprising a sequence at least 95%, 99%, or 100% identical to SEQ ID NO: 58 ⁇ CR21 polynucleotide sequence ⁇ , wherein the AAV5 capsid protein comprises SEQ ID NO: 108 or a sequence comprising at most 1, 2, 3, or 4 amino-acid substitutions relative to APGTNVTKA (SEQ ID NO: 108).
  • the disclosure provides a polynucleotide encoding an AAV5 capsid protein comprising a sequence at least 95%, 99%, or 100% identical to SEQ ID NO: 59 ⁇ CR22 polynucleotide sequence ⁇ , wherein the AAV5 capsid protein comprises SEQ ID NO:
  • the disclosure provides a polynucleotide encoding an AAV5 capsid protein comprising a sequence at least 95%, 99%, or 100% identical to SEQ ID NO: 60 ⁇ CR23 polynucleotide sequence ⁇ , wherein the AAV5 capsid protein comprises SEQ ID NO:
  • the disclosure provides a polynucleotide encoding an AAV5 capsid protein comprising a sequence at least 95%, 99%, or 100% identical to SEQ ID NO: 61 ⁇ CR24 polynucleotide sequence ⁇ , wherein the AAV5 capsid protein comprises SEQ ID NO:
  • the disclosure provides a polynucleotide encoding an AAV5 capsid protein comprising a sequence at least 95%, 99%, or 100% identical to SEQ ID NO: 62 ⁇ CR25 polynucleotide sequence ⁇ , wherein the AAV5 capsid protein comprises SEQ ID NO:
  • the disclosure provides a polynucleotide encoding an AAV5 capsid protein comprising a sequence at least 95%, 99%, or 100% identical to SEQ ID NO: 63 ⁇ CR26 polynucleotide sequence ⁇ , wherein the AAV5 capsid protein comprises SEQ ID NO:
  • APLAKSKSA SEQ ID NO: 113 or a sequence comprising at most 1, 2, 3, or 4 amino-acid substitutions relative to APLAKSKSA (SEQ ID NO: 113).
  • the disclosure provides a polynucleotide encoding an AAV5 capsid protein comprising a sequence at least 95%, 99%, or 100% identical to SEQ ID NO: 64 ⁇ CR27 polynucleotide sequence ⁇ , wherein the AAV5 capsid protein comprises SEQ ID NO:
  • the disclosure provides a polynucleotide encoding an AAV5 capsid protein comprising a sequence at least 95%, 99%, or 100% identical to SEQ ID NO: 65 ⁇ CR28 polynucleotide sequence ⁇ , wherein the AAV5 capsid protein comprises SEQ ID NO: 115 or a sequence comprising at most 1, 2, 3, or 4 amino-acid substitutions relative to APSGRKATA (SEQ ID NO: 115).
  • the disclosure provides a polynucleotide encoding an AAV5 capsid protein comprising a sequence at least 95%, 99%, or 100% identical to SEQ ID NO: 66, wherein the AAV5 capsid protein comprises the substitution K251R with respect to SEQ ID NO: 1.
  • the disclosure provides a polynucleotide encoding an AAV5 capsid protein comprising a sequence at least 95%, 99%, or 100% identical to SEQ ID NO: 67, wherein the AAV5 capsid protein comprises the substitution S485A with respect to SEQ ID NO: 1.
  • the disclosure provides a polynucleotide encoding an AAV5 capsid protein comprising a sequence at least 95%, 99%, or 100% identical to SEQ ID NO: 68, wherein the AAV5 capsid protein comprises the substitution S651A with respect to SEQ ID NO: 1.
  • the disclosure provides a polynucleotide encoding an AAV5 capsid protein comprising a sequence at least 95%, 99%, or 100% identical to SEQ ID NO: 69, wherein the AAV5 capsid protein comprises the substitution T578A with respect to SEQ ID NO: 1.
  • the disclosure provides a polynucleotide encoding an AAV5 capsid protein comprising a sequence at least 95%, 99%, or 100% identical to SEQ ID NO: 70, wherein the AAV5 capsid protein comprises the substitution T582A with respect to SEQ ID NO: 1.
  • the disclosure provides a polynucleotide encoding an AAV5 capsid protein comprising a sequence at least 95%, 99%, or 100% identical to SEQ ID NO: 71, wherein the AAV5 capsid protein comprises the substitution Y709F with respect to SEQ ID NO: 1.
  • the disclosure provides a polynucleotide encoding an AAV5 capsid protein comprising a sequence at least 95%, 99%, or 100% identical to SEQ ID NO: 72, wherein the AAV5 capsid protein comprises the substitution Y693F with respect to SEQ ID NO: 1.
  • the disclosure provides an AAV5 capsid protein comprising a sequence at least 95%, 99%, or 100% identical to a modified capsid selected from SEQ ID NOs: 9-34, wherein the substitutions in the modified capsid from the reference capsid SEQ ID NO: 1 are present, and wherein other substitutions, optionally conservative substitutions, with the specified percent identity level are tolerated.
  • the insertion site is between any two, optionally adjacent, amino acids at positions in the parental sequence corresponding to 420 to 460 of SEQ ID NO: 1. In some embodiments, the insertion site is between adjacent amino acids in the parental sequence corresponding to 444 and 445 of SEQ ID NO: 1.
  • An exemplary embodiment is the AAV5 capsid disclosue as SEQ ID NO: 31.
  • the recombinant adeno-associated virus (rAAV) virion disclosed herein comprise an AAV5 capsid protein, wherein the capsid protein comprises one or more substitutions selected from S651G, S651V, S651L, S651I, T578A, T578G, T578V, T578L, T578I, T582A, T582G, T582V, T582L, or T582I compared to a parental AAV5 capsid; and a heterologous nucleic acid comprising a nucleotide sequence encoding a gene product.
  • the recombinant adeno-associated virus (rAAV) virion disclosed herein comprise an AAV5 capsid protein, wherein the capsid protein comprises one or more substitutions selected from S651A, T578A, or T582A compared to a parental AAV5 capsid; and a heterologous nucleic acid comprising a nucleotide sequence encoding a gene product.
  • the AAV5 capsid protein may comprise any two substitutions selected from S651A or S651V; T578A or T578V; or T582A or T582V - or all three of S651A or S651V; T578A or T578V; or T582A or T582V.
  • the following combinations of mutations are expressly contemplated by the present disclosure:
  • the AAV5 capsid protein may comprise any two substitutions selected from S651A, T578A, or T582A; or all three S651A, T578A, or T582A.
  • the AAV5 capsid protein may be any one of SEQ ID NOs 74-80, or a sequence at least 90%, 92%, 95%, 96%, 97%, 98%, 99%, or 100% identical thereto.
  • T578A, T582A, and/or S651A are examples of T578A, T582A, and/or S651A
  • NSKRWNPEIQYTNNYNDPQFVDFAPDSTGEYRTTRPIGTRYLTRPL, where X A, G, V,
  • SKRWNPEIQYTNNYNDPQFVDFAPDSTGEYRTTRPIGTRYLTRPL (SEQ ID NO: 78) T582A andS651A
  • NSKRWNPEIQYTNNYNDPQFVDFAPDSTGEYRTTRPIGTRYLTRPL SEQ ID NO: 80
  • the alanine substitution may instead be a substitutions to a valine (V), glycine (G), leucine (L), or isoleucine (I).
  • one or more amino acid residues are conserved to the residue present in wild-type AAV5 capsid.
  • T581 is conserved as a tyrosine (T), or semi-conserved as serine (S).
  • S serine
  • U.S. Pat. No. 10,046,016 teaches that infectivity of lung epithelial cells is increased by mutation by a T581A mutation.
  • conjunction“and/or” means both“and” and“or,” and lists joined by“and/or” encompasses all possible combinations of one or more of the listed items.
  • vector refers to a macromolecule or complex of molecules comprising a polynucleotide or protein to be delivered to a cell.
  • AAV is an abbreviation for adeno-associated virus. The term covers all subtypes of AAV, except where a subtype is indicated, and to both naturally occurring and recombinant forms.
  • the abbreviation “rAAV” refers to recombinant adeno-associated virus.
  • AAV includes AAV or any subtype.
  • AAV5 refers to AAV subtype 5.
  • the genomic sequences of various serotypes of AAV, as well as the sequences of the native inverted terminal repeats (ITRs), Rep proteins, and capsid subunits may be found in the literature or in public databases such as GenBank.
  • Publications describing AAV include Srivistava et al. (1983) J. Virol. 45:555; Chiorini et al. (1998) J. Virol. 71:6823; Chiorini et al. (1999) J. Virol.
  • rAAV vector refers to a nucleic acid (typically a plasmid) comprising a polynucleotide sequence capable of being packaged into an rAAV virion, but with the capsid or other proteins of the rAAV virion.
  • an rAAV vector comprises a heterologous polynucleotide sequence (i.e., a polynucleotide not of AAV origin) and one or two AAV inverted terminal repeat sequences (ITRs) flanking the heterologous polynucleotide sequence. Only one of the two ITRs may be packaged into the rAAV and yet infectivity of the resulting rAAV virion may be maintained. See Wu et al. (2010) Mol Ther. 18:80.
  • An rAAV vector may be designed to generate either single-stranded (ssAAV) or self complementary (scAAV). See McCarty D. (2008) Mo. Ther. 16: 1648-1656; W02001/11034; W02001/92551; W02010/129021.
  • An“rAAV virion” refers to an extracellular viral particle including at least one viral capsid protein (e.g. VP1) and an encapsidated rAAV vector (or fragment thereol), including the capsid proteins.
  • viral capsid protein e.g. VP1
  • encapsidated rAAV vector or fragment thereol
  • capsid protein or“capsid proteins.”
  • engineering of the sequence that encodes VP3 inevitably alters the sequences of the C-terminal domain of VP1 and VP2.
  • ITRs inverted terminal repeats
  • AAV viral cis- elements named so because of their symmetry. These elements are essential for efficient multiplication of an AAV genome. Without being bound by theory, it is believed that the minimal elements indispensable for ITR function are a Rep-binding site and a terminal resolution site plus a variable palindromic sequence allowing for hairpin formation.
  • the disclosure contemplates that alternative means of generating an AAV genome may exist or may be prospectively developed to be compatible with the capsid proteins of the disclosure.
  • Helper virus functions refers to functions encoded in a helper virus genome which allow AAV replication and packaging.
  • Packaging refers to a series of intracellular events that result in the assembly of an rAAV virion including encapsidation of the rAAV vector.
  • AAV“rep” and“cap” genes refer to polynucleotide sequences encoding replication and encapsidation proteins of adeno-associated virus.
  • AAV rep and cap are referred to herein as AAV“packaging genes.”
  • Packaging requires either a helper virus itself or, more commonly in recombinant systems, helper virus function supplied by a helper-free system (i.e. one or more helper plasmids).
  • A“helper virus” for AAV refers to a virus that allows AAV (e.g . wild-type AAV) to be replicated and packaged by a mammalian cell.
  • the helper viruses may be an adenovirus, herpesvirus or poxvirus, such as vaccinia.
  • An“infectious” virion or viral particle is one that comprises a competently assembled viral capsid and is capable of delivering a polynucleotide component into a cell for which the virion is tropic.
  • the term does not necessarily imply any replication capacity of the virus.
  • Infectivity refers to a measurement of the ability of a virion to inflect a cell. Infectivity can be expressed as the ratio of infectious viral particles to total viral particles. Infectivity is general determined with respect to a particular cell type. It can be measured both in vivo or in vitro. Methods of determining the ratio of infectious viral particle to total viral particle are known in the art. See, e.g., Grainger et al. (2005) Mol. Ther. 1 TS337 (describing a TCID50 infectious titer assay); and Zolotukhin et al. (1999) Gene Ther. 6:973.
  • parental capsid or“parental sequence” refer to a reference sequence from which a particle capsid or sequence is derived. Unless otherwise specified, parental sequence refers to the sequence of the wild-type capsid protein of the same serotype as the engineered capsid protein.
  • A“replication-competent” virus e.g . a replication-competent AAV refers to a virus that is infectious, and is also capable of being replicated in an infected cell (i.e. in the presence of a helper virus or helper virus functions).
  • the rAAV virion of the disclosure comprises a genome that lacks the rep gene, or both the rep and cap genes, and therefore is replication incompetent.
  • nucleic acid and“polynucleotide” are used interchangeably and refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof.
  • Non-limiting examples of polynucleotides include linear and circular nucleic acids, messenger RNA (mRNA), cDNA, recombinant polynucleotides, vectors, probes, and primers.
  • mRNA messenger RNA
  • cDNA recombinant polynucleotides
  • vectors e.g., RNA sequence complementary DNA
  • polypeptide and“protein,” are used interchangeably herein and refer to a polymeric form of amino acids of any length, which can include genetically coded and non- genetically coded amino acids, chemically or biochemically modified or derivatized amino acids, and polypeptides having modified peptide backbones.
  • the terms also encompass an amino acid polymer that has been modified; for example, disulfide bond formation, glycosylation, lipidation, phosphorylation, or conjugation with a labeling component.
  • peptide refers to a short polypeptide, e.g. a peptide having between about 4 and 30 amino acid residues.
  • isolated means separated from constituents, cellular and otherwise, in which the virion, cell, tissue, polynucleotide, peptide, polypeptide, or protein is normally associated in nature.
  • an isolated cell is a cell that is separated form tissue or cells of dissimilar phenotype or genotype.
  • sequence identity refers to the percentage of number of amino acids that are identical between a sequence of interest and a reference sequence. Generally identity is determined by aligning the the sequence of interest to the reference sequence, determining the number of amino acids that are identical between the aligned sequences, dividing that number by the total number of amino acids in the reference sequence, and multiplying the result by 100 to yield a percentage. Sequences can be aligned using various computer programs, such BLAST, available at ncbi.nlm.nih.gov. Other techniques for alignment are described in Methods in Enzymology, vol. 266: Computer Methods for Macromolecular Sequence Analysis (1996); mdMeth. Mol.
  • Recombinant as applied to a polynucleotide means that the polynucleotide is the product of various combinations of cloning, restriction or ligation steps, and other procedures that result in a construct that is distinct from a polynucleotide found in nature, or that the polynucleotide is assembled from synthetic oligonucleotides.
  • A“recombinant” protein is a protein produced from a recombinant polypeptide.
  • a recombinant virion is a virion that comprises a recombinant polynucleotide and/or a recombinant protein, e.g. a recombinant capsid protein.
  • A“gene” refers to a polynucleotide containing at least one open reading frame that is capable of encoding a particular protein after being transcribed and translated.
  • A“gene product” is a molecule resulting from expression of a particular gene. Gene products may include, without limitation, a polypeptide, a protein, an aptamer, an interfering RNA, or an mRNA.
  • Gene-editing systems e.g. a CRISPR/Cas system
  • A“short hairpin RNA,” or shRNA is a polynucleotide construct used to express an siRNA.
  • A“control element” or“control sequence” is a nucleotide sequence involved in an interaction of molecules that contributes to the functional regulation of a polynucleotide, including replication, duplication, transcription, splicing, translation, or degradation of the polynucleotide. The regulation may affect the frequency, speed, or specificity of the process, and may be enhancing or inhibitory in nature. Control elements include transcriptional regulatory sequences such as promoters and/or enhancers.
  • A“promoter” is a DNA sequence capable under certain conditions of binding RNA polymerase and initiating transcription of a coding region usually located downstream (in the 3’ direction) from the promoter.
  • tissue-specific promoter refers to a promoter that is operable in cells of a particular organ or tissue, such as the cardiac tissue.
  • “Operatively linked” or “operably linked” refers to a juxtaposition of genetic elements, wherein the elements are in a relationship permitting them to operate in the expected manner. For instance, a promoter is operatively linked to a coding region if the promoter helps initiate transcription of the coding sequence. There may be intervening residues between the promoter and coding region so long as this functional relationship is maintained.
  • An“expression vector” is a vector comprising a coding sequence which encodes a gene product of interest used to effect the expression of the gene product in target cells.
  • An expression vector comprises control elements operatively linked to the coding sequence to facilitate expression of the gene product.
  • expression cassette refers to a heterologous polynucleotide comprising a coding sequence which encodes a gene product of interest used to effect the expression of the gene product in target cells.
  • expression cassette of an AAV vector include the polynucleotides between (and not including) the ITRs.
  • gene delivery or“gene transfer” as used herein refers to methods or systems for reliably inserting foreign nucleic acid sequences, e.g., DNA, into host cells. Such methods can result in transient expression of non-integrated transferred DNA, extra- chromosomal replication and expression of transferred replicons (e.g., episomes), or integration of transferred genetic material into the genomic DNA of host cells.
  • transferred replicons e.g., episomes
  • Heterologous means derived from a genotypically distinct entity from that of the rest of the entity to which it is being compared.
  • a polynucleotide introduced by genetic engineering techniques into a plasmid or vector derived from a different species is a heterologous polynucleotide.
  • a promoter removed from its native coding sequence and operatively linked to a coding sequence with which it is not naturally found linked is a heterologous promoter.
  • an rAAV that includes a heterologous nucleic acid is an rAAV that includes a nucleic acid not normally included in a naturally-occurring AAV.
  • genetic alteration and“genetic modification” (and grammatical variants thereof), are used interchangeably herein to refer to a process wherein a genetic element (e.g., a polynucleotide) is introduced into a cell other than by mitosis or meiosis.
  • a genetic element e.g., a polynucleotide
  • the element may be heterologous to the cell, or it may be an additional copy or improved version of an element already present in the cell.
  • Genetic alteration may be effected, for example, by transfecting a cell with a recombinant plasmid or other polynucleotide through any process known in the art, such as electroporation, calcium phosphate precipitation, or contacting with a polynucleotide- liposome complex. Genetic alteration may also be effected, for example, by transduction or infection with a vector.
  • a cell is said to be“stably” altered, transduced, genetically modified, or transformed with a polynucleotide sequence if the sequence is available to perform its function during extended culture of the cell in vitro.
  • a cell is“heritably” altered (genetically modified) in that a genetic alteration is introduced which is also inheritable by progeny of the altered cell.
  • transfection refers to the uptake of an exogenous nucleic acid molecule by a cell.
  • a cell has been“transfected” when exogenous nucleic acid has been introduced inside the cell membrane.
  • transfection techniques are generally known in the art. See, e.g., Graham et al. (1973) Virology, 52:456, Sambrook et al. (1989) Molecular Cloning, a laboratory manual, Cold Spring Harbor Laboratories, New York, Davis et al. (1986) Basic Methods in Molecular Biology, Elsevier, and Chu et al. (1981) Gene 13:197.
  • Such techniques can be used to introduce one or more exogenous nucleic acid molecules into suitable host cells.
  • transduction refers to the transfer of an exogenous nucleic acid into a cell by a recombinant virion, in contrast to“infection” by a wild-type virion.
  • the terms“transduction” and“infectious” are synomymous, and therefore“infectivity” and“transduction efficiency” are equivalent and can be determined using similar methods.
  • Treatment “Treatment,”“treating,” and“treat” are defined as acting upon a disease, disorder, or condition with an agent to reduce or ameliorate harmful or any other undesired effects of the disease, disorder, or condition and/or its symptoms.
  • administering when used in connection with a composition of the invention refer both to direct administration (administration to a subject by a medical professional or by self-administration by the subject) and/or to indirect administration (prescribing a composition to a patient).
  • an effective amount is administered, which amount can be determined by one of skill in the art. Any method of administration may be used.
  • Administration to a subject can be achieved by, for example, intravenous, intrarterial, intramuscular, intravascular, or intramyocardial delivery.
  • an effective amount in reference to an amount of a composition refers to an amount that is sufficient to induce a desired physiologic outcome (e.g ., reprogramming of a cell or treatment of a disease).
  • An effective amount can be administered in one or more administrations, applications or dosages. Such delivery is dependent on a number of variables including the time period which the individual dosage unit is to be used, the bioavailability of the composition, the route of administration, etc.
  • compositions e.g., rAAV virions
  • amounts of the compositions depends upon a variety of factors including the activity of the specific agent employed, the age, body weight, general health, sex, and diet of the subject, the time of administration, the rate of excretion, the composition combination, severity of the particular disease being treated and form of administration.
  • the terms“individual,”“subject,” and“patient” are used interchangeably herein, and refer to a mammal, including, but not limited to, human and non-human primates (e.g . , simians); mammalian sport animals (e.g., horses); mammalian farm animals (e.g., sheep, goats, etc.); mammalian pets (e.g., dogs, cats, etc.); and rodents (e.g., mice, rats, etc.).
  • human and non-human primates e.g . , simians
  • mammalian sport animals e.g., horses
  • mammalian farm animals e.g., sheep, goats, etc.
  • mammalian pets e.g., dogs, cats, etc.
  • rodents e.g., mice, rats, etc.
  • cardiac pathology or“cardiac dysfunction” are used interchangeably and refer to any impairment in the heart’s pumping function. This includes, for example, impairments in contractility, impairments in ability to relax (sometimes referred to as diastolic dysfunction), abnormal or improper functioning of the heart’s valves, diseases of the heart muscle (sometimes referred to as cardiomyopathies), diseases such as angina pectoris, myocardial ischemia and/or infarction characterized by inadequate blood supply to the heart muscle, infiltrative diseases such as amyloidosis and hemochromatosis, global or regional hypertrophy (such as may occur in some kinds of cardiomyopathy or systemic hypertension), and abnormal communications between chambers of the heart.
  • impairments in contractility sometimes referred to as diastolic dysfunction
  • abnormal or improper functioning of the heart’s valves diseases of the heart muscle (sometimes referred to as cardiomyopathies)
  • diseases of the heart muscle sometimes referred to as cardiomyopathies)
  • diseases such as angina pectoris, myocardial
  • the term“cardiomyopathy” refers to any disease or dysfunction that affects myocardium directly.
  • the etiology of the disease or disorder may be, for example, inflammatory, metabolic, toxic, infiltrative, fibroplastic, hematological, genetic, or unknown in origin.
  • Two fundamental forms are recognized (1) a primary type, consisting of heart muscle disease of unknown cause; and (2) a secondary type, consisting of myocardial disease of known cause or associated with a disease involving other organ systems.
  • “Specific cardiomyopathy” refers to heart diseases associated with certain systemic or cardiac disorders; examples include hypertensive and metabolic cardiomyopathy.
  • the cardiomyopathies include dilated cardiomyopathy (DCM), a disorder in which left and/or right ventricular systolic pump function is impaired, leading to progressive cardiac enlargement; hypertrophic cardiomyopathy, characterized by left ventricular hypertrophy without obivious causes such as hypertension or aortic stenosis; and restrictive cardiomyopathy, characterized by abnormal diastolic function and excessively rigid ventricular walls that impede ventricular filling. Cardiomyopathies also include left ventricular non-compaction, arrhythmogenic right ventricular cardiomyopathy, and arrhythmogenic right ventricular dysplasia.
  • DCM dilated cardiomyopathy
  • hypertrophic cardiomyopathy characterized by left ventricular hypertrophy without obivious causes such as hypertension or aortic stenosis
  • restrictive cardiomyopathy characterized by abnormal diastolic function and excessively rigid ventricular walls that impede ventricular filling.
  • Cardiomyopathies also include left ventricular non-compaction, arrhythmogenic right ventricular cardiomyopathy
  • Heart failure referes to the pathological state in which an abnormality of cardiac function is responsible for failure of the hear to pump blood at a rate commensurate with the requirements of the metabolizing tissues and/or allows the heart to do so only from an abnormally elevated diastolic volume.
  • Heart failure includes systolic and diastotic failure. Patient with heart failure are classified into those with low cardiac output (typically secondary to ischemic heart disease, hypertension, dialated cardiomyopathy, and/or valvular or pericardial disease) and those with elevated cardiac output (typically due to hyperthyroidism, anemia, pregnancy, arteriovenous fistulas, beriberi, and Paget’s disease).
  • Heart failure includes heart failure with reduced ejection fraction (HFrEF) and heart failure with preserved ejection fraction (HFpEF).
  • phrases“pharmaceutically acceptable” is employed herein to refer to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
  • purified refers to material that has been isolated under conditions that reduce or eliminate the presence of unrelated materials, i.e. impurities, including native materials from which the material is obtained.
  • purified rAAV vector DNA is preferably substantially free of cell or culture components, including tissue culture components, contaminants, and the like.
  • cardiac tissue regeneration comprises generation of cardiomyocytes.
  • therapeutic gene refers to a gene that, when expressed, confers a beneficial effect on the cell or tissue in which it is present, or on a mammal in which the gene is expressed.
  • beneficial effects include amelioration of a sign or symptom of a condition or disease, prevention or inhibition of a condition or disease, or conferral of a desired characteristic.
  • Therapeutic genes include genes that partially or wholly correct a genetic deficiency in a cell or mammal.
  • a cardiomyocyte refers to a differentiated cardiomyocyte that is able to send or receive electrical signals.
  • a cardiomyocyte is said to be a functional cardiomyocyte if it exhibits electrophysiological properties such as action potentials and/or Ca 2+ transients.
  • a“differentiated non-cardiac cell” can refer to a cell that is not able to differentiate into all cell types of an adult organism (i.e.. is not a pluripotent cell), and which is of a cellular lineage other than a cardiac lineage (e.g., a neuronal lineage or a connective tissue lineage).
  • Differentiated cells include, but are not limited to, multipotent cells, oligopotent cells, unipotent cells, progenitor cells, and terminally differentiated cells.
  • a less potent cell is considered“differentiated” in reference to a more potent cell.
  • A“somatic cell” is a cell forming the body of an organism. Somatic cells include cells making up organs, skin, blood, bones and connective tissue in an organism, but not germ cells.
  • totipotent means the ability of a cell to form all cell lineages of an organism. For example, in mammals, only the zygote and the first cleavage stage blastomeres are totipotent.
  • pluripotent means the ability of a cell to form all lineages of the body or soma.
  • embryonic stem cells are a type of pluripotent stem cells that are able to form cells from each of the three germs layers, the ectoderm, the mesoderm, and the endoderm.
  • Pluripotent cells can be recognized by their expression of markers such as Nanog and Rexl.
  • multipotent refers to the ability of an adult stem cell to form multiple cell types of one lineage.
  • hematopoietic stem cells are capable of forming all cells of the blood cell lineage, e.g., lymphoid and myeloid cells.
  • oligopotent refers to the ability of an adult stem cell to differentiate into only a few different cell types.
  • lymphoid or myeloid stem cells are capable of forming cells of either the lymphoid or myeloid lineages, respectively.
  • the term“unipotent” means the ability of a cell to form a single cell type. For example, spermatogonial stem cells are only capable of forming sperm cells.
  • the term“reprogramming” or“transdifferentiation” refers to the generation of a cell of a certain lineage (e.g., a cardiac cell) from a different type of cell (e.g., a fibroblast cell) without an intermediate process of de-differentiating the cell into a cell exhibiting pluripotent stem cell characteristics.
  • a cell of a certain lineage e.g., a cardiac cell
  • a different type of cell e.g., a fibroblast cell
  • cardiac cell refers to any cell present in the heart that provides a cardiac function, such as heart contraction or blood supply, or otherwise serves to maintain the structure of the heart. Cardiac cells as used herein encompass cells that exist in the epicardium, myocardium or endocardium of the heart.
  • Cardiac cells also include, for example, cardiac muscle cells or cardiomyocytes, and cells of the cardiac vasculatures, such as cells of a coronary artery or vein.
  • cardiac cells include epithelial cells, endothelial cells, fibroblasts, cardiac stem or progenitor cells, cardiac conducting cells and cardiac pacemaking cells that constitute the cardiac muscle, blood vessels and cardiac cell supporting structure.
  • Cardiac cells may be derived from stem cells, including, for example, embryonic stem cells or induced pluripotent stem cells.
  • cardiomyocyte refers to sarcomere- containing striated muscle cells, naturally found in the mammalian heart, as opposed to skeletal muscle cells. Cardiomyocytes are characterized by the expression of specialized molecules e.g., proteins like myosin heavy chain, myosin light chain, cardiac a-actinin.
  • cardiomyocyte as used herein is an umbrella term comprising any cardiomyocyte subpopulation or cardiomyocyte subtype, e.g., atrial, ventricular and pacemaker cardiomyocytes.
  • cardiomyocyte-like cells is intended to mean cells sharing features with cardiomyocytes, but which may not share all features.
  • a cardiomyocyte-like cell may differ from a cardiomyocyte in expression of certain cardiac genes.
  • culture means the maintenance of cells in an artificial, in vitro environment.
  • A“cell culture system” is used herein to refer to culture conditions in which a population of cells may be grown as monolayers or in suspension.
  • “Culture medium” is used herein to refer to a nutrient solution for the culturing, growth, or proliferation of cells.
  • Culture medium may be characterized by functional properties such as, but not limited to, the ability to maintain cells in a particular state (e.g., a pluripotent state, a quiescent state, etc.), to mature cells - in some instances, specifically, to promote the differentiation of progenitor cells into cells of a particular lineage (e.g., a cardiomyocyte).
  • the term“expression” or“express” refers to the process by which polynucleotides are transcribed into mRNA and/or the process by which the transcribed mRNA is subsequently being translated into peptides, polypeptides, or proteins. If the polynucleotide is derived from genomic DNA, expression may include splicing of the mRNA in a eukaryotic cell. The expression level of a gene may be determined by measuring the amount of mRNA or protein in a cell or tissue sample.
  • induced cardiomyocyte or the abbreviation“iCM” refers to a non- cardiomyocyte (and its progeny) that has been transformed into a cardiomyocyte (and/or cardiomyocyte-like cell).
  • the methods of the present disclosure can be used in conjunction with any methods now known or later discovered for generating induced cardiomyocytes, for example, to enhance other techniques.
  • induced pluripotent stem cell-derived cardiomyocytes refers to human induced pluripotent stem cells that have been differentiated into cardiomyocyte- like cells. Exemplary methods for prepared iPS-CM cells are provided by Karakikes et al. Circ Res. 2015 Jun 19; 117(1): 80-88.
  • human cardiac fibroblast and“mouse cardiac fibroblast” as used herein refer to primary cell isolated from the ventricles of the adult heart of a human or mouse, respectively, and maintain in culture ex vivo.
  • non-cardiomyocyte refers to any cell or population of cells in a cell preparation not fulfilling the criteria of a“cardiomyocyte” as defined and used herein.
  • Non-limiting examples of non-cardiomyocytes include somatic cells, cardiac fibroblasts, non cardiac fibroblasts, cardiac progenitor cells, and stem cells.
  • reprogramming includes transdifferentiation, dedifferentiation and the like.
  • reprogramming efficiency refers to the number of cells in a sample that are successfully reprogrammed to cardiomyocytes relative to the total number of cells in the sample.
  • reprogramming factor includes a factor that is introduced for expression in a cell to assist in the reprogramming of the cell from one cell type into another.
  • a reprogramming factor may include a transcription factor that, in combination with other transcription factors and/or small molecules, is capable of reprogramming a cardiac fibroblast into an induced cardiomyocyte.
  • a repogramming factor refers to a polypeptide that can be encoded by an AAV-delivered polynucleotide.
  • Reprogramming factors may also include small molecules.
  • stem cells refer to cells that have the capacity to self-renew and to generate differentiated progeny.
  • pluritent stem cells refers to stem cells that can give rise to cells of all three germ layers (endoderm, mesoderm and ectoderm), but do not have the capacity to give rise to a complete organism.
  • the term“equivalents thereof’ in reference to a polypeptide or nucleic acid sequence refers to a polypeptide or nucleic acid that differs from a reference polypeptide or nucleic acid sequence, but retains essential properties (e.g., biological activity).
  • a typical variant of a polynucleotide differs in nucleotide sequence from another, reference polynucleotide. Changes in the nucleotide sequence of the variant may or may not alter the amino acid sequence of a polypeptide encoded by the reference polynucleotide. Nucleotide changes may result in amino acid substitutions, deletions, additions, fusions and truncations in the polypeptide encoded by the reference sequence. Generally, differences are limited so that the sequences of the reference polypeptide and the variant are closely similar overall and, in many regions, identical.
  • progenitor cell refers to a cell that is committed to differentiate into a specific type of cell or to form a specific type of tissue.
  • a progenitor cell like a stem cell, can further differentiate into one or more kinds of cells, but is more mature than a stem cell such that it has a more limited/restricted differentiation capacity.
  • the term“genetic modification” refers to a permanent or transient genetic change induced in a cell following introduction of new nucleic acid (i.e., nucleic acid exogenous to the cell). Genetic change can be accomplished by incorporation of the new nucleic acid into the genome of the cardiac cell, or by transient or stable maintenance of the new nucleic acid as an extrachromosomal element. Where the cell is a eukaryotic cell, a permanent genetic change can be achieved by introduction of the nucleic acid into the genome of the cell. Suitable methods of genetic modification include viral infection, transfection, conjugation, protoplast fusion, electroporation, particle gun technology, calcium phosphate precipitation, direct microinjection, and the like.
  • the term“stem cells” refer to cells that have the capacity to self-renew and to generate differentiated progeny.
  • pluripototent stem cells refers to stem cells that can give rise to cells of all three germ layers (endoderm, mesoderm and ectoderm), but do not have the capacity to give rise to a complete organism.
  • the compositions for inducing cardiomycocyte phenotype can be used on a population of cells to induce reprogramming. In other embodiments, the compositions induce a cardiomycocyte phenotype.
  • induced pluripotent stem cells shall be given its ordinary meaning and shall also refer to differentiated mammalian somatic cells (e.g, adult somatic cells, such as skin) that have been reprogrammed to exhibit at least one characteristic of pluripotency. See, for example, Takahashi et al. (2007) Cell 131(5):861-872, Kim et al. (2011) Proc. Natl. Acad. Sci. 108(19): 7838-7843, Sell (2013) Stem Cells Handbook.
  • transduction efficiency refers to the percentage of cells transduced with at least one AAV genome. For example, if 1 x 10 6 cells are exposed to a virus and 0.5 x 10 6 cells are determined to contain at least one copy of the AAV genome, then the transduction efficiency is 50%.
  • An illustrative method for determining transduction efficiency is flow cytometry. For example, the percentage of GFP+ cells is a measure of transduction efficieny when the AAV genome comprises a polynucleotide encoding green fluorescence protein (GFP).
  • GFP green fluorescence protein
  • the term“selectivity” refers to the ratio of transduction efficiency for one cell type over another, or over all other cells types.
  • infectivity refers to the ability of an AAV virion to infect a cell, in particularly an in vivo cell. Infectivity therefore is a function of, at least, biodistribution and neutralizing antibody escape.
  • AAV adeno-associated virus
  • rAAV recombinant adeno-associated virus
  • AHCF adult human cardiac fibroblast
  • APCF adult pig cardiac fibroblast
  • a-MHC- GFP alpha-myosin heavy chain green fluorescence protein
  • CF cardiac fibroblast
  • cm centimeter
  • CO cardiac output
  • EF ejection fraction
  • FACS fluorescence activated cell sorting
  • GFP green fluorescence protein
  • GMT Gata4, Mef2c and Tbx5
  • GMTc Gata4, Mef2c, Tbx5, TGF-b ⁇ , WNTi
  • GO gene ontology
  • hCF human cardiac fibroblast
  • iCM induced cardiomyocyte
  • kg killigram
  • m microgram
  • m ⁇ microliter
  • mg milligram
  • ml milliliter
  • MI myejection fraction
  • the AAV capsid is encoded by the cap gene of AAV, which is also termed the right open-reading frame (ORF) (in contrast to the left ORF, rep).
  • ORF right open-reading frame
  • the structures of representative AAV capsids are described in various publications including Xie et al. (2002) Proc. Natl. Acad. Sci USA 99: 10405-1040 (AAV2); Govindasamy et al. (2006) J Virol. 80: 11556-11570 (AAV4); Nam et a. (2007) J. Virol. 81 : 12260-12271 (AAV 8) and Govindasamy et al. (2013) J. Virol. 87: 11187-11199 (AAV5).
  • the three VPs are translated from the same mRNA, with VP1 containing a unique N-terminal domain in addition to the entire VP2 sequence at its C-terminal region.
  • VP2 contains an extra N-terminal sequence in addition to VP3 at its C terminus. In most crystal structures, only the C-terminal polypeptide sequence common to all the capsid proteins ( ⁇ 530 amino acids) is observed.
  • N-terminal unique region of VP1, the VP1-VP2 overlapping region, and the first 14 to 16 N- terminal residues of VP3 are thought to be primarily disordered.
  • Cryo-electron microscopy and image reconstruction data suggest that in intact AAV capsids, the N-terminal regions of the VP1 and VP2 proteins are located inside the capsid and are inaccessible for receptor and antibody binding.
  • receptor attachment and transduction phenotypes are, generally, determined by the amino acid sequences within the common C-terminal domain of VP1, VP2 and VP3
  • the one or more amino acid insertions, substitutions, or deletions is/are in the GH loop, or loop IV, of the AAV capsid protein, e.g., in a solvent- accessible portion of the GH loop, or loop IV, of the AAV capsid protein.
  • GH loop/loop IV of AAV capsid see, e.g., van Vliet et al. (2006) Mol. Ther. 14:809; Padron et al. (2005) Virol. 79:5047; and Shen et al. (2007 )Mol. Ther. 15: 1955.
  • a“parental” AAV capsid protein is a wild-type AAV5 capsid protein. In some embodiments, a“parental” AAV capsid protein is a chimeric AAV capsid protein.
  • Amino acid sequences of various AAV capsid proteins are known in the art. See, e.g., GenBank Accession No. NP_049542 for AAV1; GenBank Accession No. NP_044927 for AAV4; GenBank Accession No. AAD13756 for AAV5; GenBank Accession No. AAB95450 for AAV6; GenBank Accession No. YP_077178 for AAV7; GenBank Accession No.
  • Adeno-associated virus is a replication-deficient parvovirus, the single- stranded DNA genome of which is about 4.7 kb in length including two 145 nucleotide inverted terminal repeat (ITRs).
  • ITRs nucleotide inverted terminal repeat
  • AAV5 genome is provided in GenBank Accession No. AF085716.
  • the life cycle and genetics of AAV are reviewed in Muzyczka, Current Topics in Microbiology and Immunology, 158: 97-129 (1992). Production of pseudotyped rAAV is disclosed in, for example, WO 01/83692.
  • rAAV variants for example rAAV with capsid mutations
  • rAAV vectors are provided in US 7,105,345; US 15/782,980; US 7,259,151; US 6,962,815; US 7,718,424; US 6,984,517; US 7,718,424; US 6,156,303; US 8,524,446; US 7,790,449; US 7,906,111; US 9,737,618; US App 15/433,322; US 7,198,951, each of which is incorporated by reference in its entirety for all purposes.
  • the rAAV virions of the disclosure comprise a heterologous nucleic acid comprising a nucleotide sequence encoding one or more gene product.
  • the gene product(s) may be either a polypeptide or an RNA, or both.
  • the gene product is a polypeptide
  • the nucleotide sequence encodes a messenger RNA, optionally with one or more introns, which is translated into the gene product polypeptide.
  • the nucleotide sequence may encode one, two, three, or more gene products (though the number is limited by the packaging capacity of the rAAV virion, typically about 5.2 kb).
  • the gene products may be operatively linked to one promoter (for a single transcriptional unit) or more than one. Multiple gene products may also be produced using internal ribosome entry signal (IRES) or a self-cleaving peptide (e.g., a 2A peptide).
  • IRS internal ribosome entry signal
  • the gene product is a polypeptide.
  • the polypeptide gene product is a polypeptide that induces reprogramming of a cardiac fibroblast, to generate an induced cardiomyocyte-like cell (iCM).
  • the polypeptide gene product is a polypeptide that enhances the function of a cardiac cell.
  • the polypeptide gene product is a polypeptide that provides a function that is missing or defective in the cardiac cell.
  • the polypeptide gene product is a genome- editing endonuclease.
  • the gene product comprises a fusion protein that is fused to a heterologous polypeptide.
  • the gene product comprises a genome editing nuclease fused to an amino acid sequence that provides for subcellular localization, /. e.. the fusion partner is a subcellular localization sequence (e.g., one or more nuclear localization signals (NLSs) for targeting to the nucleus, two or more NLSs, three or more NLSs, etc.).
  • NLSs nuclear localization signals
  • a viral vector is produced by introducing a viral DNA or RNA construct into a“producer cell” or“packaging cell” line.
  • Packaging cell lines include but are not limited to any easily -transfectable cell line.
  • Packaging cell lines can be based on HEK291, 293T cells, NIH3T3, COS, HeLa or Sf9 cell lines. Examples of packaging cell lines include but are not limited to: Sf9 (ATCC® CRL-1711TM).
  • Exemplary packing cell lines and methods for generating rAAV virions are provided by Int’l Pat. Pub. Nos.
  • the gene product is a functional cardiac protein.
  • the gene product is a genome-editing endonuclease (optionally with a guide RNA, single-guide RNA, and/or repair template) that replaces or repairs a non-functional cardiac protein into a functional cardiac protein.
  • Functional cardiac proteins include, but are not limited to cardiac troponin T; a cardiac sarcomeric protein; b-myosin heavy chain; myosin ventricular essential light chain 1; myosin ventricular regulatory light chain 2; cardiac a-actin; a-tropomyosin; cardiac troponin I; cardiac myosin binding protein C; four-and-a-half LIM protein 1; titin; 5’-AMP -activated protein kinase subunit gamma-2; troponin I type 3, myosin light chain 2, actin alpha cardiac muscle 1; cardiac LIM protein; caveolin 3 (CAV3); galactosidase alpha (GLA); lysosomal-associated membrane protein 2 (LAMP2); mitochondrial transfer RNA glycine (MTTG); mitochondrial transfer RNA isoleucine (MTTI); mitochondrial transfer RNA lysine (MTTK); mitochondrial transfer RNA glutamine (MTTQ); myosin light chain 3 (MYL
  • the gene product is a gene product whose expression complements a defect in a gene responsible for a genetic disorder.
  • the disclosure provides rAAV virions comprising a polynucleotide encoding one or more of the following— e.g., for use, without limitation, in the disorder indicated in parentheses, or for other disorders caused by each: TAZ (Barth syndrome); FXN (Freidrich’s Ataxia); CASQ2 (CPVT); FBN1 (Marfan); RAF1 and SOSls (Noonan); SCN5A (Brugada); KCNQ1 and KCNH2s (Long QT Syndrome); DMPK (Myotonic Dystrophy 1); LMNA (Limb Girdle Dystrophy Type IB); JUP (Naxos); TGFBR2 (Loeys-Dietz); EMD (X-Linked EDMD); and ELN (SV Aortic Stenosis).
  • the rAAV virion comprises a polynucleotide encording one or more of cardiac troponin T (TNNT2); BAG family molecular chaperone regulator 3 (BAG3); myosin heavy chain (MYH7); tropomyosin 1 (TPM1); myosin binding protein C (MYBPC3); 5’-AMP- activated protein kinase subunit gamma-2 (PRKAG2); troponin I type 3 (TNNI3); titin (TTN); myosin, light chain 2 (MYL2); actin, alpha cardiac muscle 1 (ACTC1); potassium voltage-gated channel, KQT- like subfamily, member 1 (KCNQ1); plakophilin 2 (PKP2); myocyte enhancer factor 2c (MEF2C); and cardiac LIM protein (CSRP3).
  • TNNT2 cardiac troponin T
  • BAG3 BAG family molecular chaperone regulator 3
  • MYH7 myosin heavy
  • the gene products of the disclosure are polypeptide reprogramming factors.
  • Reprogramming factors are desirable as means to convert one cell type into another.
  • Non-cardiomyocytes cells can be differentiated into cardiomyocytes cells in vitro or in vivo using any method available to one of skill in the art. For example, see methods described in Ieda et al. (2010) Cell 142:375-386; Christoforou et al. (2013) PLoS ONE 8:e63577; Addis et al. (2013) J. Mol. Cell Cardiol. 60:97-106; Jayawardena et al. (2012) Circ. Res. 110: 1465-1473; Nam Y et al. (2003) PNAS USA 110:5588-5593; Wada R et al. (2013) PNAS USA 110: 12667-12672; and Fu J et al. (2013) Stem Cell Reports 1 :235-247.
  • the reprogramming factors may be capable of converting a cardiac fibroblast to a cardiac myocyte either directly or through an intermediate cell type.
  • direct regramming is possible, or reprogramming by first converting the fibroblast to a pluripotent or totipotent stem cell.
  • a pluripotent stem cell is termed an induced pluripotent stem (iPS) cell.
  • iPS-CM cell is termed an iPS-CM cell.
  • iPS-CM derived in vitro from cardiac fibroblasts are used in vivo to select capsid proteins of interest.
  • iPS-CM cells in vitro but, particular, in vivo, as part of a therapeutic gene therapy regimen.
  • Induced cardiomyocyte-like (iCM) cells refer to cells directly reprogrammed into cardiomyocytes.
  • Induced cardiomyocytes express one or more cardiomyocyte-specific markers, where cardiomyocyte-specific markers include, but are not limited to, cardiac troponin I, cardiac troponin-C, tropomyosin, caveolin-3, myosin heavy chain, myosin light chain-2a, myosin light chain-2v, ryanodine receptor, sarcomeric a-actinin, Nkx2.5, connexin 43, and atrial natriuretic factor. Induced cardiomyocytes can also exhibit sarcomeric structures.
  • Induced cardiomyocytes exhibit increased expression of cardiomyocyte-specific genes ACTC1 (cardiac a-actin), ACTN2 (actinin a2), MYH6 (a-myosin heavy chain), RYR2 (ryanodine receptor 2), MYL2 (myosin regulatory light chain 2, ventricular isoform), MYL7 (myosin regulatory light chain, atrial isoform), TNNT2 (troponin T type 2, cardiac), and NPPA (natriuretic peptide precursor type A), PLN (phospholamban).
  • ACTC1 cardiac a-actin
  • ACTN2 actinin a2
  • MYH6 a-myosin heavy chain
  • RYR2 ryanodine receptor 2
  • MYL2 myosin regulatory light chain 2, ventricular isoform
  • MYL7 myosin regulatory light chain, atrial isoform
  • TNNT2 troponin T type 2, cardiac
  • Reprogramming methods involving polypeptide reprogramming factors include those described in US2018/0112282A1, WO2018/005546, WO2017/173137, US2016/0186141, US2016/0251624, US2014/0301991, and US2013/0216503A1, which are incorporated in their entirety, particularly for the reprogramming methods and factors disclosed.
  • cardiac cells are reprogrammed into induced cardiomyocyte- like (iCM) cells using one or more reprogramming factors that modulate the expression of one or more polynucleotides or proteins of interest, such as Achaete-scute homolog 1 (ASCL1), Myocardin (MYOCD), myocyte-specific enhancer factor 2C (MEF2C), and/or T-box transcription factor 5 (TBX5).
  • ASCL1 Achaete-scute homolog 1
  • MYOCD Myocardin
  • MEF2C myocyte-specific enhancer factor 2C
  • T-box transcription factor 5 T-box transcription factor 5
  • the one or more reprogramming factors are provided as a polynucleotide (e.g., an RNA, an mRNA, or a DNA polynucleotide) that encode one or more polynucleotides or proteins of interest.
  • the one or more reprogramming factors are provided as a protein.
  • the reprogramming factors are microRNAs or microRNA antagonists, siRNAs, or small molecules that are capable of increasing the expression of one or more polynucleotides or proteins of interest.
  • expression of a polynucleotides or proteins of interest is increased by expression of a microRNA or a microRNA antagonist.
  • endogenous expression of an Oct polypeptide can be increased by introduction of microRNA-302 (miR-302), or by increased expression of miR- 302. See, e.g., Hu et al, Stem Cells 31(2): 259-68 (2013), which is incorporated herein by reference in its entirety.
  • miRNA-302 can be an inducer of endogenous Oct polypeptide expression.
  • the miRNA-302 can be introduced alone or with a nucleic acid that encodes the Oct polypeptide.
  • a suitable nucleic acid gene product is a microRNA.
  • Suitable micrRNAs include, e.g., mir-1, mir-133, mir-208, mir-143, mir-145, and mir-499.
  • the methods of the disclosure comprise administering an rAAV virion of the disclosure before, during, or after administration of the small-molecule reprogramming factor.
  • the small-molecule reprogramming factor is a small molecule selected from the group consisting of SB431542, LDN-193189, dexamethasone, LY364947, D4476, myricetin, IWR1, XAV939, docosahexaenoic acid (DHA), S-Nitroso-TV- acetylpenicillamine (SNAP), Hh-Agl.5, alprostadil, cromakalim, MNITMT, A769662, retinoic acid p-hydoxyanlide, decamethonium dibromide, nifedipine, piroxicam, bacitracin, aztreonam, harmalol hydrochloride, amide-C2 (A7), Ph-C12 (A7), Ph-C12 (A7),
  • the gene products comprise reprogramming factors that modulate the expression of one or more proteins of interest selected from ASCL1, MYOCD, MEF2C, and TBX5.
  • the gene products comprise one or more reprogramming factors selected from ASCL1, MYOCD, MEF2C, AND TBX5, CCNB1, CCND1, CDK1, CDK4, AURKB, OCT4, BAF60C, ESRRG, GATA4, GATA6, HAND2, IRX4, ISLL, MESP1, MESP2, NKX2.5, SRF, TBX20, ZFPM2, and miR-133.
  • the gene products comprise GATA4, MEF2C, and TBX5 (i.e., GMT). In some embodiments, the gene products comprise MYOCD, MEF2C, and TBX5 (i.e., MyMT). In some embodiments, the gene products comprise MYOCD, ASCL1, MEF2C, and TBX5 (i.e., My AMT). In some embodiments, the gene products comprise MYOCD and ASCL1 (i.e., My A). In some embodiments, the gene products comprise GATA4, MEF2C, TBX5, and MYOCD (i.e., 4F).
  • the gene products comprise GATA4, MEF2C, TBX5, ESSRG, MYOCD, ZFPM2, and MESP1 (i.e., 7F).
  • the gene products comprise one or more of ASCL1, MEF2C, GATA4, TBX5, MYOCD, ESRRG, AND MESPL.
  • the rAAV virions generate cardiac myocytes in vitro or in vivo.
  • Cardiomyocytes or cardiac myocytes are the muscle cells that make up the cardiac muscle.
  • Each myocardial cell contains myofibrils, which are long chains of sarcomeres, the contractile units of muscle cells.
  • Cardiomyocytes show striations similar to those on skeletal muscle cells, but unlike multinucleated skeletal cells, they contain only one nucleus. Cardiomyocytes have a high mitochondrial density, which allows them to produce ATP quickly, making them highly resistant to fatigue.
  • Mature cardiomyocytes can express one or more of the following cardiac markers: a-Actinin, MLC2v, MY20, cMHC, NKX2-5, GATA4, cTNT, cTNI, MEF2C, MLC2a, or any combination thereof.
  • the mature cardiomyocytes express NKX2- 5, MEF2C or a combination thereof.
  • cardiac progenitor cells express early stage cardiac progenitor markers such as GATA4, ISL1 or a combination thereof.
  • the gene product is a polynucleotide.
  • the gene product is a guide RNA capable of binding to an RNA-guided endonuclease.
  • the gene product is an inhibitory nucleic acid capable of reducing the level of an mRNA and/or a polypeptide gene product, e.g., in a cardiac cell.
  • the polnucleotide gene product is an interfering RNA capable of selectively inactivating a transcript encoded by an allele that causes a cardiac disease or disorder.
  • the allele is a myosin heavy chain 7, cardiac muscle, beta (MYH7) allele that comprises a hypertrophic cardiomyopathy-causing mutation.
  • Other examples include, e.g., interfering RNAs that selectively inactivate a transcript encoded by an allele that causes hypertrophic cardiomyopathy (HCM), dilated cardiomyopathy (DCM) or Left Ventricular Non-Compaction (LVNC), where the allele is a MYL3 (myosin light chain 3, alkali, ventricular, skeletal slow), MYH7, TNNI3 (troponin I type 3 (cardiac)), TNNT2 (troponin T type 2 (cardiac)), TPM1 (tropomyosin 1 (alpha)) or ACTC1 allele comprising an HCM-causing, a DCM-causing or a LVNC-causing mutation. See, e.g., U.S. Pat. Pub. No. 2016/0237430 for examples of cardiac disease-
  • the gene product is a polypeptide-encoding RNA.
  • the gene product is an interfering RNA.
  • the gene product is an aptamer.
  • the gene product is a polypeptide.
  • the gene product is a therapeutic polypeptide, e.g., a polypeptide that provides clinical benefit.
  • the gene product is a site-specific nuclease that provide for site-specific knock-down of gene function.
  • the gene product is an RNA-guided endonuclease that provides for modification of a target nucleic acid.
  • the gene products are: i) an RNA-guided endonuclease that provides for modification of a target nucleic acid; and ii) a guide RNA that comprises a first segment that binds to a target sequence in a target nucleic acid and a second segment that binds to the RNA-guided endonuclease.
  • the gene products are: i) an RNA-guided endonuclease that provides for modification of a target nucleic acid; ii) a first guide RNA that comprises a first segment that binds to a first target sequence in a target nucleic acid and a second segment that binds to the RNA- guided endonuclease; and iii) a first guide RNA that comprises a first segment that binds to a second target sequence in the target nucleic acid and a second segment that binds to the RNA-guided endonuclease.
  • a nucleotide sequence encoding a heterologous gene product in an rAAV virion of the present disclosure can be operably linked to a promoter.
  • a nucleotide sequence encoding a heterologous gene product in an rAAV virion of the present disclosure can be operably linked to a constitutive promoter, a regulatable promoter, or a cardiac cell-specific promoter.
  • Suitable constitutive promoters include a human elongation factor 1 a subunit (EF1a) promoter, a b-actin promoter, an a-actin promoter, a b-glucuronidase promoter, CAG promoter, super core promoter, and a ubiquitin promoter.
  • a nucleotide sequence encoding a heterologous gene product in an rAAV virion of the present disclosure is operably linked to a cardiac-specific transcriptional regulator element (TRE), where cardiac-specific TREs include promoters and enhancers.
  • cardiac-specific TREs include, but are not limited to, TREs derived from the following genes: myosin light chain-2 (MLC-2), a- myosin heavy chain (a-MHC), desmin, AE3, cardiac troponin C (cTnC), and cardiac actin.
  • MLC-2 myosin light chain-2
  • a-MHC a- myosin heavy chain
  • desmin desmin
  • AE3 cardiac troponin C
  • cardiac actin cardiac actin
  • the promoter is an a-MHC promoter, an MLC-2 promoter, or cTnT promoter.
  • the polynucleotide encoding a gene product is operably linked to a promoter and/or enhancer to facilitate expression of the gene product.
  • a promoter and/or enhancer to facilitate expression of the gene product.
  • any of a number of suitable transcription and translation control elements including constitutive and inducible promoters, transcription enhancer elements, transcription terminators, etc. may be used in the rAAV virion (e.g., Bitter et al. (1987) Methods in Enzymology, 153:516-544).
  • polycistronic vector comprises an enhancer and a promoter operatively linked to a single open-reading frame comprising two or more polynucleotides linked by 2A region(s), whereby expression of the open-reading frame result in multiple polypeptides being generated co-translationally.
  • the 2A region is believed to mediate generation of multiple polypeptide sequences through codon skipping; however, the present disclosure relates also to polycistronic vectors that employ post- translational cleavage to generate two or more proteins of interest from the same polynucleotide.
  • Illustrative 2A sequences, vectors, and associated methods are provided in US20040265955A1, which is incorporated herein by reference.
  • Non-limiting examples of suitable eukaryotic promoters include CMV, CMV immediate early, HSV thymidine kinase, early and late SV40, long terminal repeats (LTRs) from retrovirus, and mouse metallothionein-I.
  • promoters that are capable of conferring cardiac specific expression will be used.
  • suitable cardiac specific promoters include desmin (Des), alpha- myosin heavy chain (a-MHC), myosin light chain 2 (MLC-2), cardiac troponin T (cTnT) and cardiac troponin C (cTnC).
  • Non-limiting examples of suitable neuron specific promoters include synapsin I (SYN), calcium/calmodulin-dependent protein kinase II, tubulin alpha I, neuron-specific enolase and platelet-derived growth factor beta chain promoters and hybrid promoters by fusing cytomegalovirus enhancer (E) to those neuron-specific promoters.
  • SYN synapsin I
  • E cytomegalovirus enhancer
  • Suitable promoters for driving expression reprogramming factors include, but are not limited to, retroviral long terminal repeat (LTR) elements; constitutive promoters such as CMV, HSV1-TK, SV40, EF-la, b-actin, phosphoglycerol kinase (PGK); inducible promoters, such as those containing Tet- operator elements; cardiac specific promoters, such as desmin (DES), alpha-myosin heavy chain (a-MHC), myosin light chain 2 (MLC-2), cardiac troponin T (cTnT) and cardiac troponin C (cTnC); neural specific promoters, such as nestin, neuronal nuclei (NeuN), microtubule-associate protein 2 (MAP2), beta III tubulin, neuron specific enolase (NSE), oligodendrocyte lineage (Oligl/2), and glial fibrillary acidic protein (GFAP); and pancreatic specific promoters
  • LTR
  • a polynucleotide is operably linked to a cell type-specific transcriptional regulator element (TRE), where TREs include promoters and enhancers.
  • TREs include, but are not limited to, TREs derived from the following genes: myosin light chain-2, a-myosin heavy chain, AE3, cardiac troponin C, and cardiac actin.
  • TREs include, but are not limited to, TREs derived from the following genes: myosin light chain-2, a-myosin heavy chain, AE3, cardiac troponin C, and cardiac actin.
  • Franz et al. (1997) Cardiovasc. Res. 35:560-566; Robbins et al. (1995) Ann. N. Y. Acad. Sci. 752:492-505; Linn et al. (1995) Circ. Res. 76:584-591; Parmacek et al. (1994) Cell. Biol. 14: 1870-1885; Hunter e
  • the promoter can be one naturally associated with a gene or nucleic acid segment.
  • the promoter can be one naturally associated with a microRNA gene (e.g., an miRNA-302 gene).
  • a naturally associated promoter can be referred to as the“natural promoter” and may be obtained by isolating the 5' non-coding sequences located upstream of the coding segment and/or exon.
  • an enhancer may be one naturally associated with a nucleic acid sequence. However, the enhancer can be located either downstream or upstream of that sequence.
  • a recombinant or heterologous promoter refers to a promoter that is not normally associated with a nucleic acid in its natural environment.
  • a recombinant or heterologous enhancer refers also to an enhancer not normally associated with a nucleic acid sequence in its natural environment.
  • promoters or enhancers can include promoters or enhancers of other genes, and promoters or enhancers isolated from any other prokaryotic, viral, or eukaryotic cell, and promoters or enhancers not“naturally occurring,” i.e., containing different elements of different transcriptional regulatory regions, and/or mutations that alter expression.
  • sequences may be produced using recombinant cloning and/or nucleic acid amplification technology, including PCRTM, in connection with the compositions disclosed herein (see U.S. Pat. No. 4,683,202, U.S. Pat. No. 5,928,906, each incorporated herein by reference).
  • the promoters employed may be constitutive, inducible, developmentally-specific, tissue-specific, and/or useful under the appropriate conditions to direct high level expression of the nucleic acid segment.
  • the promoter can be a constitutive promoter such as, a CMV promoter, a CMV cytomegalovirus immediate early promoter, a CAG promoter, an EF- 1a promoter, a HSV1-TK promoter, an SV40 promoter, a b-actin promoter, a PGK promoter, or a combination thereof.
  • eukaryotic promoters examples include, but are not limited to, constitutive promoters, e.g., viral promoters such as CMV, SV40 and RSV promoters, as well as regulatable promoters, e.g., an inducible or repressible promoter such as the tet promoter, the hsp70 promoter and a synthetic promoter regulated by CRE.
  • constitutive promoters e.g., viral promoters such as CMV, SV40 and RSV promoters
  • regulatable promoters e.g., an inducible or repressible promoter such as the tet promoter, the hsp70 promoter and a synthetic promoter regulated by CRE.
  • cell type-specific promoters are used to drive expression of reprogramming factors in specific cell types.
  • suitable cell type-specific promoters useful for the methods described herein include, but are not limited to, the synthetic macrophage-specific promoter described in He et al (2006), Human Gene Therapy 17:949-959; the granulocyte and macrophage-specific lysozyme M promoter (see, e.g., Faust et al (2000), Blood 96(2):719-726); and the myeloid-specific CDl lb promoter (see, e.g, Dziennis et al (1995), Blood 85(2):319- 329).
  • promoters examples include a human EF 1a elongation factor promoter, a CMV cytomegalovirus immediate early promoter, a CAG chicken albumin promoter, a viral promoter associated with any of the viral vectors described herein, or a promoter that is homologous to any of the promoters described herein (e.g, from another species).
  • prokaryotic promoters examples include, but are not limited to, SP6, T7, T5, toe, bla, trp, gal, lac, or maltose promoters.
  • an internal ribosome entry sites (IRES) element can be used to create multigene, or polycistronic, messages.
  • IRES elements are able to bypass the ribosome scanning model of 5'-methylated Cap dependent translation and begin translation at internal sites (Pelletier and Sonenberg, Nature 334(6180):320-325 (1988)).
  • IRES elements from two members of the picomavirus family polio and encephalomyocarditis
  • have been described Pelletier and Sonenberg, Nature 334(6180):320-325 (1988)
  • an IRES from a mammalian message Macejak & Samow, Nature 353:90-94 (1991)).
  • IRES elements can be linked to heterologous open reading frames. Multiple open reading frames can be transcribed together, each separated by an IRES, creating polycistronic messages. By virtue of the IRES element, each open reading frame is accessible to ribosomes for efficient translation. Multiple genes can be efficiently expressed using a single promoter/enhancer to transcribe a single message (see U.S. Patent Nos. 5,925,565 and 5,935,819, herein incorporated by reference).
  • a nucleotide sequence is operably linked to a polyadenylation sequence.
  • Suitable polyadenylation sequences include bovine growth hormone polyA signal (bGHpolyA) and short poly A signal.
  • the rAAV vectors of the disclosure compriset the Woodchuck Post-transcriptional Regulatory Element (WPRE).
  • WPRE Woodchuck Post-transcriptional Regulatory Element
  • the polynucleotide encoding gene products are join by sequences include so-called self-cleaving peptide, e.g. P2A peptides.
  • the gene product comprises a site-specific endonuclease that provides for site-specific knock-down of gene function, e.g., where the endonuclease knocks out an allele associated with a cardiac disease or disorder.
  • a site-specific endonuclease can be targeted to the defective allele and knock out the defective allele.
  • a site-specific endonuclease is an RNA-guided endonuclease.
  • a site-specific nuclease can also be used to stimulate homologous recombination with a donor DNA that encodes a functional copy of the protein encoded by the defective allele.
  • a subject rAAV virion can be used to deliver both a site-specific endonuclease that knocks out a defective allele a functional copy of the defective allele (or fragment thereof), resulting in repair of the defective allele, thereby providing for production of a functional cardiac protein (e.g. , functional troponin, etc.).
  • a subject rAAV virion comprises a heterologous nucleotide sequence that encodes a site-specific endonuclease and a heterologous nucleotide sequence that encodes a functional copy of a defective allele, where the functional copy encodes a functional cardiac protein.
  • Functional cardiac proteins include, e.g., troponin, a chloride ion channel, and the like.
  • Site-specific endonucleases that are suitable for use include, e.g.
  • ZFNs zinc finger nucleases
  • TALENs transcription activator-like effector nucleases
  • site-specific endonucleases are non-naturally occurring and are modified to target a specific gene.
  • site-specific nucleases can be engineered to cut specific locations within a genome, and non-homologous end joining can then repair the break while inserting or deleting several nucleotides.
  • site-specific endonucleases also referred to as“INDELs” then throw the protein out of frame and effectively knock out the gene. See, e.g., U.S. Pat. Pub. No. 2011/0301073.
  • Suitable site-specific endonucleases include engineered meganuclease re engineered homing endonucleases.
  • Suitable endonucleases include an I-Tevl nuclease.
  • Suitable meganucleases include I-Scel (see, e.g., Bellaiche et al. (1999) Genetics 152: 1037); and I-Crel (see, e.g., Heath et al. (1997) Nature Sructural Biology 4:468).
  • Site-specific endonucleases that are suitable for use include CRISPRi systems and the Cas9-based SAM system.
  • the gene product is an RNA-guided endonuclease.
  • the gene product comprises an RNA comprising a nucleotide sequence encoding an RNA-guided endonuclease.
  • the gene product is a guide RNA, e.g., a single -guide RNA.
  • the gene products are: 1) a guide RNA; and 2) an RNA-guided endonuclease.
  • the guide RNA can comprise: a) a protein-binding region that binds to the RNA-guided endonuclease; and b) a region that binds to a target nucleic acid.
  • An RNA-guided endonuclease is also referred to herein as a“genome editing nuclease.”
  • suitable genome editing nucleases are CRISPR/Cas endonucleases (e.g., class 2 CRISPR/Cas endonucleases such as a type II, type V, or type VI CRISPR/Cas endonucleases).
  • a suitable genome editing nuclease is a CRISPR/Cas endonuclease (e.g., a class 2 CRISPR/Cas endonuclease such as a type II, type V, or type VI CRISPR/Cas endonuclease).
  • the gene product comprises a class 2 CRISPR/Cas endonuclease.
  • the gene product comprises a class 2 type II CRISPR/Cas endonuclease (e.g., a Cas9 protein).
  • the gene product comprises a class 2 type V CRISPR/Cas endonuclease (e.g., a Cpfl protein, a C2cl protein, or a C2c3 protein).
  • the gene product comprises a class 2 type VI CRISPR/Cas endonuclease (e.g., a C2c2 protein; also referred to as a“Casl3a” protein).
  • the gene product comprises a CasX protein.
  • the gene product comprises a CasY protein.
  • the disclosure provides methods of identifying AAV capsid proteins that confer on rAAV virions increased transduction efficiency in target cells.
  • the methods comprise providing a population of rAAV virions whose rAAV genomes comprise a library of cap polynucleotides encoding variant AAV capsid proteins; optionally contacting the population with non-target cells for a time sufficient to permit attachment of undesired rAAV virions to the non-target cells; contacting the population with target cells for a time sufficient to permit transduction of the cap polynucleotide into the target cells by the rAAV virions; and sequencing the cap polynucleotides from the target cells, thereby identifying AAV capsid proteins that confer increased transduction efficiency in the target cells.
  • the method further comprises depleting the population of rAAV virions by contacting the population with non-target cells for time sufficient to permit attachment of the rAAV virions to the non-target cells.
  • identifications methods are provided in the Examples.
  • the disclosure provides methods for generating cardiomyocytes and/or cardiomyocyte-like cells in vitro using an rAAV virion.
  • Selected starting cells are transduced with an rAAV and optionally exposed to small-molecule reprogramming factors (before, during, or after transduction) for a time and under conditions sufficient to convert the starting cells across lineage and/or differentiation boundaries to form cardiac progenitor cells and/or cardiomyocytes.
  • the starting cells are fibroblast cells.
  • the starting cells express one or more markers indicative of a differentiated phenotype. The time for conversion of starting cells into cardiac progenitor and cardiomyocyte cells can vary.
  • the starting cells can be incubated after treatment with one or more polynucleotides or proteins of interest until cardiac or cardiomyocyte cell markers are expressed.
  • cardiac or cardiomyocyte cell markers can include any of the following markers: a-GATA4, TNNT2, MYH6, RYR2, NKX2-5, MEF2C, ANP, Actinin, MLC2v, MY20, cMHC, ISL1, cTNT, cTNI, and MLC2a, or any combination thereof.
  • the induced cardiomycocyte cells are negative for one or more neuronal cells markers.
  • Such neuronal cell markers can include any of the following markers: DCX, TUBB3, MAP2, and EN02.
  • Incubation can proceed until cardiac progenitor markers are expressed by the starting cells.
  • cardiac progenitor markers include GATA4, TNNT2, MYH6, RYR2, or a combination thereof.
  • the cardiac progenitor markers such as GATA4, TNNT2, MYH6, RYR2, or a combination thereof can be expressed by about 8 days, or by about 9 days, or by about 10 days, or by about 11 days, or by about 12 days, or by about 14 days, or by about 15 days, or by about 16 days, or by about 17 days, or by about 18 days, or by about 19 days, or by about 20 days after starting incubation of cells in the compositions described herein. Further incubation of the cells can be performed until expression of late stage cardiac progenitor markers such as NKX2-5, MEF2C or a combination thereof occurs.
  • Reprogramming efficiency may be measured as a function of cardiomyocyte markers.
  • pluripotency markers include, but are not limited to, the expression of cardiomyocyte marker proteins and mRNA, cardiomyocyte morphology and electrophysiological phenotype.
  • cardiomyocyte markers include, a-sarcoglycan, atrial natriuretic peptide (ANP), bone morphogenetic protein 4 (BMP4), connexin 37, connexin 40, crypto, desmin, GATA4, GATA6, MEF2C, MYH6, myosin heavy chain, NKX2.5, TBX5, and Troponin T.
  • the expression of various markers specific to cardiomyocytes may be detected by conventional biochemical or immunochemical methods (e.g., enzyme- linked immunosorbent assay, immunohistochemical assay, and the like). Alternatively, expression of a nucleic acid encoding a cardiomyocyte- specific marker can be assessed. Expression of cardiomyocyte- specific marker-encoding nucleic acids in a cell can be confirmed by reverse transcriptase polymerase chain reaction (RT-PCR) or hybridization analysis, molecular biological methods which have been commonly used in the past for amplifying, detecting and analyzing mRNA coding for any marker proteins. Nucleic acid sequences coding for markers specific to cardiomyocytes are known and are available through public databases such as GenBank. Thus, marker-specific sequences needed for use as primers or probes are easily determined.
  • RT-PCR reverse transcriptase polymerase chain reaction
  • Cardiomyocytes exhibit some cardiac-specific electrophysiological properties.
  • One electrical characteristic is an action potential, which is a short-lasting event in which the difference of potential between the interior and the exterior of each cardiac cell rises and falls following a consistent trajectory.
  • Another electrophysiological characteristic of cardiomyocytes is the cyclic variations in the cytosolic-free Ca 2+ concentration, named as Ca 2+ transients, which are employed in the regulation of the contraction and relaxation of cardiomyocytes. These characteristics can be detected and evaluated to assess whether a population of cells has been reprogrammed into cardiomyocytes.
  • the present disclosure provides a method of delivering a gene product to a cardiac cell, e.g., a cardiac fibroblast.
  • the methods generally involve infecting a cardiac cell (e.g, a cardiac fibroblast) with an rAAV virion, where the gene product(s) encoded by the heterologous nucleic acid present in the rAAV virion is/are produced in the cardiac cell (e.g., cardiac fibroblast).
  • Delivery of gene product(s) to a cardiac cell can provide for treatment of a cardiac disease or disorder.
  • Delivery of gene product(s) to a cardiac cell (e.g., cardiac fibroblast) can provide for generation of an induced cardiomyocyte-like (iCM) cell from the cardiac fibroblast.
  • Delivery of gene product(s) to a cardiac cell e.g., cardiac fibroblast
  • infecting or transducing a cardiac cell is carried out in vitro.
  • infecting or transducing a cardiac cell is carried out in vitro, ⁇ and the infected/transduced cardiac cell (e.g., cardiac fibroblast) is introduced into (e.g., transfused into or implanted into) an individual in need thereof, e.g., directly into cardiac tissue of an individual in need thereof.
  • an effective amount of rAAV virions to be delivered to cells is from about 10 5 to about 10 13 of the rAAV virions.
  • Other effective dosages can be readily established by one of ordinary skill in the art through routine trials establishing dose response curves.
  • infecting a cardiac cell is carried out in vivo.
  • an effective amount of an rAAV virion of the present disclosure is administered directly into cardiac tissue of an individual in need thereof.
  • An“effective amount” will fall in a relatively broad range that can be determined through experimentation and/or clinical trials.
  • a therapeutically effective dose will be on the order of from about 10 6 to about 10 15 of the rAAV virions, e.g., from about 10 5 to 10 12 rAAV virions, of the present disclosure.
  • an effective amount of an rAAV virion of the present disclosure is administered via intramyocardial injection through the epicardium. In some embodiments, an effective amount of an rAAV virion of the present disclosure is administered via vascular delivery through the coronary artery. In some embodiments, an effective amount of an rAAV virion of the present disclosure is administered via systemic delivery through the superior vena cava. In some embodiments, an effective amount of an rAAV virion of the present disclosure is administered via systemic delivery through a peripheral vein.
  • from about 10 4 to about 10 5 , from about 10 5 to about 10 6 , from about 10 6 to about 10 7 , from about 10 6 to about 10 7 , from about 10 7 to about 10 8 , from about 10 8 to about 10 9 , from about 10 9 to about 10 10 , from about 10 10 to about 10 11 , to about 10 11 , from about 10 11 to about 10 12 , from about 10 12 to about 10 13 , from about 10 13 to about 10 14 , from about 10 14 to about 10 15 genome copies, or more than 10 15 genome copies, of an rAAV virion of the present disclosure are administered to an individual, e.g., are administered directly into cardiac tissue in the individual, or are administered via another route.
  • the number of rAAV virions administered to an individual can be expressed in viral genomes (vg) per kilogram (kg) body weight of the individual.
  • effective amount of an rAAV virion of the present disclosure is from about 10 2 vg/kg to 10 4 vg/kg, from about 10 4 vg/kg to about 10 6 vg/kg, from about 10 6 vg/kg to about 10 8 vg/kg, from about 10 8 vg/kg to about 10 10 vg/kg, from about 10 10 vg/kg to about 10 12 vg/kg, from about 10 12 vg/kg to about 10 14 vg/kg, from about 10 14 vg/kg to about 10 16 vg/kg, from about 10 16 vg/kg to about 10 18 vg/kg, or more than 10 18 vg/kg.
  • an effective amount of an rAAV virion of the present disclosure is administered via intramyocardial injection through the epicardium. In some embodiments, an effective amount of an rAAV virion of the present disclosure is administered via vascular delivery through the coronary artery. In some embodiments, an effective amount of an rAAV virion of the present disclosure is administered via systemic delivery through the superior vena cava. In some embodiments, an effective amount of an rAAV virion of the present disclosure is administered via systemic delivery through a peripheral vein.
  • more than one administration may be employed to achieve the desired level of gene expression.
  • the more than one administration is administered at various intervals, e.g., daily, weekly, twice monthly, monthly, every 3 months, every 6 months, yearly, etc.
  • multiple administrations are administered over a period of time of from 1 month to 2 months, from 2 months to 4 months, from 4 months to 8 months, from 8 months to 12 months, from 1 year to 2 years, from 2 years to 5 years, or more than 5 years.
  • the present disclosure provides a method of reprogramming a cardiac fibroblast to generate an induced cardiomyocyte-like cell (iCM).
  • the method generally involves infecting a cardiac fibroblast with an rAAV virion of the present disclosure, where the rAAV virion comprises a heterologous nucleic acid comprising a nucleotide sequence encoding one or more reprogramming factors.
  • the expression of various markers specific to cardiomyocytes is detected by conventional biochemical or immunochemical methods (e.g., enzyme-linked immunosorbent assay; immunohistochemical assay; and the like). Alternatively, expression of nucleic acid encoding a cardiomyocyte-specific marker can be assessed. Expression of cardiomyocyte- specific marker-encoding nucleic acids in a cell can be confirmed by reverse transcriptase polymerase chain reaction (RT-PCR) or hybridization analysis, molecular biological methods which have been commonly used in the past for amplifying, detecting and analyzing mRNA coding for any marker proteins. Nucleic acid sequences coding for markers specific to cardiomyocytes are known and are available through public data bases such as GenBank; thus, marker-specific sequences needed for use as primers or probes is easily determined.
  • RT-PCR reverse transcriptase polymerase chain reaction
  • Induced cardiomyocytes can also exhibit spontaneous contraction. Whether an induced cardiomyocyte exhibits spontaneous contraction can be determined using standard electrophysiol ogical methods (e.g., patch clamp).
  • induced cardiomyocytes can exhibit spontaneous Ca 2+ oscillations.
  • Ca 2+ oscillations can be detected using standard methods, e.g., using any of a variety of calcium-sensitive dyes, intracellular Ca 2+ ion-detecting dyes include, but are not limited to, fura-2, bis-fura 2, indo-1, Quin-2, Quin-2 AM, Benzothiaza-1, Benzothiaza-2, indo- 5F, Fura-FF, BTC, Mag-Fura-2, Mag-Fura-5, Mag-Indo-1, fluo-3, rhod-2, rhod-3, fura-4F, fur a- 5F, fura-6F, fluo-4, fluo-5F, fluo-5N, Oregon Green 488 BAPTA, Calcium Green, Calcein, Fura-C18, Calcium Green-C18, Calcium Orange, Calcium Crimson, Calcium Green-5N, Magnesium Green, Oregon Green 488 BAPTA-1, Oregon Green 488 B
  • an iCM is generated in vitro, and the iCM is introduced into an individual, e.g. , the iCM is implanted into a cardiac tissue of an individual in need thereof.
  • a method of the present disclosure can comprise infecting a population of cardiac fibroblasts in vitro, to generate a population of iCMs; and the population of iCMs is implanted into a cardiac tissue of an individual in need thereof.
  • an iCM is generated in vivo.
  • an rAAV virion of the present disclosure that comprises a heterologous nucleic acid comprising a nucleotide sequence encoding one or more reprogramming factors is administered to an individual.
  • the rAAV virion is administered directly into cardiac tissue of an individual in need thereof.
  • from about 10 6 to about 10 5 , from about 10 5 to about 10 9 , from about 10 9 to about 10 10 , from about 10 10 to about 10 11 , from about 10 11 to about 10 12 , from about 10 12 to about 10 13 , from about 10 13 to about 10 14 , from about 10 14 to about 10 15 genome copies, or more than 10 15 genome copies, of an rAAV virion of the present disclosure that comprises a heterologous nucleic acid comprising a nucleotide sequence encoding one or more reprogramming factors are administered to an individual, e.g. , are administered directly into cardiac tissue in the individual or via another route of administration.
  • the number of rAAV virions administered to an individual can be expressed in viral genomes (vg) per kilogram (kg) body weight of the individual.
  • effective amount of an rAAV virion of the present disclosure is from about 10 2 vg/kg to 10 4 vg/kg, from about 10 4 vg/kg to about 10 6 vg/kg, from about 10 6 vg/kg to about 10 8 vg/kg, from about 10 8 vg/kg to about 10 10 vg/kg, from about 10 10 vg/kg to about 10 12 vg/kg, from about 10 12 vg/kg to about 10 14 vg/kg, from about 10 14 vg/kg to about 10 14 vg/kg, from about 10 14 vg/kg to about 10 16 vg/kg, or more than 10 16 vg/kg.
  • an effective amount of an rAAV virion of the present disclosure is administered via intramyocardial injection through the epicardium. In some embodiments, an effective amount of an rAAV virion of the present disclosure is administered via vascular delivery through the coronary artery. In some embodiments, an effective amount of an rAAV virion of the present disclosure is administered via systemic delivery through the superior vena cava. In some embodiments, an effective amount of an rAAV virion of the present disclosure is administered via systemic delivery through a peripheral vein.
  • the present disclosure provides a method of modifying (“editing”) the genome of a cardiac cell.
  • the present disclosure provides a method of modifying (“editing”) the genome of a cardiac fibroblast.
  • the present disclosure provides a method of modifying (“editing”) the genome of a cardiomyocyte.
  • the methods generally involve infecting a cardiac cell (e.g., a cardiac fibroblast or a cardiomyocyte) with an rAAV virion of the present disclosure, where the rAAV virion comprises a heterologous nucleic acid comprising a nucleotide sequence encoding a genome-editing endonuclease.
  • the method comprises infecting a cardiac fibroblast or a cardiomyocyte with an rAAV virion of the present disclosure, where the rAAV virion comprises a heterologous nucleic acid comprising a nucleotide sequence encoding an RNA-guided genome -editing endonuclease.
  • the method comprises infecting a cardiac fibroblast or a cardiomyocyte with an rAAV virion of the present disclosure, where the rAAV virion comprises a heterologous nucleic acid comprising a nucleotide sequence encoding: i) an RNA-guided genome-editing endonuclease; and ii) one or more guide RNAs.
  • the method comprises infecting a cardiac fibroblast or a cardiomyocyte with an rAAV virion of the present disclosure, where the rAAV virion comprises a heterologous nucleic acid comprising a nucleotide sequence encoding: i) an RNA-guided genome-editing endonuclease; ii) a guide RNAs; and iii) a donor template DNA.
  • RNA-guided genome editing endonucleases are described above.
  • infecting a cardiac cell is carried out in vitro.
  • infecting a cardiac cell e.g., cardiac fibroblast; a cardiomyocyte
  • infecting a cardiac cell is carried out in vitro; and the infected cardiac cell (e.g., cardiac fibroblast) is introduced into (e.g., implanted into) an individual in need thereof, e.g., directly into cardiac tissue of an individual in need thereof.
  • an effective amount of rAAV virions to be delivered to cells will be on the order of from about 10 s to about 10 13 of the rAAV virions.
  • Other effective dosages can be readily established by one of ordinary skill in the art through routine trials establishing dose response curves.
  • infecting a cardiac cell is carried out in vivo.
  • a cardiac cell e.g., cardiac fibroblast; a cardiomyocyte
  • an effective amount of an rAAV virion of the present disclosure is administered directly into cardiac tissue of an individual in need thereof.
  • An“effective amount” will fall in a relatively broad range that can be determined through experimentation and/or clinical trials.
  • a therapeutically effective dose will be on the order of from about 10 6 to about 10 15 of the rAAV virions, e.g., from about 10 11 to 10 12 rAAV virions, of the present disclosure.
  • an effective amount of an rAAV virion of the present disclosure is administered via intramyocardial injection through the epicardium. In some embodiments, an effective amount of an rAAV virion of the present disclosure is administered via vascular delivery through the coronary artery. In some embodiments, an effective amount of an rAAV virion of the present disclosure is administered via systemic delivery through the superior vena cava. In some embodiments, an effective amount of an rAAV virion of the present disclosure is administered via systemic delivery through a peripheral vein.
  • rAAV virion of the present disclosure are administered to an individual, e.g., are administered directly into cardiac tissue in the individual.
  • the number of rAAV virions administered to an individual can be expressed in viral genomes (vg) per kilogram (kg) body weight of the individual.
  • an rAAV virion of the present disclosure is from about 10 2 vg/kg to 10 4 vg/kg, from about 10 4 vg/kg to about 10 6 vg/kg, from about 10 6 vg/kg to about 10 8 vg/kg, from about 10 8 vg/kg to about 10 10 vg/kg, from about 10 10 vg/kg to about 10 12 vg/kg, from about 10 12 vg/kg to about 10 14 vg/kg, from about 10 14 vg/kg to about 10 16 vg/kg, from about 10 16 vg/kg to about 10 18 vg/kg, or more than 10 18 vg/kg.
  • an effective amount of an rAAV virion of the present disclosure is administered via intramyocardial injection through the epicardium. In some embodiments, an effective amount of an rAAV virion of the present disclosure is administered via vascular delivery through the coronary artery. In some embodiments, an effective amount of an rAAV virion of the present disclosure is administered via systemic delivery through the superior vena cava. In some embodiments, an effective amount of an rAAV virion of the present disclosure is administered via systemic delivery through a peripheral vein.
  • the genome editing comprises homology-directed repair (HDR).
  • HDR homology-directed repair
  • the HDR corrects a defect in an endogenous target nucleic acid in the cardiac fibroblast or the cardiomyocyte, where the defect is associated with, or leads to, a defect in structure and/or function of the cardiac fibroblast or the cardiomyocyte, or a component of the cardiac fibroblast or the cardiomyocyte.
  • the genome editing comprises non-homologous end joining (NHEJ).
  • NHEJ non-homologous end joining
  • the NHEJ deletes a defect in an endogenous target nucleic acid in the cardiac fibroblast or the cardiomyocyte, where the defect is associated with, or leads to, a defect in structure and/or function of the cardiac fibroblast or the cardiomyocyte, or a component of the cardiac fibroblast or the cardiomyocyte.
  • a method of the present disclosure for editing the genome of a cardiac cell can be used to correct any of a variety of genetic defects that give rise to a cardiac disease or disorder.
  • Mutations of interest include mutations in one or more of the following genes: cardiac troponin T (TNNT2); myosin heavy chain (MYH7); tropomyosin 1 (TPM1); myosin binding protein C (MYBPC3); 5’-AMP-activated protein kinase subunit gamma-2 (PRKAG2); troponin I type 3 (TNNI3); titin (TTN); myosin, light chain 2 (MYL2); actin, alpha cardiac muscle 1 (ACTC1); potassium voltage-gated channel, KQT- like subfamily, member 1 (KCNQ1); plakophilin 2 (PKP2); myocyte enhancer factor 2c (MEF2C); and cardiac LIM protein (CSRP3).
  • TNNT2 cardiac troponin T
  • MYH7 myosin heavy
  • mutations of interest include, without limitation, MYH7 R663H mutation; TNNT2 R173W; PKP2 2013delC mutation; PKP2 Q617X mutation; and KCNQ1 G269S missense mutation.
  • Mutations of interest include mutations in one or more of the following genes: MYH6, ACTN2, SERCA2, GATA4, TBX5, MYOCD, NKX2-5, NOTCH1, MEF2C, HAND2, and HAND1.
  • the mutations of interest include mutations in the following genes: MEF2C, TBX5, and MYOCD.
  • Cardiac diseases and disorders that can be treated with a method of the present disclosure include coronary heart disease, cardiomyopathy, endocarditis, congenital cardiovascular defects, and congestive heart failure.
  • Cardiac diseases and disorders that can be treated with a method of the present disclosure include hypertrophic cardiomyopathy; a valvular heart disease; myocardial infarction; congestive heart failure; long QT syndrome; atrial arrhythmia; ventricular arrhythmia; diastolic heart failure; systolic heart failure; cardiac valve disease; cardiac valve calcification; left ventricular non-compaction; ventricular septal defect; and ischemia.
  • the disclosure provides a methods of treating a cardiac pathology in a subject in need thereof, comprising administering a therapeutically effective amount of a pharmaceutical composition comprising an rAAV virion to the subject, wherein the rAAV virion transduces cardiac tissue.
  • Subjects in need of treatment using compositins and methods of the present disclosure include, but are not limited to, individuals having a congenital heart defect, individuals suffering from a degenerative muscle disease, individuals suffering from a condition that results in ischemic heart tissue (e.g., individuals with coronary artery disease), and the like.
  • a method is useful to treat a degenerative muscle disease or condition (e.g., familial cardiomyopathy, dilated cardiomyopathy, hypertrophic cardiomyopathy, restrictive cardiomyopathy, or coronary artery disease with resultant ischemic cardiomyopathy).
  • a subject method is useful to treat individuals having a cardiac or cardiovascular disease or disorder, for example, cardiovascular disease, aneurysm, angina, arrhythmia, atherosclerosis, cerebrovascular accident (stroke), cerebrovascular disease, congenital heart disease, congestive heart failure, myocarditis, valve disease coronary, artery disease dilated, diastolic dysfunction, endocarditis, high blood pressure (hypertension), cardiomyopathy, hypertrophic cardiomyopathy, restrictive cardiomyopathy, coronary artery disease with resultant ischemic cardiomyopathy, mitral valve prolapse, myocardial infarction (heart attack), or venous thromboembolism.
  • cardiovascular disease for example, cardiovascular disease, aneurysm, angina, arrhythmia, atherosclerosis, cerebrovascular accident (stroke), cerebrovascular disease, congenital heart disease, congestive heart failure, myocarditis, valve disease coronary, artery disease dilated, diastolic dysfunction, endocarditis, high
  • Subjects suitable for treatment using the compositions, cells and methods of the present disclosure include individuals (e.g., mammalian subjects, such as humans, non-human primates, domestic mammals, experimental non- human mammalian subjects such as mice, rats, etc.) having a cardiac condition including but limited to a condition that results in ischemic heart tissue (e.g., individuals with coronary artery disease) and the like.
  • individuals e.g., mammalian subjects, such as humans, non-human primates, domestic mammals, experimental non- human mammalian subjects such as mice, rats, etc.
  • a cardiac condition including but limited to a condition that results in ischemic heart tissue (e.g., individuals with coronary artery disease) and the like.
  • an individual suitable for treatment suffers from a cardiac or cardiovascular disease or condition, e.g., cardiovascular disease, aneurysm, angina, arrhythmia, atherosclerosis, cerebrovascular accident (stroke), cerebrovascular disease, congenital heart disease, congestive heart failure, myocarditis, valve disease coronary, artery disease dilated, diastolic dysfunction, endocarditis, high blood pressure (hypertension), cardiomyopathy, hypertrophic cardiomyopathy, restrictive cardiomyopathy, coronary artery disease with resultant ischemic cardiomyopathy, mitral valve prolapse, myocardial infarction (heart attack), or venous thromboembolism.
  • a cardiac or cardiovascular disease or condition e.g., cardiovascular disease, aneurysm, angina, arrhythmia, atherosclerosis, cerebrovascular accident (stroke), cerebrovascular disease, congenital heart disease, congestive heart failure, myocarditis, valve disease coronary, artery disease dilated, diasto
  • individuals suitable for treatment with a subject method include individuals who have a degenerative muscle disease, e.g., familial cardiomyopathy, dilated cardiomyopathy, hypertrophic cardiomyopathy, restrictive cardiomyopathy, or coronary artery disease with resultant ischemic cardiomyopathy.
  • a degenerative muscle disease e.g., familial cardiomyopathy, dilated cardiomyopathy, hypertrophic cardiomyopathy, restrictive cardiomyopathy, or coronary artery disease with resultant ischemic cardiomyopathy.
  • the cardiac pathology can be selected from the group consisting of congestive heart failure, myocardial infarction, cardiac ischemia, myocarditis and arrhythmia.
  • the subject is diabetic.
  • the subject is non-diabetic.
  • the subject suffers from diabetic cardiomyopathy.
  • the rAAV virions of the disclosure and/or pharmaceutical compositions thereof can be administered locally or systemically.
  • An rAAV virion can be introduced by injection, catheter, implantable device, or the like.
  • An rAAV virion can be administered in any physiologically acceptable excipient or carrier that does not adversely affect the cells.
  • rAAV virions of the disclosure and/or pharmaceutical compositions thereof can be administered intravenously or through an intracardiac route (e.g., epicardially or intramyocardially).
  • Methods of administering rAAV virions of the disclosure and/or pharmaceutical compositions thereof to subjects, particularly human subjects include injection or infusion of the pharmaceutical compositions (e.g., compositions comprising rAAV virions). Injection may include direct muscle injection and infusion may include intravascular infusion.
  • the rAAV virions or pharmaceutical compositions can be inserted into a delivery device which facilitates introduction by injection into the subjects.
  • delivery devices include tubes, e.g., catheters, for injecting cells and fluids into the body of a recipient subject.
  • the tubes can additionally include a needle, e.g., a syringe, through which the cells of the invention can be introduced into the subject at a desired location.
  • the rAAV virion is administered by subcutaneous, intravenous, intramuscular, intraperitoneal, or intracardiac injection or by intracardiac catheterization. In some embdoiments, the rAAV virion is administered by direct intramyocardial injection or transvascular administration. In some embdoiments, the rAAV virion is administered by direct intramyocardial injection, antegrade intracoronary injection, retrograde injection, transendomyocardial injection, or molecular cardiac surgery with recirculating delivery (MCARD).
  • MCARD molecular cardiac surgery with recirculating delivery
  • the rAAV virions can be inserted into such a delivery device, e.g., a syringe, in different forms.
  • the rAAV virion can be supplied in the form of a pharmaceutical composition.
  • Such a composition can include an isotonic excipient prepared under sufficiently sterile conditions for human administration.
  • Cell Therapy Stem Cell Transplantation, Gene Therapy, and Cellular Immunotherapy, by G. Morstyn & W. Sheridan eds, Cambridge University Press, 1996; and Hematopoietic Stem Cell Therapy, E. D. Ball, J. Lister & P. Law, Churchill Livingstone, 2000.
  • Recombinant AAV may be administered locally or systemically.
  • Recombinant AAV may be engineered to target specific cell types by selecting the appropriate capsid protein of the disclosure.
  • the rAAV virions can first be tested in a suitable animal model. At one level, recombinant AAV are assessed for their ability to infect target cells in vivo.
  • Recombinant AAV can also be assessed to ascertain whether it migrates to target tissues, whether they induce an immune response in the host, or to determine an appropriate number, or dosage, of rAAV virions to be administered. It may be desirable or undesirable for the recombinant AAV to generate an immune response, depending on the disease to be treated. Generally, if repeated administration of a virion is required, it will be advantageous if the virion is not immunogenic.
  • rAAV virion compositions can be administered to immunodeficient animals (such as nude mice, or animals rendered immunodeficient chemically or by irradiation).
  • Target tissues or cells can be harvested after a period of infection and assessed to determine if the tissues or cells have been infected and if the desired phenotype (e.g . induced cardiomyocyte) has been induced in the target tissue or cells.
  • Recombinant AAV virions can be administered by various routes, including without limitation direct injection into the heart or cardiac catetherization.
  • the rAAV virions can be administered systemically such as by intravenous infusion. When direct injection is used, it may be performed either by open-heart surgey or by minimally invasive surgery.
  • the recombinant viruses are delivered to the pericardial space by injection or infusion. Injected or infused recombinant viruses can be traced by a variety of methods. For example, recombinant AAV labeled with or expressing a detectable label (such as green fluorescent protein, or beta-galactosidase) can readily be detected.
  • a detectable label such as green fluorescent protein, or beta-galactosidase
  • the recombinant AAV may be engineered to cause the target cell to express a marker protein, such as a surface-expressed protein or a fluorescent protein.
  • a marker protein such as a surface-expressed protein or a fluorescent protein.
  • the infection of target cells with recombinant AAV can be detected by their expression of a cell marker that is not expressed by the animal employed for testing (for example, a human-specific antigen when injecting cells into an experimental animal).
  • the presence and phenotype of the target cells can be assessed by fluorescence microscopy (e.g., for green fluorescent protein, or beta-galactosidase), by immunohistochemistry (e.g., using an antibody against a human antigen), by ELISA (using an antibody against a human antigen), or by RT-PCR analysis using primers and hybridization conditions that cause amplification to be specific for RNA indicative of a cardiac phenotype.
  • fluorescence microscopy e.g., for green fluorescent protein, or beta-galactosidase
  • immunohistochemistry e.g., using an antibody against a human antigen
  • ELISA using an antibody against a human antigen
  • RT-PCR analysis using primers and hybridization conditions that cause amplification to be specific for RNA indicative of a cardiac phenotype.
  • the present disclosure provides pharmaceutical composition comprising an rAAV virion of the disclosure.
  • the pharmaceutical composition may include one or more of a pharmaceutically acceptable carrier, diluent, excipient, and buffer.
  • the pharmaceutically acceptable carrier, diluent, excipient, or buffer is suitable for use in a human.
  • excipients, carriers, diluents, and buffers include any pharmaceutical agent that can be administered without undue toxicity.
  • Pharmaceutically acceptable excipients include, but are not limited to, liquids such as water, saline, glycerol and ethanol.
  • Pharmaceutically acceptable salts can be included therein, for example, mineral acid salts such as hydrochlorides, hydrobromides, phosphates, sulfates, and the like; and the salts of organic acids such as acetates, propionates, malonates, benzoates, and the like. Additionally, auxiliary substances, such as pH buffering substances may be present in such vehicles.
  • mineral acid salts such as hydrochlorides, hydrobromides, phosphates, sulfates, and the like
  • organic acids such as acetates, propionates, malonates, benzoates, and the like.
  • auxiliary substances such as pH buffering substances may be present in such vehicles.
  • Pharmaceutically acceptable excipients have been amply described in a variety of publications, including, for example, A.
  • rAAV virion is generated and purified as necessary or desired.
  • the rAAV can be mixed with or suspended in a pharmaceutically acceptable carrier. These rAAV can be adjusted to an appropriate concentration, and optionally combined with other agents.
  • the concentation of rAAV virion and/or other agent included in a unit dose can vary widely. The dose and the number of administrations can be optimized by those skilled in the art. For example, about 10 2 -10 10 vector genomes (vg) may be administered.
  • the dose be at least about 10 2 vg, about 10 3 vg, about 10 4 vg, about 10 5 vg, about 10 6 vg, about 10 7 vg, about 10 8 vg, about 10 9 vg, about 10 10 vg, or more vector genomes.
  • Daily doses of the compounds can vary as well.
  • Such daily doses can range, for example, from at least about 10 2 vg/day, about 10 3 vg/day, about 10 4 vg/day, to about 10 5 vg/day, about 10 6 vg/day, about 10 7 vg/day, about 10 8 vg/day, about 10 9 vg/day, about 10 10 vg/day, or more vector genomes per day.
  • the method of treatment is enhanced by the administration of one or more anti-inflammatory agents, e.g., an anti-inflammatory steroid or a nonsteroidal antiinflammatory drug (NSAID).
  • NSAID nonsteroidal antiinflammatory drug
  • Anti-inflammatory steroids for use in the invention include the corticosteroids, and in particular those with glucocorticoid activity, e.g., dexamethasone and prednisone.
  • Nonsteroidal anti-inflammatory drugs (NSAIDs) for use in the invention generally act by blocking the production of prostaglandins that cause inflammation and pain, cyclooxygenase- 1 (COX- 1) and/or cyclooxygenase-2 (COX-2).
  • COX-1 cyclooxygenase- 1
  • COX-2 cyclooxygenase-2
  • Traditional NSAIDs work by blocking both COX-1 and COX-2.
  • the COX-2 selective inhibitors block only the COX-2 enzyme.
  • the NSAID is a COX-2 selective inhibitor, e.g., celecoxib (Celebrex ® ), rofecoxib (Vioxx ), and valdecoxib (B extra ).
  • the anti-inflammatory is an NSAID prostaglandin inhibitor, e.g., Piroxicam.
  • the amount of rAAV virion for use in treatment will vary not only with the particular carrier selected but also with the route of administration, the nature of the condition being treated and the age and condition of the patient. Ultimately, the attendant health care provider may determine proper dosage.
  • a pharmaceutical composition may be formulated with the appropriate ratio of each compound in a single unit dosage form for administration with or without cells. Cells or vectors can be separately provided and either mixed with a liquid solution of the compound composition, or administered separately.
  • Recombinant AAV can be formulated for parenteral administration (e.g. , by injection, for example, bolus injection or continuous infusion) and may be presented in unit dosage form in ampoules, prefilled syringes, small volume infusion containers or multi-dose containers with an added preservative.
  • the pharmaceutical compositions can take the form of suspensions, solutions, or emulsions in oily or aqueous vehicles, and can contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
  • Suitable carriers include saline solution, phosphate buffered saline, and other materials commonly used in the art.
  • compositions can also contain other ingredients such as agents useful for treatment of cardiac diseases, conditions and injuries, such as, for example, an anticoagulant (e.g., dalteparin (fragmin), danaparoid (orgaran), enoxaparin (lovenox), heparin, tinzaparin (innohep), and/or warfarin (coumadin)), an antiplatelet agent (e.g., aspirin, ticlopidine, clopidogrel, or dipyridamole), an angiotensin-converting enzyme inhibitor (e.g., Benazepril (Lotensin), Captopril (Capoten), Enalapril (Vasotec), Fosinopril (Monopril), Lisinopril (Prinivil, Zestril), Moexipril (Univasc), Perindopril (Aceon), Quinapril (Accupril), Ramipril (Altace
  • Additional agents can also be included such as antibacterial agents, antimicrobial agents, anti-viral agents, biological response modifiers, growth factors; immune modulators, monoclonal antibodies and/or preservatives.
  • the compositions of the invention may also be used in conjunction with other forms of therapy.
  • the rAAV virions described herein can be administered to a subject to treat a disease or disorder.
  • a composition may be in a single dose, in multiple doses, in a continuous or intermittent manner, depending, for example, upon the recipient’s physiological condition, whether the purpose of the administration is in response to traumatic injury or for more sustained therapeutic purposes, and other factors known to skilled practitioners.
  • the administration of the compounds and compositions of the invention may be essentially continuous over a preselected period of time or may be in a series of spaced doses. Both local and systemic administration is contemplated.
  • localized delivery of rAAV virion is achieved.
  • localized delivery of rAAV virions is used to generate a population of cells within the heart.
  • an aqueous pharmaceutical composition can comprise a physiological salt, such as a sodium salt.
  • a physiological salt such as a sodium salt.
  • NaCl Sodium chloride
  • Other salts that may be present include potassium chloride, potassium dihydrogen phosphate, disodium phosphate dehydrate, magnesium chloride and calcium chloride.
  • Compositions may include one or more buffers.
  • Typical buffers include: a phosphate buffer; a Tris buffer; a borate buffer; a succinate buffer; a histidine buffer; or a citrate buffer.
  • Buffers will typically be included at a concentration in the 5-20 mM range.
  • the pH of a composition will generally be between 5 and 8, and more typically between 6 and 8 e.g. between 6.5 and 7.5, or between 7.0 and 7.8.
  • the composition is preferably sterile.
  • the composition is preferably gluten free.
  • the composition is preferably non-pyrogenic.
  • a composition comprising cells may include a cryoprotectant agent.
  • cryoprotectant agents include a glycol (e.g., ethylene glycol, propylene glycol, and glycerol), dimethyl sulfoxide (DMSO), formamide, sucrose, trehalose, dextrose, and any combinations thereof.
  • One or more of the following types of compounds can also be present in the composition with the rAAV virions: a WNT agonist, a GSK3 inhibitor, a TGF-beta signaling inhibitor, an epigenetic modifier, LSD1 inhibitor, an adenylyl cyclase agonist, or any combination thereof.
  • kits are described herein that include any of composition (e.g. rAAV virions) described herein.
  • the kit can include any of compositions described herein, either mixed together or individually packaged, and in dry or hydrated form.
  • the rAAV virions and/or other agents described herein can be packaged separately into discrete vials, bottles or other containers.
  • any of the rAAV virions and/or agents described herein can be packaged together as a single composition, or as two or more compositions that can be used together or separately.
  • the compounds and/or agents described herein can be packaged in appropriate ratios and/or amounts to facilitate conversion of selected cells across differentiation boundaries to form cardiac progenitor cells and/or cardiomyocytes.
  • the kit can include instructions for administering those compositions, compounds and/or agents. Such instructions can provide the information described throughout this application.
  • the rAAV virion or pharmaceutical composition can be provided within any of the kits in the form of a delivery device. Alternatively a delivery device can be separately included in the kits, and the instructions can describe how to assemble the delivery device prior to administration to a subject.
  • kits can also include syringes, catheters, scalpels, sterile containers for sample or cell collection, diluents, pharmaceutically acceptable carriers, and the like.
  • the kits can provide other factors such as any of the supplementary factors or drugs described herein for the compositions in the preceding section or other parts of the application.
  • Embodiment 1-1 A recombinant adeno-associated virus (rAAV) virion, comprising: a) an AAV5 capsid protein, wherein the capsid protein comprises an insertion with respect to a parental sequence of 5 to 11 amino acids at an insertion site in the GH loop of the parental sequence; and
  • a heterologous nucleic acid comprising a nucleotide sequence encoding a gene product.
  • Embodiment 1-2 The rAAV virion of embodiment 1-1, wherein the rAAV virion exhibits increased transduction efficiency in cardiac cells compared to an AAV virion comprising the parental sequence.
  • Embodiment 1-3 The rAAV virion of embodiment 1-1, wherein the rAAV virion exhibits increased transduction efficiency in human cardiac fibroblast (hCF) cells compared to an AAV virion comprising the parental sequence.
  • hCF human cardiac fibroblast
  • Embodiment 1-4 The rAAV virion of embodiment 1-3, wherein the rAAV virion exhibits at least 10-fold increased transduction efficiency in hCF cells at a multiplicity of infection (MOI) of 1,000.
  • MOI multiplicity of infection
  • Embodiment 1-5 The rAAV virion of embodiment 1-3, wherein the rAAV virion exhibits at least 2-fold increased transduction efficiency in hCF cells at a multiplicity of infection (MOI) of 100,000.
  • Embodiment 1-6 The rAAV virion of embodiment 1-1, wherein the rAAV virion exhibits increased transduction efficiency in induced pluripotent stem cell-derived cardiomyocyte (iPS-CM) cells compared to an AAV virion comprising the parental sequence.
  • iPS-CM induced pluripotent stem cell-derived cardiomyocyte
  • Embodiment 1-7 The rAAV virion of embodiment 1-6, wherein the rAAV virion exhibits at least 2-fold increased transduction efficiency in iPS-CM cells at a multiplicity of infection (MOI) of 100,000.
  • MOI multiplicity of infection
  • Embodiment 1-8 The rAAV virion of embodiment 1-6, wherein the rAAV virion exhibits at least 4-fold increased transduction efficiency in iPS-CM cells at a multiplicity of infection (MOI) of 1,000.
  • MOI multiplicity of infection
  • Embodiment 1-9 The rAAV virion of embodiment 1-1, wherein the rAAV virion exhibits increased selectivity of the rAAV virion for hCF cells over iPS-CM cells.
  • Embodiment I- 10 The rAAV virion of embodiment 1-1, wherein the rAAV virion exhibits increased selectivity of the rAAV virion for iPS-CM cells over hCF cells.
  • Embodiment 1-11 The rAAV virion of embodiment 1-1, wherein the insertion site is between any two, optionally adjacent, amino acids at positions in the parental sequence corresponding to 560 to 594 of SEQ ID NO: 1.
  • Embodiment 1-12 The rAAV virion of embodiment 1-11, wherein the insertion site is between adjacent amino acids in the parental sequence corresponding to 574 and 575 of SEQ ID NO: 1.
  • Embodiment 1-13 The rAAV virion of embodiment 1-12, wherein the insertion is a peptide of formula:
  • X 0 and X1o are each independently A, S, G, or absent (SEQ ID NO: 1101).
  • Embodiment 1-14 The rAAV virion of embodiment 1-12, wherein the insertion is a peptide of formula:
  • X 0 and X8 are each independently A, S, G, or absent (SEQ ID NO: 1102).
  • Embodiment 1-15 The rAAV virion of embodiment 1-12, wherein the insertion is a peptide of formula: -A-X1-X2-X3-X4-X5-X6-X7-A- wherein:
  • X1 is P, R, or G
  • X2 is K, L, or R;
  • X3 is any amino acid
  • X4 is N, H, K, or Q
  • X5 is any amino acid, or optionally X5 is G, K, or S;
  • X6 is any amino acid, or optionally X6 is T or V;
  • X7 is any amino acid, or optionally X7 is K or V (SEQ ID NO: 1103).
  • Embodiment I-Embodiment 1-16 The rAAV virion of embodiment 1-14, wherein the insertion comprises an amino acid sequence selected from SEQ ID NOs: 101-600.
  • Embodiment 1-17 The rAAV virion of embodiment 1-14, wherein the insertion comprises an amino acid sequence selected from RKVHIEV (SEQ ID NO: 81), RKYQSDL (SEQ ID NO: 82), PLTNTVK (SEQ ID NO: 83), LKYHGPP (SEQ ID NO: 84), RKYQGDM (SEQ ID NO: 85), RKFHSTD (SEQ ID NO: 86), RKHHGLE (SEQ ID NO: 87), PGTNVTK (SEQ ID NO: 88), RKMHMPD (SEQ ID NO: 89), PLKKIVQ (SEQ ID NO: 90), PLGKKTS (SEQ ID NO: 91), PRGVKVT (SEQ ID NO: 92), PLAKSKS (SEQ ID NO: 93), PRTKGAV (SEQ ID NO: 94), and PSGRKAT (SEQ ID NO: 95).
  • RKVHIEV SEQ ID NO: 81
  • RKYQSDL
  • Embodiment 1-18 The rAAV virion of embodiment 1-14, wherein the insertion comprises an amino acid sequence selected from ARKVHIEVA (SEQ ID NO: 101), ARKYQSDLA (SEQ ID NO: 102), APLTNTVKA (SEQ ID NO: 103), ALKYHGPPA (SEQ ID NO: 104), ARKYQGDMA (SEQ ID NO: 105), ARKFHSTDA (SEQ ID NO: 106), ARKHHGLEA (SEQ ID NO: 107), APGTNVTKA (SEQ ID NO: 108), ARKMHMPDA (SEQ ID NO: 109), APLKKIVQA (SEQ ID NO: 110), APLGKKTSA (SEQ ID NO: 111), APRGVKVTA (SEQ ID NO: 112), APLAKSKSA (SEQ ID NO: 113), APRTKGAVA (SEQ ID NO: 114), APSGRKATA (SEQ ID NO: 115).
  • ARKVHIEVA
  • Embodiment 1-19 The rAAV virion of embodiment 1-14, wherein the insertion comprises the amino acid sequence PLTNTVK (SEQ ID NO: 83) or a sequence comprising at most 1, 2, 3, or 4 amino-acid substitutions relative to PLTNTVK (SEQ ID NO: 83).
  • Embodiment 1-20 The rAAV virion of embodiment 1-14, wherein the insertion comprises the amino acid sequence PLKKIVQ (SEQ ID NO: 90) or a sequence comprising at most 1, 2, 3, or 4 amino-acid substitutions relative to PLKKIVQ (SEQ ID NO: 90).
  • Embodiment 1-21 An AAV5 capsid protein, wherein the capsid protein comprises an insertion with respect to a parental sequence of 5 to 11 amino acids at an insertion site in the GH loop of the parental sequence.
  • Embodiment 1-22 The AAV 5 capsid protein of embodiment 1-21 , wherein the AAV 5 capsid protein exhibits increased transduction efficiency in cardiac cells compared to an AAV virion comprising the parental sequence.
  • Embodiment 1-2 The AAV5 capsid protein of embodiment 1-21, wherein the AAV5 capsid protein exhibits increased transduction efficiency in human cardiac fibroblast (hCF) cells compared to an AAV virion comprising the parental sequence.
  • hCF human cardiac fibroblast
  • Embodiment 1-24 The AAV 5 capsid protein of embodiment 1-23, wherein the AAV 5 capsid protein exhibits at least 10-fold increased transduction efficiency in hCF cells at a multiplicity of infection (MOI) of 1,000.
  • MOI multiplicity of infection
  • Embodiment 1-25 The AAV5 capsid protein of embodiment 1-23, wherein The AAV5 capsid protein exhibits at least 2-fold increased transduction efficiency in hCF cells at a multiplicity of infection (MOI) of 100,000.
  • MOI multiplicity of infection
  • Embodiment 1-26 The AAV 5 capsid protein of embodiment 1-21 , wherein the AAV 5 capsid protein exhibits increased transduction efficiency in induced pluripotent stem cell- derived cardiomyocyte (iPS-CM) cells compared to an AAV virion comprising the parental sequence.
  • iPS-CM induced pluripotent stem cell- derived cardiomyocyte
  • Embodiment 1-27 The AAV 5 capsid protein of embodiment 1-26, wherein the AAV 5 capsid protein exhibits at least 2-fold increased transduction efficiency in iPS-CM cells at a multiplicity of infection (MOI) of 100,000.
  • MOI multiplicity of infection
  • Embodiment 1-28 The AAV 5 capsid protein of embodiment 1-26, wherein the AAV 5 capsid protein exhibits at least 4-fold increased transduction efficiency in iPS-CM cells at a multiplicity of infection (MOI) of 1,000.
  • MOI multiplicity of infection
  • Embodiment 1-29. The AAV 5 capsid protein of embodiment 1-21 , wherein the AAV 5 capsid protein exhibits increased selectivity of The AAV5 capsid protein for hCF cells over iPS-CM cells.
  • Embodiment 1-30 The AAV5 capsid protein of embodiment 1-21, wherein the AAV5 capsid protein exhibits increased selectivity of The AAV5 capsid protein for iPS-CM cells over hCF cells.
  • Embodiment 1-3 The AAV5 capsid protein of embodiment 1-21, wherein the insertion site is between any two, optionally adjacent, amino acids at positions in the parental sequence corresponding to 560 to 594 of SEQ ID NO: 1.
  • Embodiment 1-32 The AAV5 capsid protein of embodiment 1-21, wherein the insertion site is between adjacent amino acids in the parental sequence corresponding to 574 and 575 of SEQ ID NO: 1.
  • Embodiment 1-33 The AAV5 capsid protein of embodiment 1-32, wherein the insertion is a peptide of formula:
  • n 5-9
  • X 0 and X1o are each independently A, S, G, or absent (SEQ ID NO: 1101).
  • Embodiment 1-34 The AAV5 capsid protein of embodiment 1-32, wherein the insertion is a peptide of formula:
  • X 0 and X8 are each independently A, S, G, or absent (SEQ ID NO: 1102).
  • Embodiment 1-35 The AAV5 capsid protein of embodiment 1-32, wherein the insertion is a peptide of formula:
  • X1 is P, R, or G
  • X2 is K, L, or R;
  • X3 is any amino acid
  • X 4 is N, H, K, or Q;
  • X5 is any amino acid, or optionally X5 is G, K, or S;
  • X6 is any amino acid, or optionally X6 is T or V;
  • X7 is any amino acid, or optionally X7 is K or V (SEQ ID NO: 1103).
  • Embodiment 1-36 The AAV5 capsid protein of embodiment 1-34, wherein the insertion comprises an amino acid sequence selected from SEQ ID NOs: 101-600.
  • Embodiment 1-37 The AAV5 capsid protein of embodiment 1-34, wherein the insertion comprises an amino acid sequence selected from RKVHIEV (SEQ ID NO: 81), RKYQSDL (SEQ ID NO: 82), PLTNTVK (SEQ ID NO: 83), LKYHGPP (SEQ ID NO: 84), RKYQGDM (SEQ ID NO: 85), RKFHSTD (SEQ ID NO: 86), RKHHGLE (SEQ ID NO: 87), PGTNVTK (SEQ ID NO: 88), RKMHMPD (SEQ ID NO: 89), PLKKIVQ (SEQ ID NO: 90), PLGKKTS (SEQ ID NO: 91), PRGVKVT (SEQ ID NO: 92), PLAKSKS (SEQ ID NO: 93), PRTKGAV (SEQ ID NO: 94), and PSGRKAT (SEQ ID NO: 95).
  • RKVHIEV SEQ ID NO: 81
  • Embodiment 1-38 The AAV5 capsid protein of embodiment 1-34, wherein the insertion comprises an amino acid sequence selected from ARKVHIEVA (SEQ ID NO: 101), ARKYQSDLA (SEQ ID NO: 102), APLTNTVKA (SEQ ID NO: 103), ALKYHGPPA (SEQ ID NO: 104), ARKYQGDMA (SEQ ID NO: 105), ARKFHSTDA (SEQ ID NO: 106), ARKHHGLEA (SEQ ID NO: 107), APGTNVTKA (SEQ ID NO: 108), ARKMHMPDA (SEQ ID NO: 109), APLKKIVQA (SEQ ID NO: 110), APLGKKTSA (SEQ ID NO: 111), APRGVKVTA (SEQ ID NO: 112), APLAKSKSA (SEQ ID NO: 113), APRTKGAVA (SEQ ID NO: 114), APSGRKATA (SEQ ID NO: 115).
  • Embodiment 1-39 The AAV5 capsid protein of embodiment 1-34, wherein the insertion comprises the amino acid sequence PLTNTVK (SEQ ID NO: 83) or a sequence comprising at most 1, 2, 3, or 4 amino-acid substitutions relative to PLTNTVK (SEQ ID NO: 83).
  • Embodiment 1-40 The AAV5 capsid protein of embodiment 1-34, wherein the insertion comprises the amino acid sequence PLKKIVQ (SEQ ID NO: 90) or a sequence comprising at most 1, 2, 3, or 4 amino-acid substitutions relative to PLKKIVQ (SEQ ID NO: 90).
  • Embodiment 1-4 A polynucleotide encoding the AAV5 capsid protein of any one of embodiments 1-21 to 1-40.
  • Embodiment 1-42 A pharmaceutical composition comprising the rAAV virion of any one of embodiments 1-1 to 1-20.
  • Embodiment 1-43 A method of transducing a cardiac cell, comprising contacting the cardiac cell with an rAAV virion according to any one of embodiments 1-1 to 1-20, wherein the rAAV virion transduces the cardiac cell.
  • Embodiment 1-44 A method of delivering one or more gene products to a cardiac cell, comprising contacting the cardiac cell with an rAAV virion according to any one of embodiments 1-1 to 1-20, wherein the cardiac cell expresses the gene product.
  • Embodiment 1-45 The method of embodiment 1-44, wherein the one or more gene products comprise a short-hairpin RNA or a microRNA.
  • Embodiment 1-46 The method of embodiment 1-44, wherein the one or more gene products comprising a guide RNA, a Cas protein, and optionally a repair template, wherein the gene products form a functional a CRISPR/Cas system.
  • Embodiment 1-47 The method of embodiment 1-44, wherein the one or more gene products comprise a polypeptide.
  • Embodiment 1-48 The method of embodiment 1-47, wherein the polypeptide is selected from cardiac troponin T; a cardiac sarcomeric protein; b-myosin heavy chain; myosin ventricular essential light chain 1; myosin ventricular regulatory light chain 2; cardiac a-actin; a-tropomyosin; cardiac troponin I ; cardiac myosin binding protein C; four-and-a-half LIM protein 1; titin; 5'-AMP-activated protein kinase subunit gamma-2; troponin I type 3, myosin light chain 2, actin alpha cardiac muscle 1; cardiac LIM protein; caveolin 3 (CAV3); galactosidase alpha (GLA); lysosomal-associated membrane protein 2 (LAMP2); mitochondrial transfer RNA glycine (MTTG); mitochondrial transfer RNA isoleucine (MTTI); mitochondrial transfer RNA lysine (MTTK); mitochondrial transfer RNA glutamine
  • Embodiment 1-49 The method of embodiment 1-44, wherein the one or more gene products comprise one or more reprogramming factors.
  • Embodiment 1-50 The method of embodiment 1-49, wherein the one or more reprogramming factors is one or more polypeptide selected from ASCL1, MYOCD, MEF2C, TBX5, CCNB1, CCND1, CDK1, CDK4, AURKB, OCT4, BAF60C, ESRRG, GATA4, GATA6, HAND2, IRX4, ISLL, MESP1, MESP2, NKX2.5, SRF, TBX20, and ZFPM2.
  • the one or more reprogramming factors is one or more polypeptide selected from ASCL1, MYOCD, MEF2C, TBX5, CCNB1, CCND1, CDK1, CDK4, AURKB, OCT4, BAF60C, ESRRG, GATA4, GATA6, HAND2, IRX4, ISLL, MESP1, MESP2, NKX2.5, SRF, TBX20, and ZFPM2.
  • Embodiment 1-51 The method of any one of embodiments 1-43 to 1-50, wherein the method reprograms the cardiac cell into a cardiac cardiomyocyte.
  • Embodiment 1-52 A method of treating a cardiac pathology in a subject in need thereof, comprising administering a therapeutically effective amount of a pharmaceutical composition according to embodiment 1-42 to the subject, wherein the rAAV virion transduces cardiac tissue.
  • Embodiment 1-53 The method of embodiment 1-52, wherein the rAAV virion is administered by subcutaneous, intravenous, epicardial, intramuscular, intraperitoneal, or intracardiac injection or by intracardiac catheterization.
  • Embodiment 1-54 The method of embodiment 1-52, wherein the rAAV virion is administered by direct intramyocardial injection or transvascular administration.
  • Embodiment 1-55 The method of embodiment 1-52, wherein the rAAV virion is administered by direct intramyocardial injection, antegrade intracoronary injection, retrograde injection, transendomyocardial injection, or molecular cardiac surgery with recirculating delivery (MCARD).
  • MCARD molecular cardiac surgery with recirculating delivery
  • Embodiment 1-56 A method of identifying AAV capsid proteins that confer on rAAV virions increased transduction efficiency in target cells, comprising:
  • Embodiment 1-57 The method of embodiment 1-56, further comprising, before step (b), depleting the population of rAAV virions by contacting the population with non-target cells for time sufficient to permit attachment of the rAAV virions to the non-target cells.
  • Embodiment 1-58 A recombinant adeno-associated virus (rAAV) virion, comprising: a) an AAV5 capsid protein, wherein the capsid protein comprises one or more substitutions selected from S651A, T578A, or T582A compared to a parental AAV5 capsid; and
  • Embodiment 1-59 The rAAV virion of embodiment 1-58, wherein the AAV5 capsid protein comprises two or more substitutions selected from S651A, T578A, or T582A.
  • Embodiment 1-60 The rAAV virion of embodiment 1-58, wherein the AAV5 capsid protein comprises T582A and S651A substitutions.
  • Embodiment 1-61 The rAAV virion of embodiment 1-58, wherein the AAV5 capsid protein comprises T578A and T582A substitutions.
  • Embodiment 1-62 The rAAV virion of embodiment 1-58, wherein the AAV5 capsid protein comprises T578A and S651A substitutions.
  • Embodiment 1-63 The rAAV virion of embodiment 1-58, wherein the AAV5 capsid protein comprises S651A, T578A, and T582A substitutions.
  • Embodiment 1-64 The rAAV virion of any one of embodiments 1-58 to 1-62, wherein the AAV5 capid protein shares at least 95% identity to SEQ ID NO: 73.
  • Embodiment 1-65 The rAAV virion of any one of embodiments 1-58 to 1-62, wherein the AAV5 capid protein shares at least 98% identity to SEQ ID NO: 73.
  • Embodiment 1-66 The rAAV virion of any one of embodiments 1-58 to 1-62, wherein the AAV5 capid protein shares at least 99% identity to SEQ ID NO: 73.
  • Embodiment 1-67 The rAAV virion of any one of embodiments 1-58 to 1-62, wherein the AAV5 capid protein comprises the polypeptide sequence SEQ ID NO: 73.
  • Embodiment 1-68 An AAV5 capsid protein comprising one or more substitutions selected from S651A, T578A, or T582A compared to a parental AAV5 capsid.
  • Embodiment 1-69 The AAV 5 capsid protein of embodiment 1-67, wherein the capsid protein comprises two or more substitutions selected from S651A, T578A, or T582A.
  • Embodiment 1-70 The AAV 5 capsid protein of embodiment 1-67, wherein the capsid protein comprises T582A and S651A substitutions.
  • Embodiment 1-71 The AAV 5 capsid protein of embodiment 1-68, wherein the capsid protein comprises T578A and T582A substitutions.
  • Embodiment 1-72 The AAV 5 capsid protein of embodiment 1-68, wherein the capsid protein comprises T578A and S651A substitutions.
  • Embodiment 1-73 The AAV5 capsid protein of embodiment 1-68, wherein the capsid protein comprises S651A, T578A, and T582A substitutions.
  • Embodiment 1-74 The AAV5 capsid protein of any one of embodiments 1-68 to 1-73, wherein the capid protein shares at least 90% identity to SEQ ID NO: 73.
  • Embodiment 1-75 The AAV5 capsid protein of any one of embodiments 1-68 to 1-73, wherein the capid protein shares at least 95% identity to SEQ ID NO: 73.
  • Embodiment 1-76 The AAV5 capsid protein of any one of embodiments 1-68 to 1-73, wherein the capid protein shares at least 98% identity to SEQ ID NO: 73.
  • Embodiment 1-77 The AAV5 capsid protein of any one of embodiments 1-68 to 1-73, wherein the capid protein shares at least 99% identity to SEQ ID NO: 73.
  • Embodiment 1-78 A polynucleotide encoding the AAV5 capsid protein of any one of embodiments 1-68 to 1-77.
  • Embodiment 1-79 A pharmaceutical composition comprising the rAAV virion of any one of embodiments 1-58 to 1-67.
  • Embodiment 1-80 A method of transducing a cardiac cell, comprising contacting the cardiac cell with an rAAV virion according to any one of embodiments 1-58 to 1-67, wherein the rAAV virion transduces the cardiac cell.
  • Embodiment 1-81 A method of delivering one or more gene products to a cardiac cell, comprising contacting the cardiac cell with an rAAV virion according to any one of embodiments 1-58 to 1-67, wherein the cardiac cell expresses the gene product.
  • Embodiment 1-82 The method of embodiment 1-81, wherein the one or more gene products comprise a short-hairpin RNA or a microRNA.
  • Embodiment 1-83 The method of embodiment 1-81, wherein the one or more gene products comprising a guide RNA, a Cas protein, and optionally a repair template, wherein the gene products form a functional a CRISPR/Cas system.
  • Embodiment 1-84 The method of embodiment 1-81, wherein the one or more gene products comprise a polypeptide.
  • Embodiment 1-85 The method of embodiment 1-84, wherein the polypeptide is selected from cardiac troponin T; a cardiac sarcomeric protein; b-myosin heavy chain; myosin ventricular essential light chain 1; myosin ventricular regulatory light chain 2; cardiac a-actin; a-tropomyosin; cardiac troponin I ; cardiac myosin binding protein C; four-and-a-half LIM protein 1; titin; 5'-AMP-activated protein kinase subunit gamma-2; troponin I type 3, myosin light chain 2, actin alpha cardiac muscle 1; cardiac LIM protein; caveolin 3 (CAV3); galactosidase alpha (GLA); lysosomal-associated membrane protein 2 (LAMP2); mitochondrial transfer RNA glycine (MTTG); mitochondrial transfer RNA isoleucine (MTTI); mitochondrial transfer RNA lysine (MTTK); mitochondrial transfer RNA glutamine
  • Embodiment 1-86 The method of embodiment 1-81, wherein the one or more gene products comprise one or more reprogramming factors.
  • Embodiment 1-87 The method of embodiment 1-86, wherein the one or more reprogramming factors is one or more polypeptide selected from ASCL1, MYOCD, MEF2C, TBX5, CCNB1, CCND1, CDK1, CDK4, AURKB, OCT4, BAF60C, ESRRG, GATA4, GATA6, HAND2, IRX4, ISLL, MESP1, MESP2, NKX2.5, SRF, TBX20, and ZFPM2.
  • the one or more reprogramming factors is one or more polypeptide selected from ASCL1, MYOCD, MEF2C, TBX5, CCNB1, CCND1, CDK1, CDK4, AURKB, OCT4, BAF60C, ESRRG, GATA4, GATA6, HAND2, IRX4, ISLL, MESP1, MESP2, NKX2.5, SRF, TBX20, and ZFPM2.
  • Embodiment 1-88 The method of any one of embodiments 1-80 to 1-87, wherein the method reprograms the cardiac cell into a cardiac cardiomyocyte.
  • Embodiment 1-89 A method of treating a cardiac pathology in a subject in need thereof, comprising administering a therapeutically effective amount of a pharmaceutical composition according to embodiment 1-79 to the subject, wherein the rAAV virion transduces cardiac tissue.
  • Embodiment 1-89 The method of embodiment 1-89, wherein the rAAV virion is administered by subcutaneous, epicardial, intravenous, intramuscular, intraperitoneal, or intracardiac injection or by intracardiac catheterization.
  • Embodiment 1-90 The method of embodiment 1-89, wherein the rAAV virion is administered by direct intramyocardial injection or transvascular administration.
  • Embodiment 1-91 The method of embodiment 1-89, wherein the rAAV virion is administered by direct intramyocardial injection, antegrade intracoronary injection, retrograde injection, transendomyocardial injection, or molecular cardiac surgery with recirculating delivery (MCARD).
  • iPSC-CMs induced pluripotent stem cell-derived cardiomyocytes
  • hCFs human cardiac fibroblasts
  • a library of cap gene sequences was generated by PCR using primers P 1 (GTCGGCGGGCAGATGGCCACC AACAACCAGGCCNNKNNKNNKNNKNN- KNNKGCCAGCTCCACCACTGCCCCCGCGACCGGCACG) (SEQ ID NO: 6) and P2 (TC- CCCAGCATGAGCGATGCATTTTATTGAGGGTATGCGAC) (SEQ ID NO: 7)
  • ⁇ N A, C, G, or T
  • K G or T ⁇ and cloned into Notl and Nhel linearized pCR-AAV-LIB575 via Gibson assembly (FIG. 2A).
  • FIG. 2B shows the structure of the AAV5 capsid with a black arrow indicating the insertion site indicated on one of the 60 copies of the capsid protein present on the assembled AAV virion. The insertion into the cap gene results in the same polypeptide being inserted in all 60 copies at the equivalent positions (not indicated in figure).
  • Virions at a multiplicity of infection ranging from 50,000 (round 1) to 1,000 (round 3) were mixed in liquid culture medium and applied to iPS-CM cells isolated from a healthy 30- year old male. Cells were incubated for 24 hours at 37°C and 5 % CO2 .
  • DNA was isolated from the iPS-CM cells, amplified by PCR using primers P2 (SEQ ID NO: 7) and P3 (CCATCGACGTCAGACGCGGAAGCTTCGATCAACTACGCAGACAG) (SEQ ID NO: 8), and sequenced using the Oxford NanoPore MinilON according to the manufacturer’s instruction. Sequencing reads for this negative selection step were analyzed (data not shown)
  • Enrichment of reads is a experimental measurement of increased transduction efficiency, as the number of reads for each unique sequence is a correlated for increased transduction efficiency of the rAAV virion containing that insertion sequence.
  • the 500 sequences with highest abundance are provided in Table 2 below.
  • FIG. 5A FIG. 5D
  • 1,000 FIG. 4D
  • Transduction efficiency was measured by counting GFP fluorescent cells using automated digital widefield microscopy with the Cytation 5TM cell imaging multi-mode reader. Representative fluorescent micrographs are shown in (FIG. 4B; parental AAV5 capsid - SEQ ID NO: 1) and (FIG. 4C; AAV5.CR17 capsid - SEQ ID NO: 103).
  • Transduction efficiency of fifteen AAV5 variants in hCF cells (FIG. 4A) was benchmarked against unmodified AAV5 (right most bar). Darker bars represent sequences that resulted in increase transduction efficiency in hCF cells in this experiment.
  • FIG. 5A-5D In iPS-CM cells (FIG. 5A-5D), increased transduction frequency was also observed and in fact the fold enhancement of transduction compared to parental AAV5 was greater than in hCF cells (FIG. 5A and FIG. 5D). Representative fluorescent images are shown for hCFs transduced by either unmodified AAV5 (FIG. 5B) or AAV5.CR23 (FIG. 5C).
  • FIG. 6C The trend in FIG. 6E was less pronounced merely because gating on high GFP+ cells selected a population of cells with high intensity GFP expression.
  • the AAV5.CR17 capsid was then tested in vivo in health and disease animals. Specifically, CD-I® IGS mice sourced from Charles River® (a wild-type background) were split into health and disease groups. The diseased group was subjected to induced myocardial infarction (MI) using the ligation method of Gao et al. Circulation Research (2010) 107: 1445- 1453. 1.2x10 n vg of either AAV5.CAG-GFP or AAV5.CR17.CAG-GFP was injected into the 6-week old CD-I mice via an intramyocardial injection. GFP intensity and distribution was assessed 7 days following an injection. All heart tissue sections were imaged using a 20x objective with equal gain and exposure.
  • MI myocardial infarction
  • Cardiomyocytes and fibroblasts were distinguished by morphology. Increased cardiomyocyte and fibroblast transduction is observed with AAV5.CR17 in both non- MI and MI animals (FIGS. 7E-7F and FIGS. 7G-7H) compared to AAV5 (FIGS. 7A-7B and FIGS. 7C-7D).
  • sequence motifs were generated using all sequence data, or the top sequences after round 3. Briefly, sequence motifs were generated for the top 100 (FIG. 8A), top 50 (FIG. 8B), top 20 (FIG. 8C) sequences in Table 2, as well as for the sequences that were re-tested in vitro in this Example (FIG. 8D). A sequence motif was also generated for all sequences, using the number of reads for each sequence to weight the significance of each amino acid in the motif (FIG. 8E). The sequence motifs suggest that certain amino acids are favored as certain positions in the insertion site.
  • flanking‘A’ residues at the start and end of the insertion are, in some embodiments, replaced with another amino acid, such as a flexible amino acid (G or S), or be absent.
  • G or S flexible amino acid
  • Example 3 Comparative Testing of AAVxl versus Wild-Type AAV5
  • AAVxl (AAVxl) was generated.
  • the capsid sequence was as follows:
  • NSKRWNPEIQYTNNYNDPQFVDFAPDSTGEYRTTRPIGTRYLTRPL, where X A, G, V,
  • hCFs human cardiac fibroblasts
  • AAV5.CAG-GFP or AAVxl T582A + S651A
  • hCFs were infected with AAV5.CAG-GFP or AAVxl (T582A + S651A) at a MOI ranging from 1,000 to 1,000,000. 48 hours after infection, cells were harvested and GFP expression was quantified using flow cytometry. At all tested MOIs, percent transduction (FIG. 10A), GFP expression (FIG. 10B), and relative transduction (FIG. IOC) were increased compared to the wild-type AAV5 capsid.
  • AAVxl vectors to deliver a functional cargo was tested by generating AAV5 and AAVxl vectors comprising an expression cassette encoding myocardin and ASCL1 (MyA).
  • MyA myocardin and ASCL1
  • Strikingly, AAVxl vector performed on average 9-fold better than AAV5 vector, based on transgene and marker expression at day 7 post-infection (shown in Table 3).
  • AAV5 or AAVxl (T582A + S651 A) capsid was used to deliver an expression cassette encoding a GFP reporter in mice using the LAD-ligation mouse model of myocardial infarction (MI), with injection of the AAV vector performed epicardially at the time of injury.
  • MI myocardial infarction
  • a single vector dose of 1.2x 10 11 genome copies (GC) was delivered to the heart of each subject by intracardiac injection. Seven days following injection, animals were sacrificed and their hearts dissociated by enzymatic digestion. Dissociated cells were stained with an endothelial marker (CD31) and fibroblast marker (Thy-1) and sorted using fluorescence activated cell sorting (FACs).
  • CD31 endothelial marker
  • Thy-1 fibroblast marker
  • GFP+, Thy-1+ and CD31- cells were classified as transduced cardiac fibroblasts, while, GFP-, Thy-1+ and CD31- cells were classified as non-transduced cardiac fibroblasts.
  • the number of transduced cells were normalized to AAV5. As shown in FIG. 11, in vivo transduction of cardiac fibroblast cells (CF) was more than 4-fold greater using AAVxl vecotr than AAV5 vector.
  • AAVxl (T582A + S651A) capsid was used to deliver an expression cassette encoding myocardin and ASCL1 (My A).
  • the AAVxl vector was tested in mice using the LAD-ligation mouse model of myocardial infarction (MI), with injection of the AAV vector performed epicardially at the time of injury.
  • MI myocardial infarction
  • a single vector dose of 1.2x 10 11 genome copies (GC) was delivered to the heart of each subject by intracardiac injection.
  • Efficacy was assessed by echocardiography at 2, 4, 6, and 8 weeks post-injection.
  • the AAVxl vector significantly preserved cardiac function (ejection fraction) compared to the GFP-encoding control (FIG. 12).
  • the AAVxl vector was further tested in a pig myocardial infarction (MI) model.
  • MI myocardial infarction
  • MyA was packaged into AAVxl capsid and injected epicardially into the border zone of pig hearts 28 days after a 90-minute balloon occlusion to introduce ischemic injury.
  • infarcted pigs were also injected with formulation buffer, so that each group consisted of ten animals. Echocardiography was performed 3-weeks, 5-weeks, 7-weeks and 9-weeks post-injection. Pigs that received AAVxl vector demonstrated significant improvement in ejection fraction relative to control 5-weeks, 7-weeks and 9-weeks post-injection (FIG. 13).
  • treatment with the an AAVxl vector resulted in an average 10% improvement in cardiac performance above pre-dose baseline.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • Organic Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • General Health & Medical Sciences (AREA)
  • General Engineering & Computer Science (AREA)
  • Biochemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Microbiology (AREA)
  • Virology (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Cardiology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Immunology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Bioinformatics & Computational Biology (AREA)
  • Crystallography & Structural Chemistry (AREA)
  • Epidemiology (AREA)
  • Rheumatology (AREA)
  • Cell Biology (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Peptides Or Proteins (AREA)
PCT/US2020/026009 2019-04-01 2020-03-31 Adeno-associated virus with engineered capsid Ceased WO2020205889A1 (en)

Priority Applications (11)

Application Number Priority Date Filing Date Title
EP20782986.2A EP3947700A4 (en) 2019-04-01 2020-03-31 Adeno-associated virus with engineered capsid
JP2021558819A JP7630176B2 (ja) 2019-04-01 2020-03-31 操作されたカプシドを有するアデノ随伴ウイルス
KR1020217035010A KR20210148232A (ko) 2019-04-01 2020-03-31 조작된 캡시드를 갖는 아데노-연관 바이러스
CA3135609A CA3135609A1 (en) 2019-04-01 2020-03-31 Adeno-associated virus with engineered capsid
CN202080036330.XA CN114450411A (zh) 2019-04-01 2020-03-31 具有工程化衣壳的腺相关病毒
AU2020253435A AU2020253435A1 (en) 2019-04-01 2020-03-31 Adeno-associated virus with engineered capsid
SG11202110607WA SG11202110607WA (en) 2019-04-01 2020-03-31 Adeno-associated virus with engineered capsid
US17/599,750 US20220154217A1 (en) 2019-04-01 2020-03-31 Adeno-associated virus with engineered capsid
IL286831A IL286831A (en) 2019-04-01 2021-09-30 An adeno-associated virus with an engineered capsid
US18/493,663 US12104165B2 (en) 2019-04-01 2023-10-24 Adeno-associated virus with engineered capsid
US18/808,450 US20250051799A1 (en) 2019-04-01 2024-08-19 Adeno-associated virus with engineered capsid

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201962827576P 2019-04-01 2019-04-01
US62/827,576 2019-04-01
US202062984197P 2020-03-02 2020-03-02
US62/984,197 2020-03-02

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US17/599,750 A-371-Of-International US20220154217A1 (en) 2019-04-01 2020-03-31 Adeno-associated virus with engineered capsid
US18/493,663 Continuation US12104165B2 (en) 2019-04-01 2023-10-24 Adeno-associated virus with engineered capsid

Publications (1)

Publication Number Publication Date
WO2020205889A1 true WO2020205889A1 (en) 2020-10-08

Family

ID=72666396

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2020/026009 Ceased WO2020205889A1 (en) 2019-04-01 2020-03-31 Adeno-associated virus with engineered capsid

Country Status (10)

Country Link
US (3) US20220154217A1 (https=)
EP (1) EP3947700A4 (https=)
JP (1) JP7630176B2 (https=)
KR (1) KR20210148232A (https=)
CN (1) CN114450411A (https=)
AU (1) AU2020253435A1 (https=)
CA (1) CA3135609A1 (https=)
IL (1) IL286831A (https=)
SG (1) SG11202110607WA (https=)
WO (1) WO2020205889A1 (https=)

Cited By (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2022076648A1 (en) 2020-10-09 2022-04-14 Tenaya Therapeutics, Inc. Plakophillin-2 gene therapy methods and compositions
WO2023102079A1 (en) * 2021-12-01 2023-06-08 Shape Therapeutics Inc. Functional aav capsids for systemic administration
WO2023108129A1 (en) * 2021-12-10 2023-06-15 Spacecraft Seven, Llc Troponin c (tnnc1) gene therapy using aav vector
US11781156B2 (en) 2020-10-09 2023-10-10 Tenaya Therapeutics, Inc. Plakophillin-2 gene therapy methods and compositions
US11859200B2 (en) 2020-05-13 2024-01-02 Voyager Therapeutics, Inc. AAV capsids with increased tropism to brain tissue
WO2024006741A1 (en) * 2022-06-28 2024-01-04 Voyager Therapeutics, Inc. Aav capsid variants and uses thereof
WO2023230464A3 (en) * 2022-05-23 2024-01-18 New York University A murine model to test the effect of pkp2 mutations on living adult hearts and uses thereof
US20240076691A1 (en) * 2021-03-05 2024-03-07 Joint Stock Company «Biocad» Codon-optimized nucleic acid encoding the fix protein
US12104165B2 (en) 2019-04-01 2024-10-01 Tenaya Therapeutics, Inc. Adeno-associated virus with engineered capsid
US12116385B2 (en) 2021-10-08 2024-10-15 Dyno Therapeutics, Inc. Capsid variants and methods of using the same
EP4192962A4 (en) * 2020-08-05 2025-04-23 Spacecraft Seven, LLC CSRP3 (CYSTEINE-GLYCINE RICH PROTEIN 3) GENE THERAPY
US12296025B2 (en) 2021-11-02 2025-05-13 Voyager Therapeutics, Inc. AAV capsid variants and uses thereof
WO2025147436A1 (en) * 2024-01-03 2025-07-10 Voyager Therapeutics, Inc. Aav capsid variants and uses thereof
US12467046B2 (en) 2018-10-02 2025-11-11 Voyager Therapeutics, Inc. Redirection of tropism of AAV capsids
EP4493702A4 (en) * 2022-03-18 2026-04-01 Univ Florida METHODS AND COMPOSITIONS FOR TREATING TNNT2-RELATED CARDIOMYOPATHY WITH A VIRAL VECTOR
EP4507713A4 (en) * 2022-04-11 2026-04-15 Tenaya Therapeutics Inc PLAKOPHILIN-2 BASED GENE THERAPY TREATMENT METHODS

Families Citing this family (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
RU2751592C2 (ru) * 2019-08-22 2021-07-15 Общество С Ограниченной Ответственностью "Анабион" Выделенный модифицированный белок VP1 капсида аденоассоциированного вируса 5 серотипа (AAV5), капсид и вектор на его основе
WO2021142267A1 (en) 2020-01-08 2021-07-15 Scarpmap Llc Methods and computing system for processing ultrasound image to determine health of subdermal tissue
IL297391A (en) 2020-04-20 2022-12-01 Tenaya Therapeutics Inc An adeno-associated virus with an engineered capsid
TW202237850A (zh) * 2020-12-01 2022-10-01 賓州大學委員會 具有組織特異性靶向基序的新穎構成物及含有其之組成物
WO2025024826A1 (en) * 2023-07-27 2025-01-30 Tenaya Therapeutics, Inc. Adeno-associated virus with engineered capsid

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20050255089A1 (en) * 1998-05-28 2005-11-17 Chiorini John A AAV5 nucleic acids
WO2017201121A1 (en) * 2016-05-17 2017-11-23 University Of Florida Research Foundation, Inc. Recombinant aav for gene therapy in lungs
WO2019060454A2 (en) * 2017-09-20 2019-03-28 4D Molecular Therapeutics Inc. CAPSID VARIANT ADENO-ASSOCIATED VIRUSES AND METHODS OF USE

Family Cites Families (141)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4797368A (en) 1985-03-15 1989-01-10 The United States Of America As Represented By The Department Of Health And Human Services Adeno-associated virus as eukaryotic expression vector
US4683202A (en) 1985-03-28 1987-07-28 Cetus Corporation Process for amplifying nucleic acid sequences
US4683195A (en) 1986-01-30 1987-07-28 Cetus Corporation Process for amplifying, detecting, and/or-cloning nucleic acid sequences
US5139941A (en) 1985-10-31 1992-08-18 University Of Florida Research Foundation, Inc. AAV transduction vectors
US4962091A (en) 1986-05-23 1990-10-09 Syntex (U.S.A.) Inc. Controlled release of macromolecular polypeptides
US7070994B2 (en) 1988-03-21 2006-07-04 Oxford Biomedica (Uk) Ltd. Packaging cells
US5591624A (en) 1988-03-21 1997-01-07 Chiron Viagene, Inc. Retroviral packaging cell lines
CA1339354C (en) 1988-09-01 1997-08-26 The Whitehead Institute For Biomedical Research Recombinant retroviruses with amphotropic and ecotropic host ranges
US5585362A (en) 1989-08-22 1996-12-17 The Regents Of The University Of Michigan Adenovirus vectors for gene therapy
US5817491A (en) 1990-09-21 1998-10-06 The Regents Of The University Of California VSV G pseusdotyped retroviral vectors
JP3534749B2 (ja) 1991-08-20 2004-06-07 アメリカ合衆国 アデノウイルスが介在する胃腸管への遺伝子の輸送
US5252479A (en) 1991-11-08 1993-10-12 Research Corporation Technologies, Inc. Safe vector for gene therapy
FR2688514A1 (fr) 1992-03-16 1993-09-17 Centre Nat Rech Scient Adenovirus recombinants defectifs exprimant des cytokines et medicaments antitumoraux les contenant.
DE4228457A1 (de) 1992-08-27 1994-04-28 Beiersdorf Ag Herstellung von heterodimerem PDGF-AB mit Hilfe eines bicistronischen Vektorsystems in Säugerzellen
CA2145093C (en) 1992-09-25 2007-04-10 Lawrence Leroy Kunz Therapeutic inhibitor of vascular smooth muscle cells
AU680459B2 (en) 1992-12-03 1997-07-31 Genzyme Corporation Gene therapy for cystic fibrosis
US5834256A (en) 1993-06-11 1998-11-10 Cell Genesys, Inc. Method for production of high titer virus and high efficiency retroviral mediated transduction of mammalian cells
ES2249761T3 (es) 1993-06-24 2006-04-01 Advec Inc. Vectores de adenovirus para terapia genica.
EP1637608B1 (en) 1993-10-25 2009-07-22 CANJI, Inc. Recombinant adenoviral vector and methods of use
PT728214E (pt) 1993-11-09 2004-11-30 Ohio Med College Linhas celulares estaveis capazes de expressar o gene de replicacao do virus adeno-associado
FR2722208B1 (fr) 1994-07-05 1996-10-04 Inst Nat Sante Rech Med Nouveau site interne d'entree des ribosomes, vecteur le contenant et utilisation therapeutique
US6013516A (en) 1995-10-06 2000-01-11 The Salk Institute For Biological Studies Vector and method of use for nucleic acid delivery to non-dividing cells
US5928906A (en) 1996-05-09 1999-07-27 Sequenom, Inc. Process for direct sequencing during template amplification
FR2751345B1 (fr) 1996-07-16 1998-09-18 Univ Paris Curie Lignees d'encapsidation hautement productrices
CA2265460A1 (en) 1996-09-11 1998-03-19 The Government Of The United States Of America, Represented By The Secre Tary, Department Of Health And Human Services Aav4 vector and uses thereof
US6306434B1 (en) 1997-02-12 2001-10-23 Chong Kun Dang Corp. Pharmaceutical composition comprising cyclosporin solid-state microemulsion
US6156303A (en) 1997-06-11 2000-12-05 University Of Washington Adeno-associated virus (AAV) isolates and AAV vectors derived therefrom
US5994136A (en) 1997-12-12 1999-11-30 Cell Genesys, Inc. Method and means for producing high titer, safe, recombinant lentivirus vectors
US6984517B1 (en) 1998-05-28 2006-01-10 The United States Of America As Represented By The Department Of Health And Human Services AAV5 vector and uses thereof
CA2349838C (en) 1998-11-05 2011-06-07 The Trustees Of The University Of Pennsylvania Adeno-associated virus serotype 1 nucleic acid sequences, vectors and host cells containing same
US6759237B1 (en) 1998-11-05 2004-07-06 The Trustees Of The University Of Pennsylvania Adeno-associated virus serotype 1 nucleic acid sequences, vectors and host cells containing same
JP3904451B2 (ja) 1999-06-01 2007-04-11 俊雄 北村 パッケージング細胞
PT1916258E (pt) 1999-08-09 2014-07-29 Genzyme Corp Aumento da expressão de uma sequência nucleotídica heteróloga de cadeia simples a partir de vectores virais recombinantes por concepção da sequência de maneira que esta forme pares de bases intracadeia
CA2406743A1 (en) 2000-04-28 2001-11-08 The Trustees Of The University Of Pennsylvania Recombinant aav vectors with aav5 capsids and aav5 vectors pseudotyped in heterologous capsids
NZ522840A (en) 2000-06-01 2004-12-24 Univ North Carolina A parvovirus vector that carries a duplexed genome resulting in co-packaging of strands of plus and minus polarity tethered together
ATE324321T1 (de) 2000-08-31 2006-05-15 Edwin Lundgren Steuervorrichtung für einen lenkdrachen an einem boot
AU2002248297A1 (en) 2001-01-05 2002-07-16 Children's Hospital, Inc. Aav2 vectors and methods
WO2002098432A1 (en) 2001-06-01 2002-12-12 The Brigham And Women's Hospital, Inc. Methods of treating cardiac disorders
WO2003042361A2 (en) 2001-11-09 2003-05-22 Government Of The United States Of America, Department Of Health And Human Services Production of adeno-associated virus in insect cells
NZ532635A (en) 2001-11-13 2007-05-31 Univ Pennsylvania A method of identifying unknown adeno-associated virus (AAV) sequences and a kit for the method
AU2002359284A1 (en) 2001-12-17 2003-06-30 The Trustees Of The University Of Pennsylvania Adeno-associated virus (aav) serotype 9 sequences, vectors containing same, and uses therefor
DK2359869T3 (en) 2001-12-17 2019-04-15 Univ Pennsylvania Sequences of adeno-associated virus (AAV) serotype 8, vectors containing these, and uses thereof
US7091029B2 (en) 2002-09-23 2006-08-15 Applied Genetics Technologies Corporation High titer recombinant AAV production
US7485291B2 (en) 2003-06-03 2009-02-03 Cell Genesys, Inc. Compositions and methods for generating multiple polypeptides from a single vector using a virus derived peptide cleavage site, and uses thereof
SI3235827T1 (sl) 2003-06-19 2021-05-31 Genzyme Corporation AAV virioni z zmanjšano imunoreaktivnostjo in uporaba za ta namen
US9441244B2 (en) 2003-06-30 2016-09-13 The Regents Of The University Of California Mutant adeno-associated virus virions and methods of use thereof
US9233131B2 (en) 2003-06-30 2016-01-12 The Regents Of The University Of California Mutant adeno-associated virus virions and methods of use thereof
CN1856576B (zh) 2003-09-30 2011-05-04 宾夕法尼亚州立大学托管会 腺伴随病毒(aav)进化支、序列、含有这些序列的载体及它们的应用
US7960100B1 (en) 2004-04-30 2011-06-14 Celera Corporation Colon cancer targets and uses thereof
FR2872170B1 (fr) 2004-06-25 2006-11-10 Centre Nat Rech Scient Cnrse Lentivirus non interactif et non replicatif, preparation et utilisations
WO2006110689A2 (en) 2005-04-07 2006-10-19 The Trustees Of The University Of Pennsylvania Method of increasing the function of an aav vector
WO2007078599A2 (en) 2005-12-16 2007-07-12 The Board Of Trustees Of The Leland Stanford Junior University Functional arrays for high throughput characterization of gene expression regulatory elements
US20070161031A1 (en) 2005-12-16 2007-07-12 The Board Of Trustees Of The Leland Stanford Junior University Functional arrays for high throughput characterization of gene expression regulatory elements
US7867484B2 (en) 2006-01-27 2011-01-11 University Of North Carolina At Chapel Hill Heparin and heparan sulfate binding chimeric vectors
WO2008016391A2 (en) 2006-01-31 2008-02-07 The Board Of Trustees Of The Leland Stanford Junior University Self-complementary parvoviral vectors, and methods for making and using the same
EP2520935A3 (en) 2006-08-09 2013-02-13 Homestead Clinical Corporation Organ-specific proteins and methods of their use
ES2385679T3 (es) 2006-08-24 2012-07-30 Virovek, Inc. Expresión de células de insecto de genes con marcos de lectura abiertos superpuestos, métodos y composiciones de éstos
EP3257937B1 (en) 2008-02-19 2022-08-03 uniQure IP B.V. Optimisation of expression of parvoviral rep and cap proteins in insect cells
WO2009126894A2 (en) 2008-04-11 2009-10-15 Massachusetts Eye And Ear Infirmary Methods and compositions for the diagnosis and treatment of angiogenic disorders
US8679837B2 (en) 2009-04-02 2014-03-25 University Of Florida Research Foundation, Inc. Inducible system for highly efficient production of recombinant Adeno-associated virus (rAAV) vectors
JP5879256B2 (ja) 2009-05-02 2016-03-08 ジェンザイム・コーポレーション 神経変性障害のための遺伝子治療
EP2292781A1 (en) 2009-08-17 2011-03-09 Genethon Baculovirus-based production of biopharmaceuticals free of contaminating baculoviral virions
ES2683695T3 (es) 2010-01-12 2018-09-27 The University Of North Carolina At Chapel Hill Repeticiones terminales invertidas restrictivas para vectores virales
JP5988961B2 (ja) 2010-04-28 2016-09-07 ザ ジェイ. デヴィッド グラッドストーン インスティテューツ 心筋細胞を発生させるための方法
JP6208580B2 (ja) 2010-05-17 2017-10-04 サンガモ セラピューティクス, インコーポレイテッド 新規のdna結合タンパク質及びその使用
HRP20171334T1 (hr) 2011-04-22 2017-11-17 The Regents Of The University Of California Virioni adeno-povezanog virusa s kapsid varijantom i postupci njihove upotrebe
WO2013033213A1 (en) 2011-08-30 2013-03-07 The J. David Gladstone Institutes Methods for generating cardiomyocytes
US9441206B2 (en) 2011-10-28 2016-09-13 The University Of North Carolina At Chapel Hill Cell line for production of adeno-associated virus
US9434928B2 (en) 2011-11-23 2016-09-06 Nationwide Children's Hospital, Inc. Recombinant adeno-associated virus delivery of alpha-sarcoglycan polynucleotides
ES2697249T3 (es) 2013-03-11 2019-01-22 Fond Telethon miR-204 y miR-211 y usos de los mismos
US9447433B2 (en) 2013-03-15 2016-09-20 The University Of North Carolina At Chapel Hill Synthetic adeno-associated virus inverted terminal repeats
JP6396988B2 (ja) 2013-03-15 2018-09-26 ザ・ユニヴァーシティ・オヴ・ノース・キャロライナ・アト・チャペル・ヒル 二重グリカン結合性aavベクターのための方法および組成物
US10604771B2 (en) 2013-05-10 2020-03-31 Sangamo Therapeutics, Inc. Delivery methods and compositions for nuclease-mediated genome engineering
EP3039129B1 (en) 2013-08-30 2018-06-27 Amgen Inc. High titer recombinant aav vector production in adherent and suspension cells
EP3043822A1 (en) 2013-09-11 2016-07-20 The J. David Gladstone Institutes, A Testamentary Trust Established under The Will of J. David Gladstone Compositions for preparing cardiomyocytes
EP3043866A4 (en) 2013-09-12 2017-05-17 President and Fellows of Harvard College Methods for inducing glucose uptake
WO2015042581A1 (en) 2013-09-23 2015-03-26 President And Fellows Of Harvard College Allele-specific rna silencing for the treatment of hypertrophic cardiomyopathy
US10144915B2 (en) 2013-10-23 2018-12-04 The J. David Gladstone Institutes, A Testamentary Trust Established Under The Will Of J. David Gladstone Reprogramming fibroblasts into cardiomyocytes
EP3099333B8 (en) 2014-01-31 2020-12-30 Temple University of the Commonwealth System of Higher Education Bag3 as a target for therapy of heart failure
GB201403684D0 (en) 2014-03-03 2014-04-16 King S College London Vector
US9287021B2 (en) * 2014-03-04 2016-03-15 Whirlpool Corporation Shelf brackets to conduct electricity to refrigerator shelves
US11141493B2 (en) 2014-03-10 2021-10-12 Editas Medicine, Inc. Compositions and methods for treating CEP290-associated disease
DK3467111T3 (da) 2014-04-22 2022-03-14 Medizinische Hochschule Hannover LNCRNAS til terapi og diagnose af hjertehypertrofi
US10648000B2 (en) 2015-02-16 2020-05-12 University Of Florida Research Foundation, Incorporated rAAV vector compositions, methods for targeting vascular endothelial cells and use in treatment of type I diabetes
JP6836999B2 (ja) 2015-03-24 2021-03-03 ザ リージェンツ オブ ザ ユニバーシティ オブ カリフォルニアThe Regents Of The University Of California アデノ随伴ウイルス変異体及びその使用方法
JP6960396B2 (ja) 2015-04-07 2021-11-05 ザ ジェイ. デビッド グラッドストーン インスティテューツ、 ア テスタメンタリー トラスト エスタブリッシュド アンダー ザ ウィル オブ ジェイ. デビッド グラッドストーン 分裂終了細胞の細胞分裂を誘発するための方法
EP3286318A2 (en) 2015-04-22 2018-02-28 Mina Therapeutics Limited Sarna compositions and methods of use
US20180296703A1 (en) 2015-08-17 2018-10-18 Temple University Of The Commonwealth System Of Higher Education Bag3 compositions and methods
CN108603176B (zh) 2015-11-01 2022-10-21 格里科贝克有限责任公司 无病毒细胞系及获得其的方法
WO2017083750A1 (en) 2015-11-11 2017-05-18 Intrexon Corporation Compositions and methods for expression of multiple biologically active polypeptides from a single vector for treatment of cardiac conditions and other pathologies
EP3436569A4 (en) 2016-03-30 2019-11-13 The J. David Gladstone Institutes, A Testamentary Trust Established under The Will of J. David Gladstone ADVANCED DIRECT CARDIAL PROGRAMMING
WO2017181162A1 (en) 2016-04-16 2017-10-19 University Of Florida Research Foundation, Incorporated Methods of enhancing biological potency of baculovirus system-produced recombinant adeno-associated virus
EP3452101A2 (en) 2016-05-04 2019-03-13 CureVac AG Rna encoding a therapeutic protein
FI3445773T3 (fi) * 2016-05-13 2023-03-30 4D Molecular Therapeutics Inc Adenoassosioituneen viruksen kapsidimuunnoksia ja niiden käyttömenetelmiä
WO2018005546A1 (en) 2016-06-27 2018-01-04 The J. David Gladstone Institutes, A Testamentary Trust Established Under The Will Of J. David Gladstone Engineered cardiomyocytes and uses thereof
US11566243B2 (en) * 2016-07-18 2023-01-31 Jaan Biotherapeutics Llc Compositions and methods for treatment of cardiac diseases
CN109937258B (zh) 2016-10-21 2023-06-23 味之素株式会社 蛋白质的分泌产生方法
US10550405B2 (en) 2017-03-15 2020-02-04 The University Of North Carolina At Chapel Hill Rational polyploid adeno-associated virus vectors and methods of making and using the same
WO2018222503A1 (en) * 2017-05-31 2018-12-06 The Regents Of The University Of California Adeno-associated virus with variant capsid and methods of use thereof
CN107634856B (zh) 2017-09-18 2020-12-22 金华市智甄通信设备有限公司 一种路由器固件升级方法及系统
US12186369B2 (en) 2017-09-20 2025-01-07 The Regents Of The University Of California Gene therapy strategy to restore electrical and cardiac function, and cardiac structure, in arrhythmogenic right ventricular cardiomyopathy
US12098385B2 (en) 2017-09-20 2024-09-24 The Regents Of The University Of California Gene therapy strategy to restore cardiac electrical and structural function in arrhythmogenic right ventricular cardiomyopathy
CN112543766A (zh) 2018-04-03 2021-03-23 斯特里迪比奥公司 抗体逃避性病毒载体
AU2019258830B2 (en) 2018-04-27 2025-12-18 Universität Heidelberg Modified AAV capsid polypeptides for treatment of muscular diseases
CA3111076A1 (en) 2018-08-30 2020-03-05 Tenaya Therapeutics, Inc. Cardiac cell reprogramming with myocardin and ascl1
US20220088052A1 (en) 2019-01-22 2022-03-24 Koninklijke Nederlandse Akademie Van Wetenschappen Tfap2 inhibition for treating cardiac disease involving fibro-fatty replacement
CA3134429A1 (en) 2019-03-28 2020-10-01 Esteve Pharmaceuticals, S.A. Methods for the manufacture of recombinant viral vectors
CN114450411A (zh) 2019-04-01 2022-05-06 特纳亚治疗股份有限公司 具有工程化衣壳的腺相关病毒
EP3959226A2 (en) 2019-04-26 2022-03-02 Sangamo Therapeutics, Inc. Engineering aav
WO2020223279A1 (en) 2019-04-29 2020-11-05 Voyager Therapeutics, Inc. VECTORIZED ANTIBODIES (vAb) AND USES THEREOF
WO2020236982A1 (en) 2019-05-20 2020-11-26 The Broad Institute, Inc. Aav delivery of nucleobase editors
AU2020299026A1 (en) 2019-07-04 2022-01-20 Children's Medical Research Institute Methods and AAV vectors for in vivo transduction
RU2751592C2 (ru) 2019-08-22 2021-07-15 Общество С Ограниченной Ответственностью "Анабион" Выделенный модифицированный белок VP1 капсида аденоассоциированного вируса 5 серотипа (AAV5), капсид и вектор на его основе
WO2021041473A1 (en) 2019-08-27 2021-03-04 The Trustees Of Columbia University In The City Of New York Engineered exosomes for targeted delivery
KR20220066914A (ko) 2019-09-20 2022-05-24 유씨엘 비즈니스 리미티드 부정맥 유발성 우심실 심근병증의 유전자 요법 조성물 및 치료
US20220403414A1 (en) 2019-10-16 2022-12-22 Wuxi Apptec (Shanghai) Co., Ltd. Novel aav variant
MX2022004771A (es) 2019-10-22 2022-10-07 Applied Genetic Tech Corporation Vectores de virus adeno-asociados (aav) de triple funcion para el tratamiento de enfermedades asociadas a c9orf72.
CA3159964A1 (en) 2019-12-04 2021-06-10 Ac Immune Sa Novel molecules for therapy and diagnosis
AU2020408225A1 (en) 2019-12-20 2022-07-14 Research Institute At Nationwide Children's Hospital Optimized gene therapy for targeting muscle in muscle diseases
WO2021183825A1 (en) 2020-03-12 2021-09-16 California Institute Of Technology Adeno-associated viral capsids with expanded sizes
WO2021187380A1 (ja) 2020-03-16 2021-09-23 国立大学法人大阪大学 不整脈源性心筋症患者由来の多能性幹細胞およびその利用ならびに不整脈源性心筋症治療用医薬
CN116406297A (zh) 2020-08-05 2023-07-07 阿斯克肋匹奥生物制药公司 治疗心脏疾患和充血性心力衰竭以及施用aav载体的方法
JP2023538519A (ja) 2020-08-07 2023-09-08 スペースクラフト セブン リミテッド ライアビリティ カンパニー Aavベクターを使用したプラコフィリン-2(pkp2)遺伝子治療
EP3957650A1 (en) 2020-08-17 2022-02-23 Themis Bioscience GmbH Co-stimulatory 4-1bbl ectodomain polypeptides for immunomodulation
WO2022066898A2 (en) 2020-09-23 2022-03-31 Codiak Biosciences, Inc. Methods of producing extracellular vesicles
US11781156B2 (en) 2020-10-09 2023-10-10 Tenaya Therapeutics, Inc. Plakophillin-2 gene therapy methods and compositions
IL301675A (en) 2020-10-09 2023-05-01 Tenaya Therapeutics Inc Methods and preparations for placophilin-2 gene therapy
IL301255A (en) 2020-10-09 2023-05-01 UCB Biopharma SRL Nucleic acid structures, viral vectors and viral particles
WO2022079082A1 (en) 2020-10-15 2022-04-21 F. Hoffmann-La Roche Ag Nucleic acid constructs for simultaneous gene activation
WO2022098765A1 (en) 2020-11-03 2022-05-12 The Board Of Trustees Of The University Of Illinois Split prime editing platforms
KR20230127221A9 (ko) 2020-12-01 2024-12-06 로카나바이오 인크. Cag 반복 질환을 치료하기 위한 rna 표적화 조성물 및 방법
US20240108751A1 (en) 2020-12-01 2024-04-04 Locanabio, Inc. Rna-targeting compositions and methods for treating myotonic dystrophy type 1
TW202237850A (zh) 2020-12-01 2022-10-01 賓州大學委員會 具有組織特異性靶向基序的新穎構成物及含有其之組成物
WO2022173847A2 (en) 2021-02-09 2022-08-18 Affinia Therapeutics Inc. Recombinant aavs with improved tropism and specificity
KR20230159471A (ko) 2021-03-19 2023-11-21 유씨엘 비즈니스 리미티드 우심실 부정맥성 심근병증의 유전자 치료 조성물 및 치료
AU2022242086A1 (en) 2021-03-26 2023-10-19 Specific Biologics Inc. Targeting oncogentic mutations with dual-cleaving endonuclease
EP4320144A4 (en) 2021-04-05 2025-04-09 Janssen Biotech, Inc. T CELL RECEPTORS CALR AND JAK2
US20240173355A1 (en) 2021-04-05 2024-05-30 The Board Of Trustees Of The Leland Stanford Junior University Gene correction for rag2 deficiency in human stem cells
AR125406A1 (es) 2021-04-23 2023-07-12 Univ Pennsylvania Nuevas composiciones con motivos selectivos para el cerebro y composiciones que las contienen
WO2023200742A2 (en) 2022-04-11 2023-10-19 Tenaya Therapeutics, Inc. Capsids for plakophillin-2 gene therapy
TW202400798A (zh) 2022-04-11 2024-01-01 美商特納亞治療股份有限公司 斑菲素蛋白—2(plakophillin—2)基因療法之治療方法

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20050255089A1 (en) * 1998-05-28 2005-11-17 Chiorini John A AAV5 nucleic acids
WO2017201121A1 (en) * 2016-05-17 2017-11-23 University Of Florida Research Foundation, Inc. Recombinant aav for gene therapy in lungs
WO2019060454A2 (en) * 2017-09-20 2019-03-28 4D Molecular Therapeutics Inc. CAPSID VARIANT ADENO-ASSOCIATED VIRUSES AND METHODS OF USE

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See also references of EP3947700A4 *

Cited By (25)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12467046B2 (en) 2018-10-02 2025-11-11 Voyager Therapeutics, Inc. Redirection of tropism of AAV capsids
US12104165B2 (en) 2019-04-01 2024-10-01 Tenaya Therapeutics, Inc. Adeno-associated virus with engineered capsid
US11859200B2 (en) 2020-05-13 2024-01-02 Voyager Therapeutics, Inc. AAV capsids with increased tropism to brain tissue
US12577588B2 (en) 2020-05-13 2026-03-17 Voyager Therapeutics, Inc. AAV capsids with increased tropism to brain tissue
EP4192962A4 (en) * 2020-08-05 2025-04-23 Spacecraft Seven, LLC CSRP3 (CYSTEINE-GLYCINE RICH PROTEIN 3) GENE THERAPY
US11781156B2 (en) 2020-10-09 2023-10-10 Tenaya Therapeutics, Inc. Plakophillin-2 gene therapy methods and compositions
JP7415042B2 (ja) 2020-10-09 2024-01-16 テナヤ セラピューティクス, インコーポレイテッド プラコフィリン2遺伝子治療の方法および組成物
JP2024041821A (ja) * 2020-10-09 2024-03-27 テナヤ セラピューティクス, インコーポレイテッド プラコフィリン2遺伝子治療の方法および組成物
US12576161B2 (en) 2020-10-09 2026-03-17 Tenaya Therapeutics, Inc. Plakophillin-2 gene therapy methods and compositions
JP2023510649A (ja) * 2020-10-09 2023-03-14 テナヤ セラピューティクス, インコーポレイテッド プラコフィリン2遺伝子治療の方法および組成物
WO2022076648A1 (en) 2020-10-09 2022-04-14 Tenaya Therapeutics, Inc. Plakophillin-2 gene therapy methods and compositions
US20240076691A1 (en) * 2021-03-05 2024-03-07 Joint Stock Company «Biocad» Codon-optimized nucleic acid encoding the fix protein
US12528841B2 (en) 2021-10-08 2026-01-20 Dyno Therapeutics, Inc. Capsid variants and methods of using the same
US12331082B2 (en) 2021-10-08 2025-06-17 Dyno Therapeutics, Inc. Capsid variants and methods of using the same
US12116385B2 (en) 2021-10-08 2024-10-15 Dyno Therapeutics, Inc. Capsid variants and methods of using the same
US12331081B2 (en) 2021-10-08 2025-06-17 Dyno Therapeutics, Inc. Capsid variants and methods of using the same
US12419969B2 (en) 2021-11-02 2025-09-23 Voyager Therapeutics, Inc. AAV capsid variants and uses thereof
US12296025B2 (en) 2021-11-02 2025-05-13 Voyager Therapeutics, Inc. AAV capsid variants and uses thereof
WO2023102079A1 (en) * 2021-12-01 2023-06-08 Shape Therapeutics Inc. Functional aav capsids for systemic administration
WO2023108129A1 (en) * 2021-12-10 2023-06-15 Spacecraft Seven, Llc Troponin c (tnnc1) gene therapy using aav vector
EP4493702A4 (en) * 2022-03-18 2026-04-01 Univ Florida METHODS AND COMPOSITIONS FOR TREATING TNNT2-RELATED CARDIOMYOPATHY WITH A VIRAL VECTOR
EP4507713A4 (en) * 2022-04-11 2026-04-15 Tenaya Therapeutics Inc PLAKOPHILIN-2 BASED GENE THERAPY TREATMENT METHODS
WO2023230464A3 (en) * 2022-05-23 2024-01-18 New York University A murine model to test the effect of pkp2 mutations on living adult hearts and uses thereof
WO2024006741A1 (en) * 2022-06-28 2024-01-04 Voyager Therapeutics, Inc. Aav capsid variants and uses thereof
WO2025147436A1 (en) * 2024-01-03 2025-07-10 Voyager Therapeutics, Inc. Aav capsid variants and uses thereof

Also Published As

Publication number Publication date
EP3947700A4 (en) 2023-01-04
US20250051799A1 (en) 2025-02-13
SG11202110607WA (en) 2021-10-28
US12104165B2 (en) 2024-10-01
JP2022527199A (ja) 2022-05-31
US20240084327A1 (en) 2024-03-14
EP3947700A1 (en) 2022-02-09
JP7630176B2 (ja) 2025-02-17
AU2020253435A1 (en) 2021-11-18
KR20210148232A (ko) 2021-12-07
CN114450411A (zh) 2022-05-06
CA3135609A1 (en) 2020-10-08
IL286831A (en) 2021-12-01
US20220154217A1 (en) 2022-05-19

Similar Documents

Publication Publication Date Title
US12104165B2 (en) Adeno-associated virus with engineered capsid
US12552838B2 (en) Adeno-associated virus with engineered capsid
US20250084385A1 (en) Adeno-associated virus with engineered capsid
US11913012B2 (en) Cardiac cell reprogramming with myocardin and ASCL1
US20250250585A1 (en) Capsids for plakophillin-2 gene therapy
US20230103731A1 (en) Gene vector control by cardiomyocyte-expressed micrornas
IL297437A (en) Anti-hemojuvelin (hjv) antibodies for treating myelofibrosis
US20230137971A1 (en) Cardiac cell reprogramming with micrornas and other factors
WO2025054256A1 (en) Targeting peptides, engineered aav capsid proteins and virions
WO2025024826A1 (en) Adeno-associated virus with engineered capsid
US20260001919A1 (en) Adeno-associated virus with engineered capsid
WO2025250683A1 (en) Adeno-associated virus with engineered capsid
WO2026060182A1 (en) Adeno-associated virus with engineered capsid
HK40073155A (en) Adeno-associated virus with engineered capsid

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 20782986

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3135609

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2021558819

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 286831

Country of ref document: IL

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 20217035010

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2020782986

Country of ref document: EP

Effective date: 20211102

ENP Entry into the national phase

Ref document number: 2020253435

Country of ref document: AU

Date of ref document: 20200331

Kind code of ref document: A