Classifications

• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
  • A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K31/00—Medicinal preparations containing organic active ingredients
  • A61K31/33—Heterocyclic compounds
  • A61K31/335—Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin
  • A61K31/34—Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having five-membered rings with one oxygen as the only ring hetero atom, e.g. isosorbide
  • A61K31/341—Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having five-membered rings with one oxygen as the only ring hetero atom, e.g. isosorbide not condensed with another ring, e.g. ranitidine, furosemide, bufetolol, muscarine
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K31/00—Medicinal preparations containing organic active ingredients
  • A61K31/16—Amides, e.g. hydroxamic acids
  • A61K31/165—Amides, e.g. hydroxamic acids having aromatic rings, e.g. colchicine, atenolol, progabide
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K31/00—Medicinal preparations containing organic active ingredients
  • A61K31/185—Acids; Anhydrides, halides or salts thereof, e.g. sulfur acids, imidic, hydrazonic or hydroximic acids
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K31/00—Medicinal preparations containing organic active ingredients
  • A61K31/70—Carbohydrates; Sugars; Derivatives thereof
  • A61K31/7004—Monosaccharides having only carbon, hydrogen and oxygen atoms
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K31/00—Medicinal preparations containing organic active ingredients
  • A61K31/70—Carbohydrates; Sugars; Derivatives thereof
  • A61K31/7008—Compounds having an amino group directly attached to a carbon atom of the saccharide radical, e.g. D-galactosamine, ranimustine
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K40/00—Cellular immunotherapy
  • A61K40/10—Cellular immunotherapy characterised by the cell type used
  • A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K40/00—Cellular immunotherapy
  • A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
  • A61K40/41—Vertebrate antigens
  • A61K40/42—Cancer antigens
  • A61K40/4271—Melanoma antigens
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P35/00—Antineoplastic agents
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P35/00—Antineoplastic agents
  • A61P35/04—Antineoplastic agents specific for metastasis
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P37/00—Drugs for immunological or allergic disorders
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
  • A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
  • A61K2239/57—Skin; melanoma

Definitions

• the present disclosure relates generally to compositions and methods for treating cancer and inflammatory diseases such as autoimmune diseases.
• Treg cells express high levels of the glucocorticoid-induced tumor necrosis factor-related receptor (GITR), while resting T cells express low levels that are increased upon activation. Modulation of GITR/GITR-Ligand (GITRL) interactions results in enhancement of immune responses. There is a need in the art for agents that modulate GITR/GITRL so as to treat cancer or autoimmune diseases.
• GITR glucocorticoid-induced tumor necrosis factor-related receptor
• GITR/GITRL is a member of Tumor necrosis factor receptor superfamily (TNFRSF), TNFRSF18. It is also referred as Activation-Inducible TNFRSF (AITR).
• TNFRSF Tumor necrosis factor receptor superfamily
• AITR Activation-Inducible TNFRSF
• Cancer immunotherapy is a new tool in the fight against cancer progression. While immune suppression at the tumor site is contributed by various stromal cells such macrophages, cancer-associated fibroblasts, checkpoint mediated T-cell suppression has been identified as potential therapeutic targets.
• Checkpoint molecules are PD-l, 0X40, CTLA-4 and GITR.
• antibody-based therapeutics targeted these checkpoint molecules are used in clinic except molecules targeting GITR, a major regulator of Foxp3+ T regulatory (Treg) cells.
• Cancer-associated immuno-suppressive elements are responsible for poor clinical responses to current cancer treatments.
• Immuno-suppressive T cells in particular, play a dominant role in the poor clinical responses.
• Agents targeting these T cell populations commonly referred as“Check point inhibitors” has revolutionized cancer immunotherapy. In this category, antibody to PD-l and CTLA-4 have shown success.
• the response rate (RR) to PD-l or PD-L1 antibody remains at about 15%— 30% as a single agent, and many patients who received anti-PD-l or anti-PD-Ll therapy are at risk of developing immune-related adverse effects (IRAEs) such as Crohn’s disease, lupus erythematosus, and rheumatoid arthritis (Rosenberg et al., 2016).
• IIRAEs immune-related adverse effects
• Glucocorticoid-induced TNR family related protein Ligand is a T-cell cytokine that co-stimulates Teffector (Teff) cells through GITR receptor and neutralizes suppressive activity of T regulatory (Treg) cells and seems to inhibit Loxp3 expression.
• GITR receptor complex Due its central role in regulating Treg, GITR receptor complex is considered an optimal therapeutic target for treating autoimmunity and cancer. Indeed, recently, an anti-GITR antibody, MK-4166 has been shown to eradicate established melanoma and colon tumors in preclinical mouse models (Mahne et al. 2017).
• GITR receptor and its ligand belong to the TNF/TNFR super family, which has been extensively studied.
• GITR is constitutively expressed at high levels on CD4+CD25+ regulatory T cell and activated T cells.
• GITR ligand (GITRL) is constitutively expressed on anti gen -present ng cells.
• Signaling through GITR can either boost Treg suppression or reduce Treg suppression leading to either diminished T-effecior cells or enhanced ability of T effector cells to recognize and respond to self-antigens, for example eancer/tumor cells.
• Pharmacological manipulation of GITR signaling may have potential application for anti tumor treatment and autoimmunity
• Ri is hydrogen or an optionally substituted substituent
• R 2 is hydrogen or an optionally substituted substituent
• R 3 is hydrogen or an optionally substituted substituent
• R 4 is hydrogen or an optionally substituted substituent
• R5 is hydrogen or an optionally substituted substituent
• Re is hydrogen or an optionally substituted substituent
• R 7 is hydrogen or an optionally substituted substituent
• R is hydrogen or an optionally substituted substituent
• Ri, R 2 , R3, R4, Rs, R 6 , R 7 , or Rs may be joined together to form one or more rings.
• R 9 is hydrogen or an optionally substituted substituent
• R 11 is hydrogen or an optionally substituted substituent
• R 12 is hydrogen or an optionally substituted substituent
• R 13 is hydrogen or an optionally substituted substituent
• R 14 is hydrogen or an optionally substituted substituent
• R 15 is hydrogen or an optionally substituted substituent
• Ri 6 is hydrogen or an optionally substituted substituent
• R 9 , Rio, R 11 , R 12 , R 13 , R 14 , R 15 , or R1 ⁇ 2 may be joined together to form one or more rings.
• GITR antagonists selected from any one or more of the compounds having the structure described in Formula II.
• compositions comprising the GITR antagonists as described herein.
• methods for using the GITR antagonists for treating inflammatory diseases, in particular, autoimmune diseases in a subject by administering to the subject a therapeutically effective amount of the compositions comprising the GITR antagonists.
• the methods further comprise administering existing therapies for autoimmune diseases to the subject.
• the compositions comprising the GITR antagonists and the existing therapies are co-administered or sequentially.
• GITR agonists selected from any one or more of the compounds having the structure described in Formula I.
• GITR agonists selected from any one or more or all of SEQ ID NO: 1, and/or SEQ ID NO: 2, or a variant, derivative or functional equivalent thereof.
• compositions comprising GITR agonists described herein.
• methods for using the GITR agonists for treating cancer in a subject by administering a therapeutically effective amount of the compositions comprising GITR agonists.
• the methods further comprise administering existing therapies for cancer to the subject.
• the compositions comprising the GITR agonists and the existing therapies are administered sequentially or simultaneously.
• the present invention is directed to a method for treating cancer in a subject in need thereof comprising administering to the subject a therapeutically effective amount of a GITR/GITRL agonist as described herein.
• the GITR/GITRL agonist may be co-administered with existing therapies for cancer to the subject or sequentially administered.
• the cancer may be T-cell/B-cell lymphomas (Hodgkin’s lymphomas and/or non-Hodgkins lymphomas), brain tumor, breast cancer, colon cancer, lung cancer, hepatocellular cancer, gastric cancer, pancreatic cancer, cervical cancer, ovarian cancer, liver cancer, bladder cancer, cancer of the urinary tract, thyroid cancer, renal cancer, carcinoma, skin cancer such as melanoma, head and neck cancer, brain cancer, and prostate cancer, androgen-dependent prostate cancer or androgen-independent prostate cancer.
• T-cell/B-cell lymphomas Hodgkin’s lymphomas and/or non-Hodgkins lymphomas
• brain tumor breast cancer, colon cancer, lung cancer, hepatocellular cancer, gastric cancer, pancreatic cancer, cervical cancer, ovarian cancer, liver cancer, bladder cancer, cancer of the urinary tract, thyroid cancer, renal
• the invention is directed to treating cancer in a subject in need thereof comprising administering to the subject a therapeutically effective amount of a sample of T-eff cells that have been enriched or expanded, wherein the T-eff cells are enriched or expanded by contacting the T-eff cells with a GITR/GITRL agonist described herein with or without the presence of T-reg cells.
• the T-eff or T-reg cells may be autologous or allogeneic relative to the subject.
• the invention is directed to a method of enriching or expanding T- eff cells comprising contacting T-eff cells with a GITR/GITRL agonist described herein with or without the presence of T-reg cells.
• T-reg cells are present.
• the T-eff and T-reg cells may be present in a starting ratio of about 1:1.
• the invention is directed to a method for treating an inflammatory disease in a subject in need thereof comprising administering to the subject a therapeutically effective amount of a GITR/GITRL antagonist described herein.
• the inflammatory disease may be autoimmune disease.
• the GITR/GITRL antagonist may be co-administered with existing therapies for inflammatory disease to the subject or sequentially administered.
• the autoimmune disease may be rheumatoid arthritis, osteoarthritis, asthma, dermatitis, psoriasis, cystic fibrosis, post transplantation late and chronic solid organ rejection, multiple sclerosis, systemic lupus erythematosus, Sjogren's syndrome, Hashimoto thyroiditis, polymyositis, scleroderma, Addison disease, vitiligo, pernicious anemia, glomerulonephritis and pulmonary fibrosis, inflammatory bowel diseases, autoimmune diabetes, diabetic retinopathy, rhinitis, ischemia-reperfusion injury, post- angioplasty restenosis, chronic obstructive pulmonary diseases (COPD), Grave's disease, gastrointestinal allergies, conjunctivitis, atherosclerosis, coronary artery disease, angina
• the invention is directed to a method for treating inflammatory disease in a subject in need thereof comprising administering to the subject a therapeutically effective amount of GITR/GITRL antagonist described herein by either in vivo or by administering engineered T cells that have been enriched or expanded for T-reg in vivo or ex vivo , wherein the T-reg cells are enriched or expanded and T-eff cells are modified by contacting the T-eff cells with a GITR/GITRL antagonist with or without the presence of T-reg cells.
• the T-eff or T-reg cells may be autologous or allogeneic relative to the subject.
• the invention is directed to a method of enriching or expanding T- reg cells comprising contacting T cells with a GITR/GITRL antagonist with or without the presence of T-eff cells.
• the T-reg cells are initially present.
• the T-eff and T-reg cells may be present in a starting ratio of about 1:1.
• FIGS. 1A-1B show the results of where PBMC was isolated (Ficoll, GE Healthcare) from the WBC cone collected from healthy platelet donor. Cells were washed and passed through 40um cell strainer before being stained with T cell surface antibodies. Then cells were put on cell sorter (BD FACSARIA III). Specific cell populations were collected as follows: CD4 + CD25 cells (T effector cells), CD4 + CD25 + CD45RA + CD127 cells (T regulatory cells) and CD3 cells (serve as Antigen Presenting Cells, APC). T effector cells were labeled with CellTrace CFSE (Invitrogen), heavily washed before cell number counting.
• PBMC was isolated (Ficoll, GE Healthcare) from the WBC cone collected from healthy platelet donor. Cells were washed and passed through 40um cell strainer before being stained with T cell surface antibodies. Then cells were put on cell sorter (BD FACSARIA III). Specific cell populations were collected as follows: CD4 + CD25 cells (T effector cells), CD4 + CD
• Effector cells and T- regs were then mixed together at 1: 1 ratio in culture media (RPMI 1640, lO%FBS, Pen-Strep and 1% NEAA) which enhanced with anti-CD3 (3ug/ml) anti-CD28 (2ug/ml) antibodies.
• APCs were treated with Mitomycin (50ug/ml) for 30 minutes at 37 °C, 5% C0 2 incubator, then added to culture mix (APC:T-eff 2: 1) as a proliferation co-stimulator.
• Cell mixture was incubated at 37 °C, 5% C0 2 for 6 days before being re-stained with T cell surface markers (CD4, CD25) and sent for FACS analysis.
• A T-eff fully stimulated
• B T-eff fully stimulated + T-reg (1: 1).
• FIGS. 2A-2C show FACS analysis for (A) T-eff fully stimulated + 11702 (5ul); (B) T- eff fully stimulated + 11702 (25ul); (C) T-eff fully stimulated + 11702 (50ul).
• FIGS. 2D-2F show FACS analysis for (A) T-eff fully stimulated + 11702 (5ul) + T-reg; (B) T-eff fully stimulated + 11702 (25ul) + T-reg; (C) T-eff fully stimulated + 11702 (50ul) + T- reg.
• FIGS. 3A-3C show FACS analysis for (A) T-eff fully stimulated + 11704 (5ul); (B) T- eff fully stimulated + 11704 (25ul); (C) T-eff fully stimulated + 11704 (50ul).
• FIGS. 3D-3F show FACS analysis for (A) T-eff fully stimulated + 11704 (5ul) + T- reg; (B) T-eff fully stimulated + 11704 (25ul) + T-reg; (C) T-eff fully stimulated + 11704 (50ul) + T-reg.
• FIG. 4 shows summary table of the effects of the agonist and antagonist compounds and the effect on T Cell effector proliferation change.
• PBMC was isolated and specific human T cell populations were collected as follows: CD4 + CD25 cells (T effector cells), CD4 + CD25 + CD45RA + CDl27 cells (T regulatory cells) and CD3 cells (serve as Antigen Presenting Cells, APC).
• T effector cells were labeled with CellTrace CFSE and effector cells and T-regs were then mixed together at 1: 1 ratio in culture media (RPMI 1640, l0%FBS, Pen-Strep and 1% NEAA) which enhanced with anti-CD3 (3ug/ml) anti-CD28 (2ug/ml) antibodies.
• FIG. 5 shows summary graph setting for the Table of Fig. 4.
• FIGS. 6A-6C show that GITR agonist 11702 inhibits melanoma growth through T- eff proliferation and T-reg inhibition in the tumor.
• C57 BL mice underwent treatment with 11702 GITR agonist or DMSO control.
• B Tumor volume was inhibited in 11702 treated animals (p ⁇ 0.05, Anova).
• C FACs analysis of tumor infiltrating lymphocytes demonstrated the increased presence of activated CD4+ cells and increased effector memory cytotoxic CD8+ T cells. Both of these groups showed increased PD-l expression suggesting increased IFN gamma induced upregulation of PD-l and invoking the potential synergy of this agent with PD-l checkpoint blockade.
• RMGL171102 As used herein, "RMGL171102”, “RMGL171103” and “RMGL171104" are interchangeably referred to as compound 11702, 11703 and 11704, respectively.
• cell therapy is also considered as ex vivo therapy, in that cells are grown or treated outside of the body and are then returned to the patient by injection or transplantation.
• the treated cells may be autologous or allogeneic relative to the patient.
• the term “comprising” or “comprises” is used in reference to compositions, methods, and respective component(s) thereof, that are useful to an embodiment, yet open to the inclusion of unspecified elements, whether useful or not. It will be understood by those within the art that, in general, terms used herein are generally intended as“open” terms (e.g., the term“including” should be interpreted as“including but not limited to,” the term “having” should be interpreted as“having at least,” the term“includes” should be interpreted as “includes but is not limited to,” etc.).
• the term“agent” or“agents” means any one or more of a protein, peptide, peptidomimetic, compound, chemical compound, small molecule, organic compound, inorganic compound, antisense compound, antibody, protease inhibitor, hormone, chemokine, cytokine, or compound of the invention as described herein, or other molecule of interest.
• the agent is a GITR agonist (for example, peptides having the sequence set forth in SEQ ID NO: 1 or SEQ ID NO: 2, or agents having the structure of Formula I, in particular compound named RMGL171102 (aka compound 11702).
• the agent is a GITR antagonist (for example, agents having the structure of Formula II).
• the agent is a GITR antagonist named RMGL171104 (aka compound 11704).
• the terms“treat,”“treatment,”“treating,” or“amelioration” when used in reference to a disease, disorder or medical condition refer to both therapeutic treatment and prophylactic or preventative measures, wherein the object is to prevent, reverse, alleviate, ameliorate, inhibit, lessen, slow down or stop the progression or severity of a symptom or condition.
• the term“treating” includes reducing or alleviating at least one adverse effect or symptom of a condition. Treatment is generally“effective” if one or more symptoms or clinical markers are reduced. Alternatively, treatment is“effective” if the progression of a disease, disorder or medical condition is reduced or halted.
• “treatment” includes not just the improvement of symptoms or markers, but also a cessation or at least slowing of progress or worsening of symptoms that would be expected in the absence of treatment. Also,“treatment” may mean to pursue or obtain beneficial results, or lower the chances of the individual developing the condition even if the treatment is ultimately unsuccessful. Those in need of treatment include those already with the condition as well as those prone to have the condition or those in whom the condition is to be prevented.
• a therapeutic that“prevents” a disorder or condition refers to a compound that, in a statistical sample, reduces the occurrence of the disorder or condition in the treated sample relative to an untreated control sample, or delays the onset or reduces the severity of one or more symptoms of the disorder or condition relative to the untreated control sample.
• “decrease”,“reduced”,“reduction”, or“inhibit” are all used herein to mean a decrease or lessening of a property, level, or other parameter by a statistically significant amount.
• “reduce,”“reduction” or“decrease” or“inhibit” typically means a decrease by at least 10% as compared to a reference level (e.g., the absence of a given treatment) and can include, for example, a decrease by at least about 10%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99% , or more.
• “reduction” or “inhibition” does not encompass a complete inhibition or reduction as compared to a reference level. “Complete inhibition” is a 100% inhibition as compared to a reference level. A decrease can be preferably down to a level accepted as within the range of normal for an individual without a given disorder.
• the terms“increased” /‘increase” or“enhance” or“activate” are all used herein to generally mean an increase of a property, level, or other parameter by a statically significant amount; for the avoidance of any doubt, the terms“increased”,“increase” or“enhance” or “activate” means an increase of at least 10% as compared to a reference level, for example an increase of at least about 20%, or at least about 30%, or at least about 40%, or at least about 50%, or at least about 60%, or at least about 70%, or at least about 80%, or at least about 90% or up to and including a 100% increase or any increase between 10-100% as compared to a reference level, or at least about a 2-fold, or at least about a 3 -fold, or at least about a 4-fold, or at least about a 5-fold or at least about a 10-fold increase, at least about a 20-fold increase, at least about a 50-fold increase, at least about a lOO-
• A“cancer” or“tumor” as used herein refers to an uncontrolled growth of cells which interferes with the normal functioning of the bodily organs and systems.
• a subject that has a cancer or a tumor is a subject having objectively measurable cancer cells present in the subject's body. Included in this definition are benign and malignant cancers, as well as dormant tumors or micrometastatses. Cancers which migrate from their original location and seed vital organs can eventually lead to the death of the subject through the functional deterioration of the affected organs.
• cancer examples include, but are not limited to B-cell lymphomas (Hodgkin’s lymphomas and/or non-Hodgkins lymphomas), brain tumor, breast cancer, colon cancer, lung cancer, hepatocellular cancer, gastric cancer, pancreatic cancer, cervical cancer, ovarian cancer, liver cancer, bladder cancer, cancer of the urinary tract, thyroid cancer, renal cancer, carcinoma, melanoma, head and neck cancer, brain cancer, and prostate cancer, including but not limited to androgen-dependent prostate cancer and androgen-independent prostate cancer.
• B-cell lymphomas Hodgkin’s lymphomas and/or non-Hodgkins lymphomas
• brain tumor breast cancer
• colon cancer lung cancer
• gastric cancer pancreatic cancer
• cervical cancer ovarian cancer
• liver cancer bladder cancer
• cancer of the urinary tract thyroid cancer
• renal cancer carcinoma
• melanoma head and neck cancer
• brain cancer and prostate cancer, including but not limited to androgen-dependent prostate cancer and androgen-independent prostate cancer
• the term "effective amount” or “therapeutically effective amount” as used herein refers to the amount of one or more GITR agonists or GITR antagonists, or amount of pharmaceutical compositions comprising one or more GITR agonists or GITR antagonists as disclosed herein, to decrease at least one or more symptom of the disease or disorder, and relates to a sufficient amount of the pharmacological composition to provide the desired effect.
• the phrase "therapeutically effective amount” as used herein means a sufficient amount of the composition to treat a disorder, at a reasonable benefit/risk ratio applicable to any medical treatment.
• “Peptidomimetic” as used herein is a small protein-like chain designed to mimic a protein function. They may be modifications of an existing peptide or newly designed to mimic known peptides. They may be, for example peptoids and/or b-peptides and/or D-peptides.
• Recombinant virus refers to a virus that has been genetically altered (e.g., by the addition or insertion) of a heterologous nucleic acid construct into the particle.
• a " gene” or “coding sequence” or a sequence which "encodes” a particular protein or peptide is a nucleic acid molecule that is transcribed (in the case of DNA) and translated (in the case of mRNA) into a polypeptide in vitro or in vivo when placed under the control of appropriate regulatory sequences.
• the boundaries of the gene are determined by a start codon at the 5' (i.e., amino) terminus and a translation stop codon at the 3' (i.e., carboxy) terminus.
• a gene can include, but is not limited to, cDNA from prokaryotic or eukaryotic mRNA, genomic DNA sequences from prokaryotic or eukaryotic DNA, and even synthetic DNA sequences.
• a transcription termination sequence will usually be located 3' to the gene sequence.
• control elements refers collectively to promoter regions, polyadenylation signals, transcription termination sequences, upstream regulatory domains, origins of replication, internal ribosome entry sites ("IRES"), enhancers, and the like, which collectively provide for the replication, transcription and translation of a coding sequence in a recipient cell. Not all of these control elements need always be present, so long as the selected coding sequence is capable of being replicated, transcribed and translated in an appropriate host cell.
• promoter region is used herein in its ordinary sense to refer to a nucleotide region including a DNA regulatory sequence, wherein the regulatory sequence is derived from a gene which is capable of binding RNA polymerase and initiating transcription of a downstream (3 '-direction) coding sequence.
• "Operably linked” refers to an arrangement of elements wherein the components so described are configured so as to perform their usual function. Thus, control elements operably linked to a coding sequence are capable of effecting the expression of the coding sequence. The control elements need not be contiguous with the coding sequence, so long as they function to direct the expression thereof. Thus, for example, intervening untranslated yet transcribed sequences can be present between a promoter sequence and the coding sequence and the promoter sequence can still be considered “operably linked" to the coding sequence.
• Gene transfer refers to methods or systems for reliably inserting foreign DNA into host cells. Such methods can result in transient expression of non-integrated transferred DNA, extrachromosomal replication and expression of transferred replicons (e.g., episomes), or integration of transferred genetic material into the genomic DNA of host cells.
• Gene transfer provides a unique approach for the treatment of acquired and inherited diseases. A number of systems have been developed for gene transfer into mammalian cells. See, e.g., U.S. Pat. No. 5,399,346. Examples of well-known vehicles for gene transfer include adenovirus and recombinant adenovirus (RAd), adeno-associated virus (AAV), herpes simplex virus type 1 (HSV-l), and lentivirus (LV).
• RAd adenovirus and recombinant adenovirus
• AAV adeno-associated virus
• HSV-l herpes simplex virus type 1
• LV lentivirus
• Genetically modified cells refer to cells that express the polynucleotide encoding polypeptides having the sequence of any one or more of SEQ ID NO: 1 or SEQ ID NO: 2 or a variant, derivative, pharmaceutical equivalent, peptidomimetic or an analog thereof.
• naked DNA refers to DNA encoding a polypeptide having the sequence of any one or more of SEQ ID NO: 1 or SEQ ID NO: 2 or a variant, derivative, pharmaceutical equivalent, peptidomimetic or an analog thereof, cloned in a suitable expression vector in proper orientation for expression.
• Viral vectors which may be used include but are not limited SIN lentiviral vectors, retroviral vectors, foamy virus vectors, adeno-associated virus (AAV) vectors, hybrid vectors and/or plasmid transposons (for example sleeping beauty transposon system) or integrase-based vector systems.
• Polynucleotide as used herein includes but is not limited to DNA, RNA, cDNA (complementary DNA), mRNA (messenger RNA), rRNA (ribosomal RNA), shRNA (small hairpin RNA), snRNA (small nuclear RNA), snoRNA (short nucleolar RNA), miRNA (microRNA), genomic DNA, synthetic DNA, synthetic RNA, and/or tRNA.
• transfection is used herein to refer to the uptake of foreign DNA by a cell.
• a cell has been "transfected” when exogenous DNA has been introduced inside the cell membrane.
• transfection techniques are generally known in the art. See, e.g., Graham et al. Virology, 52:456 (1973); Sambrook et al. Molecular Cloning, a laboratory manual, Cold Spring Harbor Laboratories, New York (1989); Davis et al., Basic Methods in Molecular Biology, Elsevier (1986), and Chu et al. Gene 13:197 (1981).
• Such techniques can be used to introduce one or more exogenous DNA moieties, such as a plasmid vector and other nucleic acid molecules, into suitable host cells.
• the term refers to both stable and transient uptake of the genetic material.
• Vector refers to the vehicle by which a polynucleotide sequence (e.g. a foreign gene) can be introduced into a host cell, so as to transform the host and promote expression (e.g. transcription and translation) of the introduced sequence.
• Vectors include plasmids, phages, viruses, etc.
• “Beneficial results” or“desired results” may include, but are in no way limited to, lessening or alleviating the severity of the disease condition, preventing the disease condition from worsening, curing the disease condition, preventing the disease condition from developing, lowering the chances of a patient developing the disease condition, decreasing morbidity and mortality, and prolonging a patient’s life or life expectancy.
• “beneficial results” or “desired results” may be alleviation of one or more symptom(s), diminishment of extent of the deficit, stabilized (i.e., not worsening) state of cancer, delay or slowing of cancer, and amelioration or palliation of symptoms associated with cancer.
• Diseases may include, but are in no way limited to any form of cancer or autoimmune diseases.
• administering refers to the placement of an agent or a composition as disclosed herein into a subject by a method or route which results in at least partial localization of the agents or composition at a desired site.
• “Route of administration” may refer to any administration pathway known in the art, including but not limited to oral, topical, aerosol, nasal, via inhalation, anal, intra-anal, peri-anal, transmucosal, transdermal, parenteral, enteral, or local.
• Parenteral refers to a route of administration that is generally associated with injection, including intratumoral, intracranial, intraventricular, intrathecal, epidural, intradural, intraorbital, infusion, intracapsular, intracardiac, intradermal, intramuscular, intraperitoneal, intrapulmonary, intraspinal, intrastemal, intrathecal, intravascular, intravenous, intraarterial, subarachnoid, subcapsular, subcutaneous, transmucosal, or transtracheal.
• the agent or composition may be in the form of solutions or suspensions for infusion or for injection, or as lyophilized powders.
• the agent or composition can be in the form of capsules, gel capsules, tablets, sugar-coated tablets, syrups, suspensions, solutions, powders, granules, emulsions, microspheres or nanospheres or lipid vesicles or polymer vesicles allowing controlled release.
• the agent or composition can be in the form of aerosol, lotion, cream, gel, ointment, suspensions, solutions or emulsions.
• agent or composition may be provided in a powder form and mixed with a liquid, such as water, to form a beverage.
• “administering” can be self- administering. For example, it is considered as“administering” that a subject consumes a composition as disclosed herein.
• a“subject” means a human or animal. Usually the animal is a vertebrate such as a primate, rodent, domestic animal or game animal. Primates include chimpanzees, cynomologous monkeys, spider monkeys, and macaques, e.g., Rhesus. Rodents include mice, rats, woodchucks, ferrets, rabbits and hamsters. Domestic and game animals include cows, horses, pigs, deer, bison, buffalo, feline species, e.g., domestic cat, and canine species, e.g., dog, fox, wolf. The terms, “patient”, “individual” and “subject” are used interchangeably herein.
• the subject is mammal.
• the mammal can be a human, non-human primate, mouse, rat, dog, cat, horse, or cow, but are not limited to these examples.
• the methods described herein can be used to treat domesticated animals and/or pets.
• the subject is a human.
• “Mammal” as used herein refers to any member of the class Mammalia, including, without limitation, humans and nonhuman primates such as chimpanzees and other apes and monkey species; farm animals such as cattle, sheep, pigs, goats and horses; domestic mammals such as dogs and cats; laboratory animals including rodents such as mice, rats and guinea pigs, and the like.
• the term does not denote a particular age. Thus, adult and newborn subjects, as well as fetuses, are intended to be included within the scope of this term.
• a subject can be one who has been previously diagnosed with or identified as suffering from or having a condition in need of treatment (e.g., cancer or autoimmune diseases) or one or more complications related to the condition, and optionally, have already undergone treatment for the condition or the one or more complications related to the condition.
• a subject can also be one who has not been previously diagnosed as having a condition or one or more complications related to the condition.
• a subject can be one who exhibits one or more risk factors for a condition or one or more complications related to the condition or a subject who does not exhibit risk factors.
• a subject can be one who exhibits one or more symptoms for a condition or one or more complications related to the condition or a subject who does not exhibit symptoms.
• A“subject in need” of diagnosis or treatment for a particular condition can be a subject suspected of having that condition, diagnosed as having that condition, already treated or being treated for that condition, not treated for that condition, or at risk of developing that condition.
• At risk of is intended to mean at increased risk of, compared to a normal subject, or compared to a control group, e.g. a patient population.
• a subject carrying a particular marker may have an increased risk for a specific disease or disorder, and be identified as needing further testing.
• Increased risk or “elevated risk” mean any statistically significant increase in the probability, e.g., that the subject has the disorder.
• the risk is preferably increased by at least 10%, more preferably at least 20%, and even more preferably at least 50% over the control group with which the comparison is being made.
• Immunosuppressive Drug includes any agent or compound having the ability to decrease the body's immune system responses.
• the immunosuppressive drug is a corticosteroid.
• the immunosuppressive drug is a small molecule (such as cyclosporine) or a monoclonal antibody (such as a cytokine blocker).
• NSAID Non-Steroidal Anti-Inflammatory Drug
• NSAIDS examples include ibuprofen, ketoprofen, piroxicam, naproxen, sulindac, aspirin, choline subsalicylate, diflunisal, fenoprofen, indomethacin, meclofenamate, salsalate, tolmetin and magnesium salicylate.
• the term“statistically significant” or“significantly” refers to statistical significance and generally means at least two standard deviation (2SD) away from a reference level.
• the term refers to statistical evidence that there is a difference. It is defined as the probability of making a decision to reject the null hypothesis when the null hypothesis is actually true.
• the term“co-administer” refers to administration of two or more therapies or two or more therapeutic agents (e.g., GITR agonist and additional anti-cancer therapies; or GITR antagonists and anti- autoimmune diseases therapies) within a 24 hour period of each other, for example, as part of a clinical treatment regimen.
• “co administer” refers to administration within 12 hours, within 6 hours, within 5 hours, within 4 hours, within 3 hours, within 2 hours, within 1 hour, within 45, within 30 minutes, within 20, within 15 minutes, within 10 minutes, or within 5 minutes of each other.
• “co-administer” refers to administration at the same time, either as part of a single formulation or as multiple formulations that are administered by the same or different routes.
• routes of administration can be same or different.
• routes of administration can be same or different.
• the invention is directed to a compound that binds to a Glucocorticoid-induced receptor ligand (GITRF) that binds at the interface of oligomers.
• GITRF Glucocorticoid-induced receptor ligand
• the amino acid residues that are located at the interface of GITRF-oligomers have been described by Zhou et al (PNAS, 2008) with an affinity of 1000 nM or greater, preferably 100 nM or greater, and more preferably of 10 nM or greater.
• the invention is directed to one of the aforementioned compounds, or a compound different from the aforementioned compounds, that exhibits an affinity for wild type GITRL that is at least about 10-fold greater than the affinity the compound exhibits for human GITRL binds to more than one of an amino acid selected from the group consisting of L42, L44, M71, 172, Q73, T74, K80, 181, Q82, N83, G86, T87, Y88, G114, 1116, L118, N120, P121, Q122, F123, 1124 and S 125 of wild type GITRL sequence as below.
• MTLHPS PIT CEFLF S T ALIS PKMCLS HLENMPLS HS RT QG AQRS S WKLWLFCS I VMLLFLC S FS WLIFIFLQLET AKEPCM AKF GPLPS KW QM AS S EPPC VNKV S D WKLEILQN GLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLI FN S EHQ VLKNNT Y W GIILLANPQFIS (SEQ ID NOG)
• Binding activity may be determined by binding of compounds to cells that express GITRL on their cell surface or a binding of compounds to purified or partially purified GITRL. Binding may be determined using, as non-limiting examples, native or recombinant GITRL, or fragments thereof. Binding of compounds may be determined using methods that are well known to those skilled in the art. Preferred methods for determining binding activity of compounds to GITRL are surface plasmon resonance, isothermal titration calorimetry, ELISA or microscale thermophoresis.
• a compound exhibits at least about lO-fold greater binding to wild type GITRL or fragment thereof than the binding the compound exhibits for a mutant of GITRL or mutant fragment thereof. More preferred are compounds that exhibit about lOO-fold greater binding to GITRL or fragment thereof, compared to the binding the compound exhibits for a mutant of GITRL or mutant fragment thereof. Most preferred are compounds that exhibit about 1000-fold greater binding to GITRL or fragment thereof, compared to the binding the compound exhibits for a mutant of GITRL or mutant fragment thereof.
• mutants exhibiting the aforementioned greater binding to wild type GITRL or fragment thereof compared to a corresponding mutant GITRL or fragment thereof, wherein said mutant bears a substitution in an amino acid selected from the group consisting of L42, L44, M71, 172, Q73, T74, K80, 181, Q82, N83, G86, T87, Y88, G114, 1116, L118, N120, P121, Q122, F 123, 1124 and S 125. Further preferred are mutants bearing a substitution at L114 to S125. [0081] Small Molecule Modifiers of GITR/GITRL
• the present invention provides a compound of Formula (I):
• Ri is hydrogen or an optionally substituted substituent
• R 2 is hydrogen or an optionally substituted substituent
• R 3 is hydrogen or an optionally substituted substituent
• R 4 is hydrogen or an optionally substituted substituent
• R5 is hydrogen or an optionally substituted substituent
• Re is hydrogen or an optionally substituted substituent
• R 7 is hydrogen or an optionally substituted substituent
• Rs is hydrogen or an optionally substituted substituent; wherein optionally any two or more of Ri, R 2 , R3, R4, Rs, R 6 , R7, or Rs may be joined together to form one or more rings.
• the optionally substituted substituent can be independently selected from halogen (e.g., F, Cl), -OH, -CN, C M alkyl, C 2-4 alkenyl, C2-4 alkynyl, C1-4 alkoxy, C3-6 cycloalkyl, C3-6 cycloalkoxy, phenyl, 5 or 6 membered heteroaryl containing 1, 2 or 3 ring heteroatoms independently selected from O, S, and N, 4-7 membered heterocyclyl containing 1 or 2 ring heteroatoms independently selected from O, S, and N, wherein each of the alkyl, alkenyl, alkynyl, alkoxy, cycloalkyl, cycloalkoxy, phenyl, heteroaryl, and heterocyclyl, is
• the present invention provides a compound of Formula I-B, or a pharmaceutically acceptable salt, ester or prodrug thereof,
• Ar 1 and Ar 2 are each independently an optionally substituted aryl (e.g., phenyl) or an optionally substituted heteroaryl (e.g., 5 or 6 membered heteroaryl, having 1-4 ring heteroatoms
• L 1 is a bond, an optionally substituted Ci -6 alkylene linker, -0-, -NH-, a protected -NH-, or an optionally substituted Ci- 6 heteroalkylene linker,
• G 1 at each occurrence is independently selected from -OH, halogen (e.g., F), Ci- 4 alkyl, C2-4 alkenyl, C2-4 alkynyl, C 1 -4 alkoxy, C3-6 cycloalkoxy, wherein each of the alkyl, alkenyl, alkynyl, alkoxy and cycloalkoxy is optionally substituted with 1-3 substituents independently selected from -OH, C1-4 alkyl, and -F, m and n are each independently an integer of 0-3 (e.g., 0, 1, or 2). [0085] Typically, L 1 in Formula I-B is a bond. When L 1 is a bond, Ar 1 and Ar 2 can be connected through any two available positions.
• halogen e.g., F
• both Ar 1 and Ar 2 are 6- membered aromatic rings and preferably, the connecting does not result in Ar 2 being ortho to the -NH- group attached to Ar 1 and/or Ar 1 being ortho to the -NH- group attached to Ar 2 in Formula I-B.
• both Ar 1 and Ar 2 are 6-membered aromatic rings and preferably, the connecting results in Ar 2 being para to the -NH- group attached to Ar 1 and/or Ar 1 being para to the -NH- group attached to Ar 2 in Formula I-B .
• L 1 in Formula I-B is not a bond.
• L 1 in Formula I-B can be an unsubstituted straight-chained Ci -6 alkylene linker, such as a -CH 2 -, -CH2CH2-, etc.
• L 1 in Formula I-B can be an unsubstituted branched C2-6 alkylene linker.
• unsubstituted branched C2 alkylene should be understood as -CH(CH 3 )-.
• L 1 in Formula I-B is -0-.
• L 1 in Formula I-B is -NH- or a protected -NH-.
• L 1 in Formula I-B can be an unsubstituted Ci -6 heteroalkylene linker containing 1 or 2 heteroatoms, which can be an oxygen or a nitrogen atom.
• L 1 in Formula I-B can be -O-CH2-, -0-(CH 2 )2-, -0-(CH 2 )2-0-, -NH-(CH 2 )2-0-, etc.
• both Ar 1 and Ar 2 are 6-membered aromatic rings, and L 1 can be para to the -NH- group attached to Ar 1 and/or para to the -NH- group attached to Ar 2 in Formula I-B .
• Ar 1 and Ar 2 can both be an optionally substituted phenyl.
• Ar 1 and Ar 2 can both be an optionally substituted heteroaryl, such as a 5- membered heteroaryl having one heteroatom such as thiophenyl or furanyl, a 6-membered heteroaryl having 1 or 2 nitrogen atoms such as pyridyl, pyrimidyl, pyridazinyl, pyrazinyl, or a 5-membered heteroaryl having two or three heteroatoms such as oxazolyl, oxadiazolyl, thiazolyl, thiadiazolyl, triazolyl, isooxazolyl, isothiazolyl, etc.
• one of Ar 1 and Ar 2 is an optionally substituted phenyl and the other of Ar 1 and Ar 2 is an optionally substituted heteroaryl, such as a 5-membered heteroaryl having one heteroatom such as thiophenyl or furanyl, a 6-membered heteroaryl having 1 or 2 nitrogen atoms such as pyridyl, pyrimidyl, pyridazinyl, pyrazinyl, or a 5-membered heteroaryl having two or three heteroatoms such as oxazolyl, oxadiazolyl, thiazolyl, thiadiazolyl, triazolyl, isooxazolyl, isothiazolyl, etc.
• a 5-membered heteroaryl having one heteroatom such as thiophenyl or furanyl
• a 6-membered heteroaryl having 1 or 2 nitrogen atoms such as pyridyl, pyrimidyl, pyridazinyl,
• the“optionally substituted” aryl or heteroaryl groups herein, such as the optionally substituted phenyl can be unsubstituted or substituted with one or more, for example, 1, 2, or 3, substituents independently selected from halogen (e.g., F, Cl), -OH, -CN, C i-4 alkyl, C2-4 alkenyl, C 2- 4 alkynyl, Ci-4 alkoxy, C3-6 cycloalkyl, C3-6 cycloalkoxy, phenyl, 5 or 6 membered heteroaryl containing 1, 2 or 3 ring heteroatoms independently selected from O, S, and N, 4-7 membered heterocyclyl containing 1 or 2 ring heteroatoms independently selected from O, S, and N, wherein each of the alkyl, alkenyl, alkynyl, alkoxy, cycloalkyl, cycloalkoxy, phenyl, heteroaryl, and heterocyclyl, is
• A“stable” compound is a compound that can be prepared and isolated and whose structure and properties remain or can be caused to remain essentially unchanged for a period of time sufficient to allow use of the compound for the purposes described herein (e.g., therapeutic administration to a subject).
• n is 0. In some embodiments, m and n are both 0.
• At least one of m and n is not 0.
• G 1 at each occurrence is independently selected from -OH, F, methyl, ethyl, CF3, cyclopropyl, cyclobutyl, methoxy, or ethoxy.
• m and n are both 1, and the two G 1 groups can be the same or different.
• G 1 can be attached to any of the four ring carbons of the tetrahydrofuran ring.
• L 1 in Formula I-B is a bond
• the compound of Formula I- B can be characterized as having Formula I-B-l:
• G 2 at each occurrence is independently selected from -OH, halogen (e.g., F), CN, C1-4 alkyl, C2-4 alkenyl, C 2- 4 alkynyl, Ci- 4 alkoxy, C3-6 cycloalkoxy, wherein each of the alkyl, alkenyl, alkynyl, alkoxy and cycloalkoxy is optionally substituted with 1-3 substituents independently selected from -OH, Ci- 4 alkyl, and -F, p and q are each independently an integer of 0-4 (e.g., 0, 1, or 2); and G 1 , m, and n are defined herein.
• halogen e.g., F
• G 2 at each occurrence can be independently -OH, F, Cl, Br, I, CN, C M alkyl (e.g., methyl, ethyl, propyl, isopropyl, etc.) optionally substituted with 1-3 fluorine, cyclopropyl, cyclobutyl, Ci- 4 alkoxy (e.g., methoxy, ethoxy, etc.) optionally substituted with 1-3 fluorine, cyclopropoxy, or cyclobutoxy.
• m is 0.
• n is 0. In some embodiments, m and n are both 0. In some embodiments, at least one of m and n is not 0. In some embodiments, G 1 at each occurrence is independently selected from -OH, F, methyl, ethyl, CF 3 , cyclopropyl, cyclobutyl, methoxy, or ethoxy. In some embodiments, m and n are both 1, and the two G 1 groups can be the same or different.
• n and n are both 0, and the compound of Formula I-B can be characterized as having Formula I-B -2:
• Formula l-B-2 wherein G 2 , p and q are defined herein.
• p is 0.
• both p and q are 0.
• q is 0.
• at least one of p and q is not 0.
• p and q are the same.
• p and q are different.
• p can be 0, 1, 2, or 3.
• q can be 0, 1, 2, or 3.
• G 2 at each occurrence can be independently -OH, F, Cl, Br, I, CN, Ci-4 alkyl (e.g., methyl, ethyl, propyl, isopropyl, etc.) optionally substituted with 1-3 fluorine, cyclopropyl, cyclobutyl, Ci- 4 alkoxy (e.g., methoxy, ethoxy, etc.) optionally substituted with 1-3 fluorine, cyclopropoxy, or cyclobutoxy.
• Ci-4 alkyl e.g., methyl, ethyl, propyl, isopropyl, etc.
• Ci- 4 alkoxy e.g., methoxy, ethoxy, etc.
• Compounds described herein can comprise one or more asymmetric centers, and thus can exist in various isomeric forms, e.g., enantiomers and/or diastereomers.
• the compounds described herein can be in the form of an individual enantiomer, diastereomer or geometric isomer, or can be in the form of a mixture of stereoisomers, including racemic mixtures and mixtures enriched in one or more stereoisomer.
• Isomers can be isolated from mixtures by methods known to those skilled in the art, including chiral high performance liquid chromatography (HPLC) and the formation and crystallization of chiral salts; or preferred isomers can be prepared by asymmetric syntheses.
• HPLC high performance liquid chromatography
• the compound of Formula (I) is:
• the present invention provides a compound of Formula (II):
• R 9 is hydrogen or an optionally substituted substituent
• R 11 is hydrogen or an optionally substituted substituent
• R 12 is hydrogen or an optionally substituted substituent
• R 13 is hydrogen or an optionally substituted substituent
• R 14 is hydrogen or an optionally substituted substituent
• R 15 is hydrogen or an optionally substituted substituent
• Ri 6 is hydrogen or an optionally substituted substituent; wherein optionally any two or more of R 9 , Rio, R 11 , R 12 , R 13 , R 14 , R 15 , or R I6 may be joined together to form one or more rings.
• the optionally substituted substituent can be independently selected from halogen (e.g., F, Cl), -OH, -CN, C M alkyl, C2-4 alkenyl, C 2-4 alkynyl, C 1-4 alkoxy, C 3-6 cycloalkyl, C 3-6 cycloalkoxy, phenyl, 5 or 6 membered heteroaryl containing 1, 2 or 3 ring heteroatoms independently selected from O, S, and N, 4-7 membered heterocyclyl containing 1 or 2 ring heteroatoms independently selected from O, S, and N, wherein each of the alkyl, alkenyl, alkynyl, alkoxy, cycloalkyl, cycloalkoxy, phenyl, heteroaryl, and heterocyclyl, is optionally substituted with one or more, for example, 1, 2, or 3, substituents independently selected from F, -OH, oxo (as applicable), C 1-4 alkyl, fluoro- substituted
• the present invention provides a compound of Formula II-B, or a pharmaceutically acceptable salt, ester or prodrug thereof;
• L 10 is an optionally substituted Ci-io alkylene linker, an optionally substituted C3-10 cycloalkylene linker, an optionally substituted phenylene, an optionally substituted heteroarylene, an optionally substituted C 1-10 heteroalky lene linker, or an optionally substituted heterocyclylene,
• G 10 and G 11 are independently hydrogen or an optionally substituted C1-4 alkyl, p and q are independently an integer of 0-4 (e.g., 0, 1, or 2), G 20 at each occurrence is independently selected from halogen (e.g., F, Cl), -OH, -CN, C1-4 alkyl, C 2- 4 alkenyl, C 2- 4 alkynyl, Ci- 4 alkoxy, C3-6 cycloalkyl, C3-6 cycloalkoxy, phenyl, 5 or 6 membered heteroaryl containing 1, 2 or 3 ring heteroatoms independently selected from O, S, and N, 4-7 membered heterocyclyl containing 1 or 2 ring heteroatoms independently selected from O, S, and N, wherein each of the alkyl, alkenyl, alkynyl, alkoxy, cycloalkyl, cycloalkoxy, phenyl, heteroaryl, and heterocyclyl, is optionally substituted with one or more, for example, 1,
• L 10 in Formula II-B is an unsubstituted C 1-10 alkylene linker, such as an unsubstituted straight-chain C 1-10 alkylene (e.g., C 3-6 alkylene) linker or an unsubstituted branched C MO alkylene linker.
• C 1-10 alkylene linker such as an unsubstituted straight-chain C 1-10 alkylene (e.g., C 3-6 alkylene) linker or an unsubstituted branched C MO alkylene linker.
• both G 10 and G 11 are hydrogen.
• G 10 and G 11 are independently hydrogen or C 1-4 alkyl (e.g., methyl, ethyl, n-propyl, isopropyl, etc.).
• p is 0. In some embodiments, both p and q are 0. In some embodiments, q is 0. In some embodiments, at least one of p and q is not 0. In some embodiments, p and q are the same. In some embodiments, p and q are different. In some embodiments, p can be 0, 1, 2, or 3. In some embodiments, q can be 0, 1, 2, or 3.
• G 20 at each occurrence can be independently -OH, F, Cl, Br, I, CN, C IM alkyl (e.g., methyl, ethyl, propyl, isopropyl, etc.) optionally substituted with 1-3 fluorine, cyclopropyl, cyclobutyl, C 1-4 alkoxy (e.g., methoxy, ethoxy, etc.) optionally substituted with 1-3 fluorine, cyclopropoxy, or cyclobutoxy.
• C IM alkyl e.g., methyl, ethyl, propyl, isopropyl, etc.
• C 1-4 alkoxy e.g., methoxy, ethoxy, etc.
• the compound of Formula (II) is:
• alkyl means a straight or branched, saturated aliphatic radical having a chain of carbon atoms.
• C x alkyl and C x -C y alkyl are typically used where X and Y indicate the number of carbon atoms in the chain.
• Ci-C 6 alkyl includes alkyls that have a chain of between 1 and 6 carbons (e.g., methyl, ethyl, propyl, isopropyl, butyl, sec -butyl, isobutyl, tert-butyl, pentyl, neopentyl, hexyl, and the like).
• Alkyl represented along with another radical means a straight or branched, saturated alkyl divalent radical having the number of atoms indicated or when no atoms are indicated means a bond, e.g., (C 6 - Cio)aryl(Co-C 3 )alkyl includes phenyl, benzyl, phenethyl, l-phenylethyl 3-phenylpropyl, and the like.
• Backbone of the alkyl can be optionally inserted with one or more heteroatoms, such as N, O, or S.
• a straight chain or branched chain alkyl has 30 or fewer carbon atoms in its backbone (e.g., C1-C30 for straight chains, C3-C30 for branched chains), and more preferably 20 or fewer.
• preferred cycloalkyls have from 3-10 carbon atoms in their ring structure, and more preferably have 5, 6 or 7 carbons in the ring structure.
• alkyl (or“lower alkyl”) as used throughout the specification, examples, and claims is intended to include both“unsubstituted alkyls” and“substituted alkyls”, the latter of which refers to alkyl moieties having one or more substituents replacing a hydrogen on one or more carbons of the hydrocarbon backbone.
• “lower alkyl” as used herein means an alkyl group, as defined above, but having from one to ten carbons, more preferably from one to six carbon atoms in its backbone structure. Likewise,“lower alkenyl” and“lower alkynyl” have similar chain lengths. Throughout the application, preferred alkyl groups are lower alkyls. In preferred embodiments, a substituent designated herein as alkyl is a lower alkyl.
• Non-limiting examples of substituents of a substituted alkyl can include halogen, hydroxy, nitro, thiols, amino, azido, imino, amido, phosphoryl (including phosphonate and phosphinate), sulfonyl (including sulfate, sulfonamido, sulfamoyl and sulfonate), and silyl groups, as well as ethers, alkylthios, carbonyls (including ketones, aldehydes, carboxylates, and esters), -CF 3 , -CN and the like.
• alkenyl refers to unsaturated straight-chain, branched- chain or cyclic hydrocarbon radicals having at least one carbon-carbon double bond.
• C x alkenyl and C x -C y alkenyl are typically used where X and Y indicate the number of carbon atoms in the chain.
• C 2 -C 6 alkenyl includes alkenyls that have a chain of between 2 and 6 carbons and at least one double bond, e.g., vinyl, allyl, propenyl, isopropenyl, l-butenyl, 2-butenyl, 3- butenyl, 2-methylallyl, l-hexenyl, 2-hexenyl, 3- hexenyl, and the like).
• Alkenyl represented along with another radical e.g., as in arylalkenyl
• Alkenyl divalent radical having the number of atoms indicated.
• Backbone of the alkenyl can be optionally inserted with one or more heteroatoms, such as N, O, or S.
• alkynyl refers to unsaturated hydrocarbon radicals having at least one carbon-carbon triple bond.
• C x alkynyl and C x -C y alkynyl are typically used where X and Y indicate the number of carbon atoms in the chain.
• C 2 -C 6 alkynyl includes alkynls that have a chain of between 2 and 6 carbons and at least one triple bond, e.g., ethynyl, 1- propynyl, 2-propynyl, l-butynyl, isopentynyl, l,3-hexa-diyn-yl, n-hexynyl, 3-pentynyl, l-hexen- 3-ynyl and the like.
• Alkynyl represented along with another radical e.g., as in arylalkynyl
• Alkynyl divalent radical having the number of atoms indicated.
• Backbone of the alkynyl can be optionally inserted with one or more heteroatoms, such as N, O, or S.
• alkylene refers to divalent alkyl, alkenyl, and alkynyl” radicals. Prefixes C x and C x -C y are typically used where X and Y indicate the number of carbon atoms in the chain.
• Ci-C 6 alkylene includes methylene, (— CH 2— ), ethylene (— CH 2 CH 2— ), trimethylene (— CH 2 CH 2 CH 2— ), tetramethylene (— CH 2 CH 2 CH 2 CH 2— ), 2-methyltetramethylene (— CH 2 CH(CH 3 )CH 2 CH 2— ), pentamethylene (— CH 2 CH 2 CH 2 CH 2 CH 2— ) and the like).
• R a and R b are each independently hydrogen, alkyl, substituted alkyl, alkenyl, or substituted alkenyl.
• C x alkylidene and C x -C y alkylidene are typically used where X and Y indicate the number of carbon atoms in the chain.
• heteroalkyl refers to straight or branched chain, or cyclic carbon-containing radicals, or combinations thereof, containing at least one heteroatom. Suitable heteroatoms include, but are not limited to, O, N, Si, P, Se, B, and S, wherein the phosphorous and sulfur atoms are optionally oxidized, and the nitrogen heteroatom is optionally quaternized. Heteroalkyls can be substituted as defined above for alkyl groups.
• halogen refers to an atom selected from fluorine, chlorine, bromine and iodine.
• halogen radioisotope or“halo isotope” refers to a radionuclide of an atom selected from fluorine, chlorine, bromine and iodine.
• A“halogen-substituted moiety” or“halo-substituted moiety”, as an isolated group or part of a larger group, means an aliphatic, alicyclic, or aromatic moiety, as described herein, substituted by one or more“halo” atoms, as such terms are defined in this application.
• halo-substituted alkyl includes haloalkyl, dihaloalkyl, trihaloalkyl, perhaloalkyl and the like (e.g.
• halosubstituted (Ci-C 3 )alkyl includes chloromethyl, dichloromethyl, difluoromethyl, trifluoromethyl (-CF 3 ), 2,2,2-trifluoroethyl, perfluoroethyl, 2,2,2-trifluoro-l,l-dichloroethyl, and the like).
• aryl refers to monocyclic, bicyclic, or tricyclic fused aromatic ring system.
• C x aryl and C x -C y aryl are typically used where X and Y indicate the number of carbon atoms in the ring system.
• C 6 -C 12 aryl includes aryls that have 6 to 12 carbon atoms in the ring system.
• aryl groups include, but are not limited to, pyridinyl, pyrimidinyl, furanyl, thienyl, imidazolyl, thiazolyl, pyrazolyl, pyridazinyl, pyrazinyl, triazinyl, tetrazolyl, indolyl, benzyl, phenyl, naphthyl, anthracenyl, azulenyl, fluorenyl, indanyl, indenyl, naphthyl, phenyl, tetrahydronaphthyl, benzimidazolyl, benzofuranyl, benzothiofuranyl, benzothiophenyl, benzoxazolyl, benzoxazolinyl, benzthiazolyl, benztriazolyl, benztetrazolyl, benzisoxazolyl, benzisothiazolyl, benzimida
• heteroaryl refers to an aromatic 5-8 membered monocyclic, 8-12 membered fused bicyclic, or 11-14 membered fused tricyclic ring system having 1-3 heteroatoms if monocyclic, 1-6 heteroatoms if bicyclic, or 1-9 heteroatoms if tricyclic, said heteroatoms selected from O, N, or S ( e.g ., carbon atoms and 1-3, 1-6, or 1-9 heteroatoms of N, O, or S if monocyclic, bicyclic, or tricyclic, respectively.
• C x heteroaryl and C x -C y heteroaryl are typically used where X and Y indicate the number of carbon atoms in the ring system.
• C 4 - C9 heteroaryl includes heteroaryls that have 4 to 9 carbon atoms in the ring system.
• Heteroaryls include, but are not limited to, those derived from benzo[b]furan, benzo[b] thiophene, benzimidazole, imidazo[4,5-c]pyridine, quinazoline, thieno[2,3-c]pyridine, thieno[3,2- b]pyridine, thieno[2, 3-b]pyridine, indolizine, imidazo[l,2a]pyridine, quinoline, isoquinoline, phthalazine, quinoxaline, naphthyridine, quinolizine, indole, isoindole, indazole, indoline, benzoxazole, benzopyrazole, benzothiazole, imidazo[l,5-a]pyridine, pyrazolo[l,5-a]pyridine, imidazo[l,2-
• heteroaryl groups include, but are not limited to, pyridyl, furyl or furanyl, imidazolyl, benzimidazolyl, pyrimidinyl, thiophenyl or thienyl, pyridazinyl, pyrazinyl, quinolinyl, indolyl, thiazolyl, naphthyridinyl, 2-amino-4-oxo-3,4-dihydropteridin-6-yl, tetrahydroisoquinolinyl, and the like.
• 1, 2, 3, or 4 hydrogen atoms of each ring may be substituted by a substituent.
• cyclyl or“cycloalkyl” refers to saturated and partially unsaturated cyclic hydrocarbon groups having 3 to 12 carbons, for example, 3 to 8 carbons, and, for example, 3 to 6 carbons.
• C x cyclyl and C x -C y cycyl are typically used where X and Y indicate the number of carbon atoms in the ring system.
• C 3 -C 8 cyclyl includes cyclyls that have 3 to 8 carbon atoms in the ring system.
• the cycloalkyl group additionally can be optionally substituted, e.g., with 1, 2, 3, or 4 substituents.
• C 3 -Ciocyclyl includes cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cyclohexenyl, 2,5-cyclohexadienyl, cycloheptyl, cyclooctyl, bicyclo[2.2.2]octyl, adamantan-l-yl, decahydronaphthyl, oxocyclohexyl, dioxocyclohexyl, thiocyclohexyl, 2-oxobicyclo [2.2.l]hept-l-yl, and the like.
• Aryl and heteroaryls can be optionally substituted with one or more substituents at one or more positions, for example, halogen, alkyl, aralkyl, alkenyl, alkynyl, cycloalkyl, hydroxyl, amino, nitro, sulfhydryl, imino, amido, phosphate, phosphonate, phosphinate, carbonyl, carboxyl, silyl, ether, alkylthio, sulfonyl, ketone, aldehyde, ester, a heterocyclyl, an aromatic or heteroaromatic moiety, -CF 3 , -CN, or the like.
• heterocyclyl refers to a nonaromatic 4-8 membered monocyclic, 8-12 membered bicyclic, or 11-14 membered tricyclic ring system having 1-3 heteroatoms if monocyclic, 1-6 heteroatoms if bicyclic, or 1-9 heteroatoms if tricyclic, said heteroatoms selected from O, N, or S (e.g., carbon atoms and 1-3, 1-6, or 1-9 heteroatoms of N, O, or S if monocyclic, bicyclic, or tricyclic, respectively).
• C x heterocyclyl and C x -C y heterocyclyl are typically used where X and Y indicate the number of carbon atoms in the ring system.
• C4-C9 heterocyclyl includes heterocyclyls that have 4-9 carbon atoms in the ring system.
• 1, 2 or 3 hydrogen atoms of each ring can be substituted by a substituent.
• Exemplary heterocyclyl groups include, but are not limited to piperazinyl, pyrrolidinyl, dioxanyl, morpholinyl, tetrahydrofuranyl, piperidyl, 4-morpholyl, 4-piperazinyl, pyrrolidinyl, perhydropyrrolizinyl, l,4-diazaperhydroepinyl, l,3-dioxanyl, l,4-dioxanyland the like.
• bicyclic and tricyclic refers to fused, bridged, or joined by single bond polycyclic ring assemblies.
• cyclylalkylene means a divalent aryl, heteroaryl, cyclyl, or heterocyclyl.
• fused ring refers to a ring that is bonded to another ring to form a compound having a bicyclic structure when the ring atoms that are common to both rings are directly bound to each other.
• Non-exclusive examples of common fused rings include decalin, naphthalene, anthracene, phenanthrene, indole, furan, benzofuran, quinoline, and the like.
• Compounds having fused ring systems can be saturated, partially saturated, cyclyl, heterocyclyl, aromatics, heteroaromatics, and the like.
• carbocyclyl as used either alone or in combination with another radical, means a mono- bi- or tricyclic ring structure consisting of 3 to 14 carbon atoms.
• one or more of the hydrogen atoms of a carbocyclyl may be optionally substituted by a substituent.
• the term“carbocycle” refers to fully saturated ring systems and saturated ring systems and partially saturated ring systems and aromatic ring systems and non-aromatic ring systems and unsaturated ring systems and partially unsaturated ring systems.
• the term “carbocycle” encompasses monocyclic, bicyclic, polycyclic, spirocyclic, fused, bridged, or linked ring systems.
• one or more of the hydrogen atoms of a carbocycle may be optionally substituted by a substituent.
• the carbocycle optionally comprises one or more heteroatoms.
• the heteroatoms are selected from N, O, S, or P.
• cyclic means carbocycles, which can be fully saturated, saturated, partially saturated, unsaturated, partially unsaturated non aromatic or aromatic that may or may not be substituted and which optionally can comprise one or more heteroatoms.
• the heteroatoms are selected from N, O, S, or P.
• one or more of the hydrogen atoms of a ring may be optionally substituted by a substituent.
• the ring or rings may be monocyclic, bicyclic, polycyclic, spirocyclic, fused, bridged, or linked.
• spiro-cycloalkyl means spirocyclic rings where the ring is linked to the molecule through a carbon atom, and wherein the resulting carbocycle is formed by alkylene groups.
• spiro-Ci-Cs-cycloalkyl means 3-8 membered, spirocyclic rings where the ring is linked to the molecule through a carbon atom, and wherein the resulting 3-8 membered carbocycle is formed by alkylene groups with 2 to 7 carbon atoms.
• spiro-C5-cycloalkyl means 5 membered, spirocyclic rings where the ring is linked to the molecule through a carbon atom, wherein the resulting 5 membered carbocycle is formed by an alkylene group with 4 carbon atoms.
• spiro-cycloalkenyl means spirocyclic rings where the ring is linked to the molecule through a carbon atom, and wherein the resulting carbocycle is formed by alkenylene groups.
• spiro-Ci-Cs-cycloalkcnyl means 3-8 membered, spirocyclic rings where the ring is linked to the molecule through a carbon atom, wherein the resulting 3-8 membered carbocycle is formed by alkenylene groups with 2 to 7 carbon atoms.
• spiro-Cs-cycloalkenyl means 5 membered, spirocyclic rings where the ring is linked to the molecule through a carbon atom, wherein the resulting 5 membered carbocycle is formed by alkenylene groups with 4 carbon atoms.
• spiro-heterocyclyl means saturated or unsaturated spirocyclic rings, which may contain one or more heteroatoms, where the ring may be linked to the molecule through a carbon atom or optionally through a nitrogen atom, if a nitrogen atom is present.
• the heteroatom is selected from O, N, S, or P. In some embodiments, the heteroatom is O, S, or N.
• spiro-C 3 -C 8 -heterocyclyl means 3-8 membered, saturated or unsaturated, spirocyclic rings which may contain one or more heteroatoms, where the ring may be linked to the molecule through a carbon atom or optionally through a nitrogen atom, if a nitrogen atom is present.
• the heteroatom is selected from O, N, S, or P. In some embodiments, the heteroatom is O, S, or N.
• spiro-Cs-heterocyclyl means 5 membered, saturated or unsaturated, spirocyclic rings which may contain one or more heteroatoms, where the ring may be linked to the molecule through a carbon atom or optionally through a nitrogen atom, if a nitrogen atom is present.
• the heteroatom is selected from O, N, S, or P. In some embodiments, the heteroatom is O, S, or N.
• one or more of the hydrogen atoms of a spirocyclic ring may be optionally substituted by a substituent.
• one or more hydrogen atoms of a spiro-cycloalkyl may be optionally substituted by a substituent.
• one or more hydrogen atoms of a spiro-C 3 -C 8 -eycloalkyl may be optionally substituted by a substituent.
• one or more hydrogen atoms of a spiro-Cs-cycloalkyl may be optionally substituted by a substituent.
• one or more hydrogen atoms of a spiro-cycloalkenyl may be optionally substituted by a substituent. In some embodiments, one or more hydrogen atoms of a spiro-C 3 -C 8 -cycloalkenyl may be optionally substituted by a substituent. In some embodiments, one or more hydrogen atoms of a spiro-Cs-cycloalkenyl may be optionally substituted by a substituent. In some embodiments, one or more hydrogen atoms of a spiro-heterocycyl may be optionally substituted by a substituent.
• one or more hydrogen atoms of a spiro-C 3 -Cs- heterocycyl may be optionally substituted by a substituent. In some embodiments, one or more hydrogen atoms of a spiro-Cs- heterocycyl may be optionally substituted by a substituent.
• carbonyl means the radical— C(O)— . It is noted that the carbonyl radical can be further substituted with a variety of substituents to form different carbonyl groups including acids, acid halides, amides, esters, ketones, and the like.
• carboxy means the radical— C(0)0— . It is noted that compounds described herein containing carboxy moieties can include protected derivatives thereof, i.e., where the oxygen is substituted with a protecting group. Suitable protecting groups for carboxy moieties include benzyl, tert-butyl, and the like. The term “carboxyl” means -COOH.
• cyano means the radical— CN.
• heteroatom refers to an atom that is not a carbon atom.
• heteroatoms include, but are not limited to nitrogen, oxygen, sulfur and halogens.
• the term“imine derivative” means a derivative comprising the moiety— C(NR)— , wherein R comprises a hydrogen or carbon atom alpha to the nitrogen.
• the term“nitro” means the radical— N0 2 .
• An“oxaaliphatic,”“oxaalicyclic”, or“oxaaromatic” mean an aliphatic, alicyclic, or aromatic, as defined herein, except where one or more oxygen atoms (— O— ) are positioned between carbon atoms of the aliphatic, alicyclic, or aromatic respectively.
• An“oxoaliphatic,”“oxoalicyclic”, or“oxoaromatic” means an aliphatic, alicyclic, or aromatic, as defined herein, substituted with a carbonyl group.
• the carbonyl group can be an aldehyde, ketone, ester, amide, acid, or acid halide.
• aromatic means a moiety wherein the constituent atoms make up an unsaturated ring system, ah atoms in the ring system are sp 2 hybridized and the total number of pi electrons is equal to 4n+2.
• An aromatic ring can be such that the ring atoms are only carbon atoms (e.g., aryl) or can include carbon and non-carbon atoms (e.g., heteroaryl).
• substituted refers to independent replacement of one or more (typically 1, 2, 3, 4, or 5) of the hydrogen atoms on the substituted moiety with substituents independently selected from the group of substituents listed below in the definition for “substituents” or otherwise specified.
• a non-hydrogen substituent can be any substituent that can be bound to an atom of the given moiety that is specified to be substituted.
• substituents include, but are not limited to, acyl, acylamino, acyloxy, aldehyde, alicyclic, aliphatic, alkanesulfonamido, alkanesulfonyl, alkaryl, alkenyl, alkoxy, alkoxycarbonyl, alkyl, alkylamino, alkylcarbanoyl, alkylene, alkylidene, alkylthios, alkynyl, amide, amido, amino, amidine, aminoalkyl, aralkyl, aralkylsulfonamido, arenesulfonamido, arenesulfonyl, aromatic, aryl, arylamino, arylcarbanoyl, aryloxy, azido, carbamoyl, carbonyl, carbonyls including ketones, carboxy, carboxylates, CF 3 , cyano (CN), cycloalkyl, cyclo
• two substituents, together with the carbon(s) to which they are attached to can form a ring.
• two or more substituents, together with the carbon(s) to which they are attached to can form one or more rings.
• Substituents may be protected as necessary and any of the protecting groups commonly used in the art may be employed. Non-limiting examples of protecting groups may be found, for example, in Greene and Wuts, Protective Groups in Organic Synthesis, 44 th . Ed., Wiley & Sons, 2006.
• alkoxyl or“alkoxy” as used herein refers to an alkyl group, as defined above, having an oxygen radical attached thereto.
• Representative alkoxyl groups include methoxy, ethoxy, propyloxy, tert-butoxy, n-propyloxy, iso-propyloxy, n-butyloxy, iso-butyloxy, and the like.
• An“ether” is two hydrocarbons covalently linked by an oxygen. Accordingly, the substituent of an alkyl that renders that alkyl an ether is or resembles an alkoxyl, such as can be represented by one of -O-alkyl, -O-alkenyl, and -O-alkynyl.
• Aroxy can be represented by -O- aryl or O-heteroaryl, wherein aryl and heteroaryl are as defined below.
• the alkoxy and aroxy groups can be substituted as described above for alkyl.
• aralkyl refers to an alkyl group substituted with an aryl group (e.g., an aromatic or hetero aromatic group).
• alkylthio refers to an alkyl group, as defined above, having a sulfur radical attached thereto.
• the“alkylthio” moiety is represented by one of -S-alkyl, -S-alkenyl, and -S-alkynyl.
• Representative alkylthio groups include methylthio, ethylthio, and the like.
• the term“alkylthio” also encompasses cycloalkyl groups, alkene and cycloalkene groups, and alkyne groups.
• Arylthio refers to aryl or heteroaryl groups.
• sulfinyl means the radical— SO— . It is noted that the sulfinyl radical can be further substituted with a variety of substituents to form different sulfinyl groups including sulfinic acids, sulfinamides, sulfinyl esters, sulfoxides, and the like.
• sulfonyl means the radical— S0 2— . It is noted that the sulfonyl radical can be further substituted with a variety of substituents to form different sulfonyl groups including sulfonic acids (-SO3H), sulfonamides, sulfonate esters, sulfones, and the like.
• thiocarbonyl means the radical— C(S)— . It is noted that the thiocarbonyl radical can be further substituted with a variety of substituents to form different thiocarbonyl groups including thioacids, thioamides, thioesters, thioketones, and the like.
• the term“amino” means -NH 2 .
• the term“alkylamino” means a nitrogen moiety having at least one straight or branched unsaturated aliphatic, cyclyl, or heterocyclyl radicals attached to the nitrogen.
• representative amino groups include — NH 2 ,— NHCH S ,— N(CH 3 ) 2 , — NH(Ci-Cioalkyl),— N(Ci-Cioalkyl) 2 , and the like.
• alkylamino includes “alkenylamino,” “alkynylamino,” “cyclylamino,” and “heterocyclylamino.”
• arylamino means a nitrogen moiety having at least one aryl radical attached to the nitrogen. For example — NHaryl, and — N(aryl) 2 .
• hetero arylamino means a nitrogen moiety having at least one heteroaryl radical attached to the nitrogen.
• NHheteroaryl and— N(heteroaryl) 2 .
• two substituents together with the nitrogen can also form a ring.
• the compounds described herein containing amino moieties can include protected derivatives thereof. Suitable protecting groups for amino moieties include acetyl, tertbutoxycarbonyl, benzyloxycarbonyl, and the like.
• aminoalkyl means an alkyl, alkenyl, and alkynyl as defined above, except where one or more substituted or unsubstituted nitrogen atoms (— N— ) are positioned between carbon atoms of the alkyl, alkenyl, or alkynyl .
• an (C 2 -C 6 ) aminoalkyl refers to a chain comprising between 2 and 6 carbons and one or more nitrogen atoms positioned between the carbon atoms.
• alkoxyalkoxy means -0-(alkyl)-0-(alkyl), such as -OCH 2 CH 2 OCH 3 , and the like.
• alkoxyalkyl means -(alkyl)-O-(alkyl), such as -CH 2 OCH 3 , -
• aryloxy means -O-(aryl), such as -O-phenyl, -O-pyridinyl, and the like.
• arylalkyl means -(alkyl)-(aryl), such as benzyl (i.e., -CFbphenyl), -CH 2 - pyrindinyl, and the like.
• arylalkyloxy means -0-(alkyl)-(aryl), such as -O-benzyl, -0-CH 2 - pyridinyl, and the like.
• cycloalkyloxy means -O-(cycloalkyl), such as -O-cyclohexyl, and the like.
• cycloalkylalkyloxy means -0-(alkyl)-(cycloalkyl, such as - OCthcyclohexyl, and the like.
• aminoalkoxy means -0-(alkyl)-NH 2 , such as -OCH 2 NH 2 , -
• the term “mono- or di-alkylamino” means -NH(alkyl) or -N(alkyl)(alkyl), respectively, such as -NHCH 3 , -N(CH 3 ) 2 , and the like.
• the term "mono- or di-alkylaminoalkoxy” means -0-(alkyl)-NH(alkyl) or -O- (alkyl)-N(alkyl)(alkyl), respectively, such as -OCH 2 NHCH 3 , -OCH 2 CH 2 N(CH 3 ) 2 , and the like.
• arylamino means -NH(aryl), such as -NH-phenyl, -NH-pyridinyl, and the like.
• arylalkylamino means -NH-(alkyl)-(aryl), such as -NH-benzyl, -NHCH 2 - pyridinyl, and the like.
• alkylamino means -NH(alkyl), such as -NHCH 3 , -NHCH 2 CH 3 , and the like.
• cyclo alkylamino means -NH-(cycloalkyl), such as -NH-cyclohexyl, and the like.
• cyclo alky lalkylamino -NH-(alkyl)-(cycloalkyl), such as -NHCH 2 - cyclohexyl, and the like.
• a Ci alkyl comprises methyl (i.e.,— CH 3 ) as well as— CR a R b R c where R a , R b , and R c can each independently be hydrogen or any other substituent where the atom alpha to the carbon is a heteroatom or cyano.
• CF 3 , CH 2 OH and CH 2 CN are all Ci alkyls.
• structures depicted herein are meant to include compounds which differ only in the presence of one or more isotopically enriched atoms.
• compounds having the present structure except for the replacement of a hydrogen atom by a deuterium or tritium, or the replacement of a carbon atom by a 13 C- or 14 C-enriched carbon are within the scope of the invention.
• compounds of the present invention as disclosed herein may be synthesized using any synthetic method available to one of skill in the art.
• the compounds of the present invention disclosed herein can be prepared in a variety of ways known to one skilled in the art of organic synthesis, and in analogy with the exemplary compounds whose synthesis is described herein.
• the starting materials used in preparing these compounds may be commercially available or prepared by known methods.
• Preparation of compounds can involve the protection and de-protection of various chemical groups. The need for protection and de-protection, and the selection of appropriate protecting groups can be readily determined by one skilled in the art.
• the chemistry of protecting groups can be found, for example, in Greene and Wuts, Protective Groups in Organic Synthesis, 44th. Ed., Wiley & Sons, 2006, which is incorporated herein by reference in its entirety.
• Non-limiting examples of synthetic methods used to prepare various embodiments of compounds of the present invention are disclosed in the Examples section herein.
• the reactions of the processes described herein can be carried out in suitable solvents which can be readily selected by one of skill in the art of organic synthesis. Suitable solvents can be substantially nonreactive with the starting materials (reactants), the intermediates, or products at the temperatures at which the reactions are carried out, i.e., temperatures which can range from the solvent’s freezing temperature to the solvent’s boiling temperature.
• a given reaction can be carried out in one solvent or a mixture of more than one solvent.
• suitable solvents for a particular reaction step can be selected.
• the compounds of the present invention as disclosed herein may be conjugated to a polymer matrix, e.g., for controlled delivery of the compound.
• the compound may be conjugated via a covalent bond or non-covalent association.
• the linkage may comprise a moiety that is cleavable under biological conditions (e.g., ester, amide, carbonate, carbamate, imide, etc.).
• the conjugated compound may be a pharmaceutically acceptable salt, ester, or prodrug of a compound disclosed herein.
• a compound as disclosed herein may be associated with any type of polymer matrix known in the art for the delivery of therapeutic agents.
• the peptide agonists of GITR comprises, consists of or consists essentially of a peptide having the sequence set forth in SEQ ID NO: l or a mutant or functional equivalent thereof.
• the peptide agonists of GITR comprises, consists of or consists essentially of a peptide having the sequence KEPCM AKF GPLPS KW QMAS S EPPC VNKV S DWKLEILQN GLYLI Y GQ V APN AN YND V AP FE VRLYKNKDMIQTLTNKS KIQN V GGT YELH V GDTIDLIFN S EHQ VLKNNT YW GULL AN PQFIS (SEQ ID NO:4).
• Functional GITR is an oligomer.
• Peptide comprising, consisting of or consisting essentially of the sequence in SEQ ID NO:4 binds to a monomer of functional GITR oligomer (for example, trimer).
• the GITR agonist is an oligomer of SEQ ID NO:4, wherein each monomer comprising the sequence set forth in SEQ ID NO:4 is linked via a linker sequence.
• the linker is GSGSGSGS (SEQ ID NO:5).
• SEQ ID NO: l comprises an oligomer of SEQ ID NO:4, wherein each monomer of SEQ ID NO:4 is linked via the linker having the sequence set forth in SEQ ID NO:5.
• the peptide agonists of GITR comprise, consist of or consist essentially of a peptide having the sequence set forth in SEQ ID NO: 2 or a mutant or functional equivalent thereof.
• compositions comprising GITR agonists.
• the composition comprises the peptide set forth in SEQ ID NO: 1.
• the composition comprises the peptide set forth in SEQ ID NO: 2.
• the peptide agonists of GITR are compositions that comprises peptides having the sequences set forth in SEQ ID NO: 1 or SEQ ID NO: 2 and further comprise a pharmaceutically acceptable solution or carrier.
• peptides comprising, consisting of or consisting essentially of the sequences set forth in SEQ ID NO: 1 or SEQ ID NO: 2, or analogs, pharmaceutical equivalents and/or peptidomimetics thereof are modified peptides.
• “Modified peptide” may include the incorporation of lactam-bridge, head-to-tail cyclization, non-natural amino acids into the peptides of the invention, including synthetic non-native amino acids, substituted amino acids, or one or more D-amino acids into the peptides (or other components of the composition, with exception for protease recognition sequences) is desirable in certain situations.
• D-amino acid-containing peptides exhibit increased stability in vitro or in vivo compared to L-amino acid- containing forms.
• the construction of peptides incorporating D-amino acids can be particularly useful when greater in vivo or intracellular stability is desired or required.
• D- peptides are resistant to endogenous peptidases and proteases, thereby providing better oral trans-epithelial and transdermal delivery of linked drugs and conjugates, improved bioavailability of membrane-permanent complexes (see below for further discussion), and prolonged intravascular and interstitial lifetimes when such properties are desirable.
• the use of D-isomer peptides can also enhance transdermal and oral trans-epithelial delivery of linked drugs and other cargo molecules.
• D-peptides cannot be processed efficiently for major histocompatibility complex class Il-restricted presentation to T helper cells, and are therefore less likely to induce humoral immune responses in the whole organism.
• Peptide conjugates can therefore be constructed using, for example, D-isomer forms of cell penetrating peptide sequences, L-isomer forms of cleavage sites, and D-isomer forms of therapeutic peptides. Therefore, in some embodiments the peptides as disclosed comprise L and D amino acids, wherein no more than 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 D-amino acids are included. In certain aspects, the peptides comprise more than 10 D-amino acids, and in certain aspects all the amino acids of the peptides are D-amino acids.
• peptides comprising, consisting of or consisting essentially of the sequences set forth in SEQ ID NO: 1 or SEQ ID NO: 2 or analogs, pharmaceutical equivalents and/or peptidomimetics thereof are retro-inverso peptides of the said peptides or analogs, pharmaceutical equivalents and/or peptidomimetics thereof.
• a "retro-inverso peptide” refers to a peptide with a reversal of the direction of the peptide bond on at least one position, i.e., a reversal of the amino- and carboxy-termini with respect to the side chain of the amino acid.
• a retro-inverso analogue has reversed termini and reversed direction of peptide bonds while approximately maintaining the topology of the side chains as in the native peptide sequence.
• the retro-inverso peptide can contain L-amino acids or D-amino acids, or a mixture of L-amino acids and D-amino acids, up to all of the amino acids being the D-isomer.
• Partial retro- inverso peptide analogues are polypeptides in which only part of the sequence is reversed and replaced with enantiomeric amino acid residues.
• retro-inverted portion of such an analogue has reversed amino and carboxyl termini, the amino acid residues flanking the retro- inverted portion are replaced by side-chain-analogous a-substituted geminal-diaminomethanes and malonates, respectively.
• Retro-inverso forms of cell penetrating peptides have been found to work as efficiently in translocating across a membrane as the natural forms. Synthesis of retro- inverso peptide analogues are described in Bonelli, F. et ah, Int J Pept Protein Res. 24(6):553-6 (1984); Verdini, A and Viscomi, G. C, J. Chem. Soc. Perkin Trans.
• variants of the peptides described herein can comprise conservatively substituted sequences, meaning that one or more amino acid residues of an original peptide are replaced by different residues, and that the conservatively substituted peptide retains a desired biological activity, i.e., function as an agonist of GITR (for example, SEQ ID NO:l or SEQ ID NO:2) that is essentially equivalent to that of the original peptide.
• conservatively substituted sequences meaning that one or more amino acid residues of an original peptide are replaced by different residues, and that the conservatively substituted peptide retains a desired biological activity, i.e., function as an agonist of GITR (for example, SEQ ID NO:l or SEQ ID NO:2) that is essentially equivalent to that of the original peptide.
• conservative substitutions include substitution of amino acids that do not alter the secondary and/or tertiary structure of peptides set forth in SEQ ID NO:l or SEQ ID NO:2, substitutions that do not change the overall or local hydrophobic character, substitutions that do not change the overall or local charge, substitutions by residues of equivalent side-chain size, or substitutions by side-chains with similar reactive groups.
• a given amino acid can be replaced by a residue having similar physiochemical characteristics, e.g., substituting one aliphatic residue for another (such as Ile, Val, Leu, or Ala for one another), or substitution of one polar residue for another (such as between Lys and Arg; Glu and Asp; or Gln and Asn).
• substitutions of entire regions having similar hydrophobicity characteristics or substitutions of residues with similar side-chain volume are well known.
• Isolated peptides comprising conservative amino acid substitutions can be tested to confirm that a desired activity, e.g. function as an agonist of GITR (for example, SEQ ID NO: 1 or SEQ ID NO: 2) is retained.
• Amino acids can be grouped according to similarities in the properties of their side chains (in A. L. Lehninger, in Biochemistry, second ed., pp. 73-75, Worth Publishers, New York (1975)): (1) non-polar: Ala (A), Val (V), Leu (L), Ile (I), Pro (P), Phe (F), Trp (W), Met (M); (2) uncharged polar: Gly (G), Ser (S), Thr (T), Cys (C), Tyr (Y), Asn (N), Gln (Q); (3) acidic: Asp (D), Glu (E); (4) basic: Lys (K), Arg (R), His (H).
• Naturally occurring residues can be divided into groups based on common side-chain properties: (1) hydrophobic: Norleucine, Met, Ala, Val, Leu, Ile, Phe, Trp; (2) neutral hydrophilic: Cys, Ser, Thr, Asn, Gln, Ala, Tyr, His, Pro, Gly; (3) acidic: Asp, Glu; (4) basic: His, Lys, Arg; (5) residues that influence chain orientation: Gly, Pro; (6) aromatic: Trp, Tyr, Phe, Pro, His, or hydroxyproline.
• Non-conservative substitutions will entail exchanging a member of one of these classes for another class.
• conservative substitutions for use in the variants described herein are as follows: Ala into Gly or into Ser; Arg into Lys; Asn into Gln or into His; Asp into Glu or into Asn; Cys into Ser; Gln into Asn; Glu into Asp; Gly into Ala or into Pro; His into Asn or into Gln; Ile into Leu or into Val; Leu into Ile or into Val; Lys into Arg, into Gln or into Glu; Met into Leu, into Tyr or into Ile; Phe into Met, into Leu or into Tyr; Ser into Thr; Thr into Ser; Trp into Tyr or into Phe; Tyr into Phe or into Trp; and/or Phe into Val, into Tyr, into Ile or into Leu.
• conservative substitutions encompass residue exchanges with those of similar physicochemical properties (i.e. substitution of a hydrophobic residue for another hydrophobic amino acid).
• cysteine residues not involved in maintaining the proper conformation of the isolated peptide as described herein can also be substituted, generally with serine, to improve the oxidative stability of the molecule and prevent aberrant crosslinking.
• cysteine bond(s) can be added to the isolated peptide as described herein to improve its stability or facilitate multimerization.
• a“functional fragment” is a fragment or segment of a peptide comprising at least 3, at least 4 or at least 5 amino acids and which can function as agonists of GITR (for example, SEQ ID NO: 1 or SEQ ID NO: 2).
• a functional fragment can comprise conservative substitutions of the sequences disclosed herein so long as they preserve the function as an agonist of GITR (for example, SEQ ID NO: 1 or SEQ ID NO: 2). This can be tested by detecting an increase in function by at least 30%, at least 40% or at least 50% of that of the parent (e.g. original) version of the peptide.
• an isolated peptide as described herein can comprise at least one peptide bond replacement.
• a single peptide bond or multiple peptide bonds e.g. 2 bonds, 3 bonds, 4 bonds, 5 bonds, or 6 or more bonds, or all the peptide bonds can be replaced.
• An isolated peptide as described herein can comprise one type of peptide bond replacement or multiple types of peptide bond replacements, e.g. 2 types, 3 types, 4 types, 5 types, or more types of peptide bond replacements.
• Non-limiting examples of peptide bond replacements include urea, thiourea, carbamate, sulfonyl urea, trifluoroethylamine, ortho- (aminoalkyl)-phenylacetic acid, para-(aminoalkyl)-phenylacetic acid, meta-(aminoalkyl)- phenylacetic acid, thioamide, tetrazole, boronic ester, olefinic group, and derivatives thereof.
• the peptides described herein are conjugated with agents that increase retention in the subject.
• agents that increase retention include but are not limited to cellulose, fatty acids, polyethylene glycol (PEG) or combinations thereof.
• an isolated peptide as described herein can comprise naturally occurring amino acids commonly found in polypeptides and/or proteins produced by living organisms, e.g. Ala (A), Val (V), Leu (L), Ile (I), Pro (P), Phe (F), Trp (W), Met (M), Gly (G), Ser (S), Thr (T), Cys (C), Tyr (Y), Asn (N), Gln (Q), Asp (D), Glu (E), Lys (K), Arg (R), and His (H).
• an isolated peptide as described herein can comprise alternative amino acids.
• Non-limiting examples of alternative amino acids include, D-amino acids; beta- amino acids; homocysteine, phosphoserine, phosphothreonine, phosphotyrosine, hydroxyproline, gamma-carboxyglutamate; hippuric acid, octahydroindole-2-carboxylic acid, statine, 1, 2,3,4, - tetrahydroisoquinoline-3-carboxylic acid, penicillamine (3-mercapto-D-valine), ornithine, citruline, alpha-methyl-alanine, para-benzoylphenylalanine, para-amino phenylalanine, p- fluorophenylalanine, phenylglycine, propargylglycine, sarcosine, and tert-butylglycine), diaminobutyric acid, 7-hydroxy-tetrahydroisoquinoline carboxylic acid, naphthylalan
• an isolated peptide can be modified, e.g. a moiety can be added to one or more of the amino acids comprising the peptide.
• an isolated peptide as described herein can comprise one or more moiety molecules, e.g. 1 or more moiety molecules per peptide, 2 or more moiety molecules per peptide, 5 or more moiety molecules per peptide, 10 or more moiety molecules per peptide or more moiety molecules per peptide.
• an isolated peptide as described herein can comprise one more types of modifications and/or moieties, e.g. 1 type of modification, 2 types of modifications, 3 types of modifications or more types of modifications.
• Non-limiting examples of modifications and/or moieties include PEGylation; glycosylation; HESylation; ELPylation; lipidation; acetylation; amidation; end-capping modifications; cyano groups; phosphorylation; and cyclization.
• an end-capping modification can comprise acetylation at the N-terminus, N-terminal acylation, and N-terminal formylation.
• an end capping modification can comprise amidation at the C-terminus, introduction of C-terminal alcohol, aldehyde, ester, and thioester moieties.
• An isolated peptide as described herein can be coupled and or connected to a second functional molecule, peptide and/or polypeptide.
• an isolated peptide as described herein is coupled to a targeting molecule.
• an isolated peptide as described herein is coupled to a targeting molecule by expressing the peptide and the targeting molecule as a fusion peptide, optionally with a peptide linker sequence interposed between them.
• a“targeting molecule” can be any molecule, e.g. a peptide, antibody or fragment thereof, antigen, targeted liposome, or a small molecule that can bind to or be bound by a specific cell or tissue type.
• an isolated peptide as described herein can be a fusion peptide or polypeptide.
• a fusion polypeptide can comprise a peptide linker domain interposed between the first domain of the peptide comprising an amino acid sequence of the peptides described herein (SEQ ID NO: 1 or SEQ ID NO: 2), variants, functional fragments, prodrug, or analog thereof as described herein and at least a second domain of the fusion peptide.
• the first peptide domain can be the N-terminal domain or the C-terminal domain or an internal sequence in the case where the partner domain forms after fragment complementation of constituent parts.
• fusion protein refers to a recombinant protein of two or more proteins. Fusion proteins can be produced, for example, by a nucleic acid sequence encoding one protein is joined to the nucleic acid encoding another protein such that they constitute a single open-reading frame that can be translated in the cells into a single polypeptide harboring all the intended proteins. The order of arrangement of the proteins can vary. Fusion proteins can include an epitope tag or a half-life extender.
• Epitope tags include biotin, FLAG tag, c-myc, hemaglutinin, His6, digoxigenin, FITC, Cy3, Cy5, green fluorescent protein, V5 epitope tags, GST, b-galactosidase, AU1, AU5, and avidin.
• Half-life extenders include Fc domain and serum albumin.
• an isolated peptide as described herein can be a pharmaceutically acceptable prodrug.
• a“prodrug” refers to compounds that can be converted via some chemical or physiological process (e.g., enzymatic processes and metabolic hydrolysis) to a therapeutic agent.
• the term“prodrug” also refers to a precursor of a biologically active compound that is pharmaceutically acceptable.
• a prodrug may be inactive when administered to a subject, i.e. an ester, but is converted in vivo to an active compound, for example, by hydrolysis to the free carboxylic acid or free hydroxyl.
• prodrug compound often offers advantages of solubility, tissue compatibility or delayed release in an organism.
• prodrug is also meant to include any covalently bonded carriers, which release the active compound in vivo when such prodrug is administered to a subject.
• Prodrugs of an active compound may be prepared by modifying functional groups present in the active compound in such a way that the modifications are cleaved, either in routine manipulation or in vivo , to the parent active compound.
• Prodrugs include compounds wherein a hydroxy, amino or mercapto group is bonded to any group that, when the prodrug of the active compound is administered to a subject, cleaves to form a free hydroxy, free amino or free mercapto group, respectively.
• prodrugs include, but are not limited to, acetate, formate and benzoate derivatives of an alcohol or acetamide, formamide and benzamide derivatives of an amine functional group in the active compound and the like. See Harper, “Drug Latentiation” in Jucker, ed. Progress in Drug Research 4:221-294 (1962); Morozowich et al,“Application of Physical Organic Principles to Prodrug Design” in E. B. Roche ed. Design of Biopharmaceutical Properties through Prodrugs and Analogs, APHA Acad. Pharm. Sci. 40 (1977); Bioreversible Carriers in Drug in Drug Design, Theory and Application, E. B. Roche, ed., APHA Acad. Pharm.
• an isolated peptide as described herein can be a pharmaceutically acceptable solvate.
• solvate refers to an isolated peptide as described herein in the solid state, wherein molecules of a suitable solvent are incorporated in the crystal lattice.
• a suitable solvent for therapeutic administration is physiologically tolerable at the dosage administered. Examples of suitable solvents for therapeutic administration are ethanol and water. When water is the solvent, the solvate is referred to as a hydrate.
• solvates are formed by dissolving the compound in the appropriate solvent and isolating the solvate by cooling or using an antisolvent. The solvate is typically dried or azeotroped under ambient conditions.
• an isolated peptide as described herein can be in a non crystalline, i.e. amorphous solid form.
• a vector comprising a nucleic acid encoding a peptide as described herein.
• the term “vector”, as used herein, refers to a nucleic acid construct designed for delivery to a host cell or for transfer between different host cells.
• a vector can be viral or non-viral.
• the term“vector” encompasses any genetic element that is capable of replication when associated with the proper control elements and that can transfer gene sequences to cells.
• a vector can include, but is not limited to, a cloning vector, an expression vector, a plasmid, phage, transposon, cosmid, chromosome, virus, virion, etc.
• the vectors can be episomal, e.g., plasmids, virus derived vectors such cytomegalovirus, adenovirus, etc., or can be integrated into the target cell genome, through homologous recombination or random integration, e.g., retrovirus derived vectors such MMLV, HIV-l, ALV, etc.
• Many viral vectors are known in the art and can be used as carriers of a nucleic acid modulatory compound into the cell.
• constructs containing the nucleic acid encoding a polypeptide can be integrated and packaged into non-replicating, defective viral genomes like Adenovirus, Adeno- associated virus (AAV), or Herpes simplex virus (HSV) or others, including retroviral and lentiviral vectors, for infection or transduction into cells.
• the construct can be incorporated into vectors capable of episomal replication, e.g. EPV and EBV vectors.
• the nucleic acid incorporated into the vector can be operatively linked to an expression control sequence such that the expression control sequence controls and regulates the transcription and translation of that polynucleotide sequence.
• expression vector refers to a vector that directs expression of an RNA or polypeptide from sequences linked to transcriptional regulatory sequences on the vector.
• sequences expressed will often, but not necessarily, be heterologous to the cell.
• An expression vector can comprise additional elements, for example, the expression vector can have two replication systems, thus allowing it to be maintained in two organisms, for example in human cells for expression and in a prokaryotic host for cloning and amplification.
• transfection as used herein to methods, such as chemical methods, to introduce exogenous nucleic acids, such as the nucleic acid sequences encoding a peptide as described herein into a cell.
• exogenous nucleic acids such as the nucleic acid sequences encoding a peptide as described herein into a cell.
• transfection does not encompass viral-based methods of introducing exogenous nucleic acids into a cell. Methods of transfection include physical treatments (electroporation, nanoparticles, magnetofection), and chemical-based transfection methods.
• Chemical-based transfection methods include, but are not limited to those that use cyclodextrin, polymers, liposomes, nanoparticles, cationic lipids or mixtures thereof (e.g., DOPA, Lipofectamine and UptiFectin), and cationic polymers, such as DEAE-dextran or poly ethy lenimine .
• the term“viral vector” refers to a nucleic acid vector construct that includes at least one element of viral origin and has the capacity to be packaged into a viral vector particle.
• the viral vector can contain the nucleic acid encoding a peptide as described herein in place of non-essential viral genes.
• the vector and/or particle can be utilized for the purpose of transferring any nucleic acids into cells either in vitro or in vivo. Numerous forms of viral vectors are known in the art.
• the term "replication incompetent" when used in reference to a viral vector means the viral vector cannot further replicate and package its genomes.
• the heterologous (also known as transgene) gene is expressed in the patient's cells, but, the rAAV is replication defective (e.g., lacks accessory genes that encode essential proteins for packaging the virus) and viral particles cannot be formed in the patient's cells.
• the term“transduction” as used herein refers to the use of viral particles or viruses to introduce exogenous nucleic acids into a cell.
• Retroviruses such as lentiviruses, provide a convenient platform for delivery of nucleic acid sequences encoding an agent of interest.
• a selected nucleic acid sequence can be inserted into a vector and packaged in retroviral particles using techniques known in the art.
• the recombinant virus can then be isolated and delivered to cells, e.g. in vitro or ex vivo.
• Retroviral systems are well known in the art and are described in, for example, U.S. Pat. No.
• a nucleotide sequence of interest is inserted into an adenovirus-based expression vector.
• adenoviruses persist extrachromosomally thus minimizing the risks associated with insertional mutagenesis (Haj-Ahmad and Graham (1986) J. Virol. 57:267-74; Bett et al. (1993) J. Virol. 67:5911-21; Mittereder et al. (1994) Human Gene Therapy 5:717-29; Seth et al. (1994) J. Virol. 68:933-40; Barr et al. (1994) Gene Therapy 1:51-58; Berkner, K. L.
• Adenoviral vectors have several advantages in gene therapy. They infect a wide variety of cells, have a broad host-range, exhibit high efficiencies of infectivity, direct expression of heterologous sequences at high levels, and achieve long-term expression of those sequences in vivo. The virus is fully infective as a cell-free virion so injection of producer cell lines is not necessary. With regard to safety, adenovirus is not associated with severe human pathology, and the recombinant vectors derived from the virus can be rendered replication defective by deletions in the early -region 1 (“El”) of the viral genome.
• El early -region 1
• Adenovirus can also be produced in large quantities with relative ease. For all these reasons vectors derived from human adenoviruses, in which at least the El region has been deleted and replaced by a gene of interest, have been used extensively for gene therapy experiments in the pre-clinical and clinical phase.
• Adenoviral vectors for use with the compositions and methods described herein can be derived from any of the various adenoviral serotypes, including, without limitation, any of the over 40 serotype strains of adenovirus, such as serotypes 2, 5, 12, 40, and 41.
• the adenoviral vectors of used in the methods described herein are generally replication-deficient and contain the sequence of interest under the control of a suitable promoter. For example, U.S. Pat. No.
• adenoviral vectors that include a human gene under the control of the Rous Sarcoma Virus (RSV) promoter.
• RSV Rous Sarcoma Virus
• Other recombinant adenoviruses of various serotypes, and comprising different promoter systems, can be created by those skilled in the art. See, e.g., U.S. Pat. No. 6,306,652, incorporated herein by reference in its entirety.
• Other useful adenovirus-based vectors for delivery of nucleic acid sequences include, but are not limited to: “minimal" adenovirus vectors as described in U.S. Pat. No.
• a nucleotide sequence encoding a peptide as described herein is inserted into an adeno-associated virus-based expression vector.
• AAV is a parvovirus which belongs to the genus Dependovirus and has several features not found in other viruses.
• AAV can infect a wide range of host cells, including non-dividing cells.
• AAV can infect cells from different species.
• AAV has not been associated with any human or animal disease and does not appear to alter the biological properties of the host cell upon integration. Indeed, it is estimated that 80-85% of the human population has been exposed to the virus.
• AAV is stable at a wide range of physical and chemical conditions, facilitating production, storage and transportation.
• AAV is a helper-dependent virus; that is, it requires co-infection with a helper virus (e.g., adenovirus, herpesvirus or vaccinia) in order to form AAV virions in the wild.
• helper virus e.g., adenovirus, herpesvirus or vaccinia
• AAV establishes a latent state in which the viral genome inserts into a host cell chromosome, but infectious virions are not produced.
• Subsequent infection by a helper virus rescues the integrated genome, allowing it to replicate and package its genome into infectious AAV virions.
• the helper virus While AAV can infect cells from different species, the helper virus must be of the same species as the host cell.
• Adeno-associated virus has been used with success in gene therapy.
• AAV has been engineered to deliver genes of interest by deleting the internal nonrepeating portion of the AAV genome (i.e., the rep and cap genes) and inserting a heterologous sequence (in this case, the sequence encoding the agent) between the ITRs.
• the heterologous sequence is typically functionally linked to a heterologous promoter (constitutive, cell- specific, or inducible) capable of driving expression in the patient's target cells under appropriate conditions.
• Recombinant AAV virions comprising a nucleic acid sequence encoding an agent of interest can be produced using a variety of art-recognized techniques, as described in U.S. Pat. Nos. 5,139,941; 5,622,856; 5,139,941; 6,001,650; and 6,004,797, the contents of each of which are incorporated by reference herein in their entireties.
• Vectors and cell lines necessary for preparing helper virus-free rAAV stocks are commercially available as the AAV Helper-Free System (Catalog No. 240071) (Agilent Technologies, Santa Clara, Calif.).
• Additional viral vectors useful for delivering nucleic acid molecules encoding a peptide as described herein include those derived from the pox family of viruses, including vaccinia virus and avian poxvirus.
• avipoxviruses such as the fowlpox and canarypox viruses, can be used to deliver the genes.
• the use of avipox vectors in cells of human and other mammalian species is advantageous with regard to safety because members of the avipox genus can only productively replicate in susceptible avian species.
• Molecular conjugate vectors such as the adenovirus chimeric vectors, can also be used for delivery of sequence encoding a peptide as described herein (Michael et al. (1993) J. Biol. Chem. 268:6866-69 and Wagner et al. (1992) Proc. Natl. Acad. Sci. USA 89:6099-6103).
• Members of the Alphavirus genus for example the Sindbis and Semliki Forest viruses, can also be used as viral vectors for delivering a nucleic acid sequence (See, e.g., Dubensky et al. (1996) J. Virol. 70:508-19; WO 95/07995; WO 96/17072).
• the vector further comprises a signal peptide operably linked to the peptide.
• Signal peptides are terminally (usually N-terminally) located peptide sequences that provide for passage of the protein into or through a membrane.
• Different signal peptides can be of use in different applications. For example, as regards a cellular system for the production of isolated peptides as described herein, a secretory signal peptide can permit increased yields and ease of purification.
• multiple signal peptides e.g.
• a peptide signaling for secretion from the first cell, a peptide signaling for internalization by a second cell, and a final peptide signaling for nuclear localization can increase the amount of peptide reaching the target environment.
• a peptide signaling for nuclear localization can increase the amount of peptide reaching the target environment.
• Signal peptides are known in the art.
• Non-limiting examples of nuclear localization signal (NLS) peptides for use in mammalian cells include; the SV40 large T-antigen NLS; the nucleoplasmin NLS; the K-K/R-X-K/R consensus NLS. Additional signal peptides are known in the art and the choice of signal peptide can be influenced by the cell type, growth conditions, and the desired destination of the peptide.
• the cell expressing a vector as described herein is a cell suitable for the production of polypeptides.
• a cell suitable for the production of polypeptides can be a prokaryotic or eukaryotic cell, e.g. bacteria, virus, yeast, fungi, mammalian cells, insect cells, plant cells, and the like.
• cells for the production of proteins are commercially available, e.g. bacterial cells (BL21 derived cells - Cat. No. 60401-1, Lucigen; Middleton, WI and mammalian cells (293 F cells - Cat. No. 11625-019, Invitrogen; Grand Island, NY).
• Recombinant molecules e.g. vectors as described herein, can be introduced into cells via transformation, particularly transduction, conjugation, lipofection, protoplast fusion, mobilization, particle bombardment, electroporation (Neumann et ah, “Gene Transfer into Mouse Lyoma Cells by Electroporation in High Electric Fields,” EMBO J. 1(7): 841-845 (1982); Wong et ah, “Electric Field Mediated Gene Transfer,” Biochem Biophys Res Commun 107 (2): 584-587 (1982); Potter et ah, “Enhancer-dependent Expression of Human Kappa Immunoglobulin Genes Introduced into Mouse pre-B Lymphocytes by Electroporation,” Proc.
• cultivation After cultivation, the cell is disrupted by physical or chemical means, and the protein or polypeptide purified from the resultant crude extract.
• cultivation may include conditions in which the protein or polypeptide is secreted into the growth medium of the recombinant host cell, and the protein or polypeptide is isolated from the growth medium.
• Alternative methods may be used as suitable.
• the peptides can also be attached to adjuvants.
• adjuvant refers to a compound or mixture that enhances the immune response and/or promotes the proper rate of absorption following inoculation, and, as used herein, encompasses any uptake-facilitating agent.
• adjuvants include, chemokines (e.g., defensins, HCC-l, HCC4, MCP-
• IL-17 A-F
• IL-18 IFNa, IFN-g; TNF-a; GM-CSF); TGFj-b; FFT-3 ligand; CD40 ligand; other ligands of receptors for those cytokines; Thl cytokines including, without limitation, IFN- g, IF-2, IF-12, IF-18, and TNF; Th2 cytokines including, without limitation, IF-4, IF-5, IF-10, and IF-13; and Thl7 cytokines including, without limitation, IF-17 (A through F), IF-23, TGF-b and IF-6; immuno stimulatory CpG motifs in bacterial DNA or oligonucleotides; derivatives of lipopoly saccharides such as monophosphoryl lipid A (MPF); muramyl dipeptide (MDP) and
• PCPP polymer poly[di(carboxylatophenoxy)phosphazene]
• RIBI RIBI
• MPF+TDM+CWS cell wall skeleton
• OM-174 a glucosamine disaccharide related to lipid A
• OM Pharma SA Meyrin, Switzerland
• heat shock proteins and derivatives thereof Feishmania homologs of elF4a and derivatives thereof
• bacterial ADP- ribosylating exotoxins and derivatives thereof e.g., genetic mutants, A and/or B subunit- containing fragments, chemically toxoided versions
• chemical conjugates or genetic recombinants containing bacterial ADP-ribosylating exotoxins or derivatives thereof C3d tandem array
• lipid ADP-ribosylating exotoxins or derivatives thereof C3d tandem array
• lipid ADP-ribosylating exotoxins or derivatives thereof C3d tandem array
• adjuvants can include the RIBI adjuvant system (Ribi Inc., Hamilton, MT.), alum, mineral gels such as aluminum hydroxide gel, oil-in-water emulsions, water-in-oil emulsions such as, e.g., Freund’s complete and incomplete adjuvants, Block co polymer (CytRx, Atlanta GA), QS-21 (Cambridge Biotech Inc., Cambridge MA), and SAF-M (Chiron, Emeryville CA), AMPHIGEN® adjuvant, saponin, Quil A or other saponin fraction, monophosphoryl lipid A, and Avridine lipid-amine adjuvant, and METASTIM®.
• RIBI adjuvant system Ribi Inc., Hamilton, MT.
• mineral gels such as aluminum hydroxide gel
• oil-in-water emulsions such as, e.g., Freund’s complete and incomplete adjuvants
• Block co polymer (CytRx, Atlanta GA),
• Suitable adjuvants can include, for example, surface active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil or hydrocarbon emulsions, keyhole limpet hemocyanins, dinitrophenol, and others.
• cell may be genetically engineered to express the peptides described herein and the genetically engineered cells may be used for cell therapy.
• cell therapy is also considered as ex vivo therapy.
• cells that may be used include but are not limited to, dendritic cells, T-lymphocytes (T-cells), naive T cells (T N ), memory T cells (for example, central memory T cells (T CM ), effector memory cells (T EM )), natural killer cells, hematopoietic stem cells and/or pluripotent embryonic/induced stem cells capable of giving rise to therapeutically relevant progeny.
• the genetically engineered cells are autologous cells.
• individual T-cells of the invention may be CD4+/CD8-, CD4-/CD8+, CD4-/CD8- or CD4+/CD8+.
• the T-cells may be a mixed population of CD4+/CD8- and CD4-/CD8+ cells or a population of a single clone.
• CD4+ T-cells may produce IL-2, IENg, TNFoc and other T-cell effector cytokines when co-cultured in vitro with cells expressing the peptides (for example CD20+ and/or CD19+ tumor cells).
• CD8 + T- cells may lyse antigen-specific target cells when co-cultured in vitro with the target cells.
• T cells may be any one or more of CD45RA + CD62L + naive cells, CD45RO + CD62L + central memory cells, CD62L effector memory cells or a combination thereof (Berger et al., Adoptive transfer of virus -specific and tumor- specific T cell immunity. Curr Opin Immunol 2009 21(2)224-232).
• tolerized antigen presenting cells may be used in cell therapy. Examples include B cells, dendritic cells, macrophages and the like. The cells may be of any origin, including from humans. The cells may be tolerized using the peptides described herein. In some embodiments, the cells are tolerized in the presence of cytokines.
• the cell producing the peptide as described herein can be administered to a subject, e.g. for treating, inhibiting, reducing the severity of and/or slow progression of cancer (SEQ ID NO: 1 and/or SEQ ID NO: 2).
• nanoparticles containing the peptide as described herein can be administrated to a subject.
• the nanoparticles for use with the peptides described herein may be as described in Levine et ah, Polymersomes: A new multi-functional tool for cancer diagnosis and therapy. Methods 2008 Vol 46 pg 25-32 or as described in S Jain, et ah, Gold nanoparticles as novel agents for cancer therapy. Br J Radiol. 2012 Feb; 85(1010): 101-113.
• the cell expressing a vector encoding a peptide as described herein can be a cell of a subject, e.g. a subject administered gene therapy for the treatment, inhibition, reduction of severity and/or slow progression of diabetes (such as type 2 diabetes mellitus).
• Vectors for gene therapy can comprise viral or non-viral vectors as described elsewhere herein.
• the present invention provides a pharmaceutical composition, comprising: compositions having one or more compounds of the invention; and a pharmaceutically acceptable carrier.
• the compound is one or more agonist of GITR (for example, peptides having the sequence set forth in SEQ ID NO: 1, SEQ ID NO: 2 or variants, derivatives or functional equivalents thereof, or compounds of Formula I).
• the compound is one or more antagonist of GITR (for example, compounds compounds of Formula II).
• compositions described herein can be provided in pharmaceutically acceptable compositions.
• These pharmaceutically acceptable compositions comprise a peptide and/or a compound capable of functioning as an agonist or antagonist of GITR as described herein formulated together with one or more pharmaceutically acceptable carriers (additives) and/or diluents.
• compositions of the present invention can be specially formulated for administration in solid or liquid form, including those adapted for the following: (1) oral administration, for example, drenches (aqueous or non-aqueous solutions or suspensions), gavages, lozenges, dragees, capsules, pills, tablets (e.g., those targeted for buccal, sublingual, and systemic absorption), boluses, powders, granules, pastes for application to the tongue; (2) parenteral administration, for example, by subcutaneous, intramuscular, intravenous or epidural injection as, for example, a sterile solution or suspension, or sustained-release formulation; (3) topical application, for example, as a cream, ointment, or a controlled-release patch or spray applied to the skin; (4) intrarectally, for example, as a pessary, cream or foam; (5) sublingually; (6) ocularly; (7) transdermally; (8) transmucosally; or (9) nasally
• oral administration for example,
• compounds can be implanted into a patient or injected using a drug delivery system. See, for example, Urquhart, et al., Ann. Rev. Pharmacol. Toxicol. 24: 199-236 (1984); Lewis, ed.“Controlled Release of Pesticides and Pharmaceuticals” (Plenum Press, New York, 1981); U.S. Pat. No. 3,773,919; and U.S. Pat. No. 35 3,270,960, contents of all of which are herein incorporated by reference.
• the term“pharmaceutically acceptable” refers to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
• the term “pharmaceutically-acceptable carrier” means a pharmaceutically-acceptable material, composition or vehicle, such as a liquid or solid filler, diluent, excipient, manufacturing aid (e.g., lubricant, talc magnesium, calcium or zinc stearate, or steric acid), or solvent encapsulating material, involved in carrying or transporting the subject compound from one organ, or portion of the body, to another organ, or portion of the body.
• manufacturing aid e.g., lubricant, talc magnesium, calcium or zinc stearate, or steric acid
• solvent encapsulating material involved in carrying or transporting the subject compound from one organ, or portion of the body, to another organ, or portion of the body.
• Each carrier must be“acceptable” in the sense of being compatible with the other ingredients of the formulation and not injurious to the patient.
• materials which can serve as pharmaceutically-acceptable carriers include: (1) sugars, such as lactose, glucose and sucrose; (2) starches, such as com starch and potato starch; (3) cellulose, and its derivatives, such as sodium carboxymethyl cellulose, methylcellulose, ethyl cellulose, microcrystalline cellulose and cellulose acetate; (4) powdered tragacanth; (5) malt; (6) gelatin; (7) lubricating agents, such as magnesium stearate, sodium lauryl sulfate and talc; (8) excipients, such as cocoa butter and suppository waxes; (9) oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, com oil and soybean oil; (10) glycols, such as propylene glycol; (11) polyols, such as glycerin, sorbitol, mannitol and polyethylene glycol (PEG); (12) esters, such as ethylene
• wetting agents, coloring agents, release agents, coating agents, sweetening agents, flavoring agents, perfuming agents, preservative and antioxidants can also be present in the formulation.
• the terms such as“excipient”,“carrier”,“pharmaceutically acceptable carrier” or the like are used interchangeably herein.
• compositions according to the invention can also be encapsulated, tableted or prepared in an emulsion or symp for oral administration.
• Pharmaceutically acceptable solid or liquid carriers may be added to enhance or stabilize the composition, or to facilitate preparation of the composition.
• Liquid carriers include syrup, peanut oil, olive oil, glycerin, saline, alcohols and water.
• Solid carriers include starch, lactose, calcium sulfate, dihydrate, terra alba, magnesium stearate or stearic acid, talc, pectin, acacia, agar or gelatin.
• the carrier may also include a sustained release material such as glyceryl monostearate or glyceryl distearate, alone or with a wax.
• compositions are made following the conventional techniques of pharmacy involving dry milling, mixing, and blending for powder forms; milling, mixing, granulation, and compressing, when necessary, for tablet forms; or milling, mixing and filling for hard gelatin capsule forms.
• a liquid carrier When a liquid carrier is used, the preparation will be in the form of a syrup, elixir, emulsion or an aqueous or non-aqueous suspension.
• Such a liquid formulation may be administered directly p.o. or filled into a soft gelatin capsule.
• formulants may be added to the composition.
• a liquid formulation may be preferred.
• these formulants may include oils, polymers, vitamins, carbohydrates, amino acids, salts, buffers, albumin, surfactants, bulking agents or combinations thereof.
• Carbohydrate formulants include sugar or sugar alcohols such as monosaccharides, disaccharides, or polysaccharides, or water soluble glucans.
• the saccharides or glucans can include fructose, dextrose, lactose, glucose, mannose, sorbose, xylose, maltose, sucrose, dextran, pullulan, dextrin, alpha and beta cyclodextrin, soluble starch, hydroxethyl starch and carboxymethylcellulose, or mixtures thereof.
• “Sugar alcohol” is defined as a C4 to C8 hydrocarbon having an -OH group and includes galactitol, inositol, mannitol, xylitol, sorbitol, glycerol, and arabitol. These sugars or sugar alcohols mentioned above may be used individually or in combination. There is no fixed limit to amount used as long as the sugar or sugar alcohol is soluble in the aqueous preparation. In one embodiment, the sugar or sugar alcohol concentration is between 1.0 w/v % and 7.0 w/v %, more preferable between 2.0 and 6.0 w/v %.
• Amino acids formulants include levorotary (L) forms of carnitine, arginine, and betaine; however, other amino acids may be added.
• Polymers formulants include polyvinylpyrrolidone (PVP) with an average molecular weight between 2,000 and 3,000, or polyethylene glycol (PEG) with an average molecular weight between 3,000 and 5,000.
• PVP polyvinylpyrrolidone
• PEG polyethylene glycol
• a buffer in the composition it is also preferred to use a buffer in the composition to minimize pH changes in the solution before lyophilization or after reconstitution.
• Most any physiological buffer may be used including but not limited to citrate, phosphate, succinate, and glutamate buffers or mixtures thereof.
• the concentration is from 0.01 to 0.3 molar.
• Surfactants that can be added to the formulation are shown in EP Nos. 270,799 and 268,110.
• liposome Another drug delivery system for increasing circulatory half-life is the liposome.
• Methods of preparing liposome delivery systems are discussed in Gabizon et al., Cancer Research (1982) 42:4734; Cafiso, Biochem Biophys Acta (1981) 649:129; and Szoka, Ann Rev Biophys Eng (1980) 9:467.
• Other drug delivery systems are known in the art and are described in, e.g., Poznansky et ah, DRUG DELIVERY SYSTEMS (R. L. Juliano, ed., Oxford, N.Y. 1980), pp. 253-315; M. L. Poznansky, Pharm Revs (1984) 36:277.
• the liquid pharmaceutical composition may be lyophilized to prevent degradation and to preserve sterility.
• Methods for lyophilizing liquid compositions are known to those of ordinary skill in the art.
• the composition may be reconstituted with a sterile diluent (Ringer’s solution, distilled water, or sterile saline, for example) which may include additional ingredients.
• a sterile diluent Finger’s solution, distilled water, or sterile saline, for example
• the composition is administered to subjects using those methods that are known to those skilled in the art.
• compositions of the invention may be sterilized by conventional, well-known sterilization techniques.
• the resulting solutions may be packaged for use or filtered under aseptic conditions and lyophilized, the lyophilized preparation being combined with a sterile solution prior to administration.
• the compositions may contain pharmaceutically-acceptable auxiliary substances as required to approximate physiological conditions, such as pH adjusting and buffering agents, tonicity adjusting agents and the like, for example, sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chloride, and stabilizers (e.g., 1-20% maltose, etc.).
• a therapeutically effective amount means that amount of an agent, compound, material, or composition comprising the same which is effective for producing some desired therapeutic effect in at least a sub-population of cells in an animal at a reasonable benefit/risk ratio applicable to a medical treatment. Determination of a therapeutically effective amount is well within the capability of those skilled in the art. Generally, a therapeutically effective amount can vary with the subject’s history, age, condition, well as the severity and type of the medical condition in the subject, and administration of
• the amount of the composition comprising a peptide and/or a compound capable of functioning as an agonist or antagonist of GITR as described herein that can be combined with a carrier material to produce a single dosage form will generally be that amount of the agent that produces a therapeutic effect. Generally out of one hundred percent, this amount will range from about 0.01% to 99% of agent, preferably from about 5% to about 70%, most preferably from 10% to about 30%.
• Toxicity and therapeutic efficacy can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the LD50 (the dose lethal to 50% of the population) and the ED5o (the dose therapeutically effective in 50% of the population).
• the dose ratio between toxic and therapeutic effects is the therapeutic index and it can be expressed as the ratio LD50/ED50.
• Compositions that exhibit large therapeutic indices are preferred.
• ED denotes effective dose and is used in connection with animal models.
• EC denotes effective concentration and is used in connection with in vitro models.
• the data obtained from the cell culture assays and animal studies can be used in formulating a range of dosage for use in humans.
• the dosage of such compounds lies preferably within a range of circulating concentrations that include the ED50 with little or no toxicity.
• the dosage may vary within this range depending upon the dosage form employed and the route of administration utilized.
• the therapeutically effective dose can be estimated initially from cell culture assays.
• a dose may be formulated in animal models to achieve a circulating plasma concentration range that includes the IC50 (i.e., the concentration of the therapeutic which achieves a half-maximal inhibition of symptoms) as determined in cell culture.
• IC50 i.e., the concentration of the therapeutic which achieves a half-maximal inhibition of symptoms
• Levels in plasma can be measured, for example, by high performance liquid chromatography.
• the effects of any particular dosage can be monitored by a suitable bioassay.
• the dosage can be determined by a physician and adjusted, as necessary, to suit observed effects of the treatment.
• the compositions are administered so that the agent is given at a dose from 1 pg/kg to 150 mg/kg, 1 pg/kg to 100 mg/kg, 1 pg/kg to 50 mg/kg, 1 pg/kg to 20 mg/kg, 1 pg/kg to 10 mg/kg, lpg/kg to lmg/kg, 100 pg/kg to 100 mg/kg, 100 pg/kg to 50 mg/kg, 100 pg/kg to 20 mg/kg, 100 pg/kg to 10 mg/kg, lOOpg/kg to lmg/kg, 1 mg/kg to 100 mg/kg, 1 mg/kg to 50 mg/kg, 1 mg/kg to 20 mg/kg, 1 mg/kg to 10 mg/kg, 10 mg/kg to 100 mg/kg, 10 mg/kg to 50 mg/kg, or 10 mg/kg to 20 mg/kg.
• ranges given here include all intermediate ranges, for example, the range 1 tmg/kg to 10 mg/kg includes 1 mg/kg to 2 mg/kg, 1 mg/kg to 3 mg/kg, 1 mg/kg to 4 mg/kg, 1 mg/kg to 5 mg/kg, 1 mg/kg to 6 mg/kg, 1 mg/kg to 7 mg/kg, 1 mg/kg to 8 mg/kg, 1 mg/kg to 9 mg/kg, 2mg/kg to lOmg/kg, 3 mg/kg to lOmg/kg, 4mg/kg to lOmg/kg, 5mg/kg to lOmg/kg, 6mg/kg to lOmg/kg, 7mg/kg to lOmg/kg, 8mg/kg to lOmg/kg, 9mg/kg to lOmg/kg , and the like.
• ranges intermediate to the given above are also within the scope of this invention, for example, in the range lmg/kg to 10 mg/kg, dose ranges such as 2mg/kg to 8 mg/kg, 3mg/kg to 7 mg/kg, 4mg/kg to 6mg/kg , and the like.
• the compositions are administered at a dosage so that agent or a metabolite thereof has an in vivo concentration of less than 500nM, less than 400nM, less than 300 nM, less than 250 nM, less than 200 nM, less than 150 nM, less than 100 nM, less than 50 nM, less than 25 nM, less than 20, nM, less than 10 nM, less than 5nM, less than 1 nM, less than 0.5 nM, less than O.
• lnM less than 0.05, less than 0.01, nM, less than 0.005 nM, less than 0.001 nM after 15 mins, 30 mins, 1 hr, 1.5 hrs, 2 hrs, 2.5 hrs, 3 hrs, 4 hrs, 5 hrs, 6 hrs, 7 hrs, 8 hrs, 9 hrs, 10 hrs, 11 hrs, 12 hrs or more of time of administration.
• the dosing schedule can vary from once a week to daily depending on a number of clinical factors, such as the subject's sensitivity to the polypeptides.
• the desired dose can be administered every day or every third, fourth, fifth, or sixth day.
• the desired dose can be administered at one time or divided into subdoses, e.g., 2-4 subdoses and administered over a period of time, e.g., at appropriate intervals through the day or other appropriate schedule.
• Such sub-doses can be administered as unit dosage forms.
• administration is chronic, e.g., one or more doses daily over a period of weeks or months.
• dosing schedules are administration daily, twice daily, three times daily or four or more times daily over a period of 1 week, 2 weeks, 3 weeks, 4 weeks, 1 month, 2 months, 3 months, 4 months, 5 months, or 6 months or more.
• Contacting refers to any method that is suitable for placing the agent on, in or adjacent to a target cell.
• contact the cells with the agent can comprise adding the agent to culture medium containing the cells.
• contacting the cells with the agent can comprise administering the agent to the subject.
• administering refers to the placement of an agent or a composition as disclosed herein into a subject by a method or route which results in at least partial localization of the agents or composition at a desired site such that a desired effect is produced.
• Routes of administration suitable for the methods of the invention include both local and systemic administration. Generally, local administration results in more of the composition being delivered to a specific location as compared to the entire body of the subject, whereas, systemic administration results in delivery to essentially the entire body of the subject.
• “Route of administration” may refer to any administration pathway known in the art, including but not limited to oral, topical, aerosol, nasal, via inhalation, anal, intra-anal, peri-anal, transmucosal, transdermal, parenteral, enteral, or local.
• Parenteral refers to a route of administration that is generally associated with injection, including intratumoral, intracranial, intraventricular, intrathecal, epidural, intradural, intraorbital, infusion, intracapsular, intracardiac, intradermal, intramuscular, intraperitoneal, intrapulmonary, intraspinal, intrastemal, intrathecal, intravascular, intravenous, intraarterial, subarachnoid, subcapsular, subcutaneous, transmucosal, or transtracheal.
• the agent or composition may be in the form of solutions or suspensions for infusion or for injection, or as lyophilized powders.
• the agent or composition can be in the form of capsules, gel capsules, tablets, sugar-coated tablets, syrups, suspensions, solutions, powders, granules, emulsions, microspheres, nanoparticles comprised of proteineous or non-pro teineous components or nanospheres or lipid vesicles or polymer vesicles allowing controlled release.
• the agent or composition can be in the form of aerosol, lotion, cream, gel, ointment, suspensions, solutions or emulsions.
• agent or composition may be provided in a powder form and mixed with a liquid, such as water, to form a beverage.
• administering can be self-administering.
• a subject consumes a composition as disclosed herein.
• Exemplary modes of administration include, but are not limited to, injection, infusion, instillation, inhalation, or ingestion.
• injection includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intraventricular, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, sub capsular, subarachnoid, intraspinal, intracerebro spinal, and intrastemal injection and infusion.
• the compositions are administered by intravenous infusion or injection.
• A“pharmaceutically acceptable salt”, as used herein, is intended to encompass any compound described herein that is utilized in the form of a salt thereof, especially where the salt confers on the compound improved pharmacokinetic properties as compared to the free form of compound or a different salt form of the compound.
• the pharmaceutically acceptable salt form can also initially confer desirable pharmacokinetic properties on the compound that it did not previously possess, and may even positively affect the pharmacodynamics of the compound with respect to its therapeutic activity in the body.
• An example of a pharmacokinetic property that can be favorably affected is the manner in which the compound is transported across cell membranes, which in turn may directly and positively affect the absorption, distribution, biotransformation and excretion of the compound.
• the solubility of the compound is usually dependent upon the character of the particular salt form thereof, which it utilized.
• an aqueous solution of the compound will provide the most rapid absorption of the compound into the body of a subject being treated, while lipid solutions and suspensions, as well as solid dosage forms, will result in less rapid absorption of the compound.
• Pharmaceutically acceptable salts include those derived from inorganic acids such as sulfuric, sulfamic, phosphoric, nitric, and the like; and the salts prepared from organic acids such as acetic, propionic, succinic, glycolic, stearic, lactic, malic, tartaric, citric, ascorbic, palmitic, maleic, hydroxy maleic, phenylacetic, glutamic, benzoic, salicyclic, sulfanilic, 2-acetoxybenzoic, fumaric, toluenesulfonic, methanesulfonic, ethane disulfonic, oxalic, isothionic, and the like.
• inorganic acids such as sulfuric, sulfamic, phosphoric, nitric, and the like
• organic acids such as acetic, propionic, succinic, glycolic, stearic, lactic, malic, tartaric, citric, ascorbic, palmitic
• Exemplary salts also include the hydrobromide, hydrochloride, sulfate, bisulfate, phosphate, nitrate, acetate, succinate, valerate, oleate, palmitate, stearate, laurate, benzoate, lactate, phosphate, tosylate, citrate, maleate, fumarate, succinate, tartrate, napthylate, mesylate, glucoheptonate, lactobionate, and laurylsulphonate salts and the like.
• Suitable acids which are capable of forming salts with the compounds of the disclosure include inorganic acids such as hydrochloric acid, hydrobromic acid, perchloric acid, nitric acid, thiocyanic acid, sulfuric acid, phosphoric acid, and the like; and organic acids such as l,2-ethanedisulfonic acid, 2-hydroxy ethanesulfonic acid, 2- naphthalenesulfonic acid, 3-phenylpropionic acid, 4-methylbicyclo[2.2.2]oct-2-ene-l-carboxylic acid, 4,4’-mefhylenebis(3-hydroxy-2-ene-l-carboxylic acid), acetic acid, anthranilic acid, benzenesulfonic acid, benzoic acid, camphorsulfonic acid, cinnamic acid, citric acid, cyclopentanepropionic acid, ethanesulfonic acid, formic acid, fumaric acid, glucohepton
• Suitable bases capable of forming salts with the compounds of the disclosure include inorganic bases such as sodium hydroxide, ammonium hydroxide, sodium carbonate, calcium hydroxide, potassium hydroxide and the like; and organic bases such as mono-, di- and tri-alkyl and aryl amines (e.g., triethylamine, diisopropyl amine, methyl amine, dimethyl amine, N-methylglucamine, pyridine, picoline, dicyclohexylamine, N,N’-dibezylethylenediamine, and the like), and optionally substituted ethanol-amines (e.g., ethanolamine, diethanolamine, trierhanolamine and the like).
• inorganic bases such as sodium hydroxide, ammonium hydroxide, sodium carbonate, calcium hydroxide, potassium hydroxide and the like
• organic bases such as mono-, di- and tri-alkyl and aryl amines (e.g., triethyl
• prodrug refers to compounds that can be converted via some chemical or physiological process (e.g., enzymatic processes and metabolic hydrolysis) to compound described herein.
• prodrug also refers to a precursor of a biologically active compound that is pharmaceutically acceptable.
• a prodrug can be inactive when administered to a subject, i.e. an ester, but is converted in vivo to an active compound, for example, by hydrolysis to the free carboxylic acid or free hydroxyl.
• the prodrug compound often offers advantages of solubility, tissue compatibility or delayed release in an organism.
• prodrug is also meant to include any covalently bonded carriers, which release the active compound in vivo when such prodrug is administered to a subject.
• Prodrugs of an active compound, as described herein may be prepared by modifying functional groups present in the active compound in such a way that the modifications are cleaved, either in routine manipulation or in vivo, to the parent active compound.
• Prodrugs include compounds wherein a hydroxy, amino or mercapto group is bonded to any group that, when the prodrug of the active compound is administered to a subject, cleaves to form a free hydroxy, free amino or free mercapto group, respectively.
• a compound comprising a hydroxy group can be administered as an ester that is converted by hydrolysis in vivo to the hydroxy compound.
• Suitable esters that can be converted in vivo into hydroxy compounds include acetates, citrates, lactates, tartrates, malonates, oxalates, salicylates, propionates, succinates, fumarates, formates, benzoates, maleates, methylene-bis-b-hydroxynaphthoates, gentisates, isethionates, di-p-toluoyltartrates, methanesulfonates, ethanesulfonates, benzenesulfonates, p-toluenesulfonates, cyclohexylsulfamates, quinates, esters of amino acids, and the like.
• a compound comprising an amine group can be administered as an amide, e.g., acetamide, formamide and benzamide that is converted by hydrolysis in vivo to the amine compound.
• an amide e.g., acetamide, formamide and benzamide that is converted by hydrolysis in vivo to the amine compound.
• the present invention provides a method for treating, inhibiting, reducing the severity of, preventing metastasis of and/or slowing progression of cancer in a subject in need thereof.
• the methods include administering to the subject a therapeutically effective amount of an agonist of GITR.
• the agonist is a peptide having the sequence set forth in SEQ ID NO: 1.
• the agonist is a peptide having the sequence set forth in SEQ ID NO: 2.
• the methods include administering to the subject a therapeutically effective amount of a composition comprising the peptide having the sequence set forth in SEQ ID NO: 1 and SEQ ID NO: 2.
• the GITR agonists are administered in combination with existing therapies for cancer. In some embodiments, the GITR agonists and the existing therapies are co administered or administered sequentially. In one embodiment, the GITR agonist is administered prior to administration of existing therapies for cancer. In some embodiments, the GITR agonist is administered after administration of existing therapies for cancer. In a further embodiment, the GITR agonist is co-administered with current therapies for cancer.
• the methods include administering to the subject a therapeutically effective amount of an agonist of GITR.
• the agonist is a peptide having the sequence set forth in SEQ ID NO: 1.
• the agonist is a peptide having the sequence set forth in SEQ ID NO: 2.
• the methods include administering to the subject a therapeutically effective amount of a composition comprising the peptide having the sequence set forth in SEQ ID NO: 1 and SEQ ID NO: 2.
• the GITR agonists for use in treating cancer are compounds having the structures set forth in Formula I.
• the invention is directed to administering to a patient suffering from cancer a sample of cells that have been enriched for T-effector cells, wherein the enrichment is achieved by contacting T-effector cells with a GITR agonist such as set forth in Formula I, together with or without T-reg cells.
• a GITR agonist such as set forth in Formula I
• the T-effector or T-reg cells may be autologous or allogeneic to the patient.
• the GITR agonist may be the RMGL171102, aka 11702 compound.
• the cancer is B-cell lymphomas (Hodgkin’s lymphomas and/or non-Hodgkins lymphomas), brain tumor, breast cancer, colon cancer, lung cancer, hepatocellular cancer, gastric cancer, pancreatic cancer, cervical cancer, ovarian cancer, liver cancer, bladder cancer, cancer of the urinary tract, thyroid cancer, renal cancer, carcinoma, melanoma, head and neck cancer, brain cancer, and prostate cancer, androgen-dependent prostate cancer and androgen-independent prostate cancer, and in particular, melanoma or lymphoma.
• B-cell lymphomas Hodgkin’s lymphomas and/or non-Hodgkins lymphomas
• brain tumor breast cancer
• colon cancer lung cancer
• gastric cancer pancreatic cancer
• cervical cancer ovarian cancer
• liver cancer bladder cancer
• cancer of the urinary tract thyroid cancer
• renal cancer carcinoma
• melanoma head and neck cancer
• brain cancer and prostate cancer
• androgen-dependent prostate cancer and androgen-independent prostate cancer
• the methods include administering to the subject a therapeutically effective amount of GITR antagonists.
• the GITR antagonists for use in treating inflammatory disease such as autoimmune diseases are compounds having the structures set forth in Formula II.
• the invention is directed to administering to a patient suffering from an inflammatory disease, in particular an autoimmune disease a sample of cells that have been enriched for T-reg cells, or wherein T-eff cells have become modified, wherein the enrichment is achieved by contacting T-effector cells with a GITR antagonist such as set forth in Formula II, together with or without T-reg cells.
• a GITR antagonist such as set forth in Formula II
• the T-effector or T-reg cells may be autologous or allogeneic to the patient.
• the GITR antagonist may be the RMGL171104, aka 11704 compound.
• the GITR antagonists are administered in combination with existing therapies for autoimmune diseases. In some embodiments, the GITR antagonists and the existing therapies are co-administered or simultaneously. In one embodiment, the GITR antagonist is administered prior to administration of existing therapies for autoimmune diseases. In some embodiments, the GITR antagonist is administered after administration of existing therapies for autoimmune diseases. In a further embodiment, the GITR antagonist is co administered with current therapies for inflammatory diseases or autoimmune diseases.
• the inflammatory disease is acute or chronic pancreatitis
• autoimmune disease is rheumatoid arthritis, osteoarthritis, asthma, dermatitis, psoriasis, cystic fibrosis, post transplantation late and chronic solid organ rejection, multiple sclerosis, systemic lupus erythematosus, Sjogren's syndrome, Hashimoto thyroiditis, polymyositis, scleroderma, Addison disease, vitiligo, pernicious anemia, glomerulonephritis and pulmonary fibrosis, inflammatory bowel diseases, autoimmune diabetes, diabetic retinopathy, rhinitis, ischemia-reperfusion injury, post- angioplasty restenosis, chronic obstructive pulmonary diseases (COPD), Grave's disease, gastrointestinal allergies, conjunctivitis, atherosclerosis, coronary artery disease, angina, cancer metastasis, small artery disease, COPD), Grave's disease, gastrointestinal
• existing treatments for cancer include but are not limited to chemotherapy, radiation therapy, hormonal therapy, surgery, immunotherapy or combinations thereof.
• chemotherapeutic agents may be selected from any one or more of cytotoxic antibiotics, antimetabolities, anti-mitotic agents, alkylating agents, arsenic compounds, DNA topoisomerase inhibitors, taxanes, nucleoside analogues, plant alkaloids, and toxins; and synthetic derivatives thereof.
• Exemplary compounds include, but are not limited to, alkylating agents: treosulfan, and trofosfamide; plant alkaloids: vinblastine, paclitaxel, docetaxol; DNA topoisomerase inhibitors: doxorubicin, epirubicin, etoposide, camptothecin, topotecan, irinotecan, teniposide, crisnatol, and mitomycin; anti-folates: methotrexate, mycophenolic acid, and hydroxyurea; pyrimidine analogs: 5-fluorouracil, doxifluridine, and cytosine arabinoside; purine analogs: mercaptopurine and thioguanine; DNA antimetabolites: 2’-deoxy-5- fluorouridine, aphidicolin glycinate, and pyrazoloimidazole; and antimitotic agents: halichondrin, colchicine, and rhizoxin.
• compositions comprising one or more chemotherapeutic agents (e.g., FLAG, CHOP) may also be used.
• FLAG comprises fludarabine, cytosine arabinoside (Ara-C) and G-CSF.
• CHOP comprises cyclophosphamide, vincristine, doxorubicin, and prednisone.
• PARP e.g., PARP-l and/or PARP-2
• inhibitors are well known in the art (e.g., Olaparib, ABT-888, BSI-201, BGP-15 (N-Gene Research Laboratories, Inc.); INO-1001 (Inotek Pharmaceuticals Inc.); PJ34 (Soriano et ah, 2001; Pacher et ah, 2002b); 3-aminobenzamide (Trevigen); 4-amino- l,8-naphthalimide; (Trevigen); 6(5H)-phenanthridinone (Trevigen); benzamide (U.S. Pat. Re. 36,397); and NU1025 (Bowman et al.).
• radiation therapy can be ionizing radiation.
• Radiation therapy can also be gamma rays, X-rays, or proton beams.
• Examples of radiation therapy include, but are not limited to, external-beam radiation therapy, interstitial implantation of radioisotopes (1-125, palladium, iridium), radioisotopes such as strontium-89, thoracic radiation therapy, intraperitoneal P-32 radiation therapy, and/or total abdominal and pelvic radiation therapy.
• the radiation therapy can be administered as external beam radiation or tele-therapy wherein the radiation is directed from a remote source.
• the radiation treatment can also be administered as internal therapy or brachytherapy wherein a radioactive source is placed inside the body close to cancer cells or a tumor mass.
• photodynamic therapy comprising the administration of photosensitizers, such as hematoporphyrin and its derivatives, Vertoporfin (BPD-MA), phthalocyanine, photosensitizer Pc4, demethoxy-hypocrellin A; and 2BA-2-DMHA.
• immunotherapy may comprise, for example, use of cancer vaccines and/or sensitized antigen presenting cells.
• therapies include targeting cells in the tumor microenvironment or targeting immune cells.
• the immunotherapy can involve passive immunity for short-term protection of a host, achieved by the administration of pre-formed antibody directed against a cancer antigen or disease antigen (e.g., administration of a monoclonal antibody, optionally linked to a chemotherapeutic agent or toxin, to a tumor antigen). Immunotherapy can also focus on using the cytotoxic lymphocyte-recognized epitopes of cancer cell lines.
• hormonal therapy can include, for example, hormonal agonists, hormonal antagonists (e.g., flutamide, bicalutamide, tamoxifen, raloxifene, leuprolide acetate (LUPRON), LH-RH antagonists), inhibitors of hormone biosynthesis and processing, and steroids (e.g., dexamethasone, retinoids, deltoids, betamethasone, cortisol, cortisone, prednisone, dehydrotestosterone, glucocorticoids, mineralocorticoids, estrogen, testosterone, progestins), vitamin A derivatives (e.g., all-trans retinoic acid (ATRA)); vitamin D3 analogs; antigestagens (e.g., mifepristone, onapristone), or antiandrogens (e.g., cyproterone acetate).
• hormonal antagonists e.g., flutamide, bicalutamide, tamoxifen,
• existing therapies for autoimmune diseases include but are not limited to physical therapy, non-steroidal anti-inflammatory drugs (NSAIDs), corticosteroids, disease-modifying anti-inflammatory drugs (DMARDs), anti-cytokine therapies, inhibition of intracellular-signaling pathways, costimulation inhibition, biological inhibitors of T cell function, B-cell anergy and depletion, regulatory T cells, stem cell transplantation and/or hematopoietic stem cell transplantation.
• NSAIDs non-steroidal anti-inflammatory drugs
• DMARDs disease-modifying anti-inflammatory drugs
• anti-cytokine therapies inhibition of intracellular-signaling pathways, costimulation inhibition, biological inhibitors of T cell function, B-cell anergy and depletion, regulatory T cells, stem cell transplantation and/or hematopoietic stem cell transplantation.
• the one or more GITR agonists or the GITR antagonists as described herein can be used in combination with other current or future drug therapies, because the effects of the one or more GITR agonists or the GITR antagonists as described herein alone may be less optimal by itself, and/or can be synergistic or more highly effective in combination with therapies acting on distinct pathways which interact functionally with the one or more GITR agonists or the GITR antagonists as described herein.
• conjoint administration of the one or more GITR agonists or the GITR antagonists as described herein with an additional drug therapy reduces the dose of the additional drug therapy such that it is less than the amount that achieves a therapeutic effect when used in a monotherapy.
• the one or more GITR agonists described herein may be combined (sequentially or simultaneously) with checkpoint inhibitors.
• immune checkpoint inhibitors for use with the GITR agonists described herein include but are not limited to anti-PD-l antibodies such as Lambrolizumab(MK-3475), Nivolumab (B MS-936558) and Pidilizumab (CT-011), anti-PD-Ll antibodies such as MPDL3280A(RG7446), MEDI4736 and BMS-936559, anti-PD-L2 antibodies, B7-DC-Fc fusion proteins such as AMP-224, anti-CTLA-4 antibodies such as tremelimumab (CP-675,206) and ipilimumab (MDX-010), antibodies against the B7/CD28 receptor superfamily, anti-Indoleamine (2,3)-dioxygenase (IDO) antibodies, anti-IDOl antibodies, anti-IDOl antibodies, anti-IDOl antibodies, anti
• Creelan BC Update on immune checkpoint inhibitors in lung cancer, Cancer Control. 2014 Jan;2l(l):80-9
• Jane de Lartigue Another Immune Checkpoint Emerges as Anticancer Target, Published online by onclive.com, Tuesday, September 24, 2013
• the immune checkpoint inhibitor is selected from the group consisting of an antibody against PD-l, an antibody against PD-L1, an antibody against PD-L2, an antibody against CTLA-4, an antibody against KIR, an antibody against IDOl, an antibody against ID02, an antibody against TIM-3, an antibody against LAG-3, an antibody against OX40R, and an antibody against PS, or a combination thereof.
• the GITR antagonists as described herein can be used in combination with existing therapies which increase the levels of Treg cells.
• the GITR antagonist may be used in combination (sequentially or simultaneously) with TNF inhibitors including monoclonal antibodies such as infliximab (Remicade), adalimumab (Humira), certolizumab pegol (Cimzia), and golimumab (Simponi), or with a circulating receptor fusion protein such as etanercept (Enbrel).
• the present invention provides a kit for treating cancers and inflammatory diseases such as autoimmune diseases.
• the kit comprises one or more GITR agonists (for treating cancer) or the GITR antagonists (for treating autoimmune diseases) and instructions for use.
• the kit is configured particularly for human subjects.
• the kit is configured for veterinary applications, treating subjects such as, but not limited to, farm animals, domestic animals, and laboratory animals.
• Instructions for use may be included in the kit.
• “Instructions for use” typically include a tangible expression describing the technique to be employed in using the components of the kit to effect a desired outcome, such as to treat cancers or autoimmune diseases.
• the kit also contains other useful components, such as, measuring tools, diluents, buffers, pharmaceutical compositions, pharmaceutically acceptable carriers, syringes or other useful paraphernalia as will be readily recognized by those of skill in the art.
• the materials or components assembled in the kit can be provided to the practitioner stored in any convenient and suitable ways that preserve their operability and utility.
• the components can be in dissolved, dehydrated, or lyophilized form; they can be provided at room, refrigerated or frozen temperatures.
• the components are typically contained in suitable packaging material(s).
• packaging material refers to one or more physical structures used to house the contents of the kit, such as inventive compositions and the like.
• the packaging material is constructed by well-known methods, preferably to provide a sterile, contaminant-free environment.
• the term “package” refers to a suitable solid matrix or material such as glass, plastic, paper, foil, and the like, capable of holding the individual kit components.
• the packaging material generally has an external label which indicates the contents and/or purpose of the kit and/or its components.
• Example 1 - GITR agonist reduces Treg population in human blood
• CD4 + CD25 CFES + population was measured in a T cell suppression assay when mixed with Treg cells in the setting of T cell activation by antigen presenting cells. Control results show T regulatory cells can inhibit 15% of T cell proliferation.
• GITR agonist effects dose dependent expansion of T effector cells and its activity is more effective in the presence of Tregs suggesting its impact on T effectors and Tregs.
• GITRL antagonist 11704 effects dose dependent retraction of T effector cells and its activity is more effective in the presence of Tregs suggesting its impact on T effectors and T regs.
• Example 2 T cell suppression assay (in vitro human cell)
• PBMC peripheral blood mononuclear cells
• T effector cells CD4 + CD25 cells
• CD4 + CD25 + CD45RA + CDl27 cells T regulatory cells
• CD3 cells servinge as Antigen Presenting Cells, APC.
• T effector cells were labeled with CellTrace CFSE (Invitrogen), heavily washed before cell number counting.
• Effector cells and T-regs were then mixed together at 1:1 ratio in culture media (RPMI 1640, l0%FBS, Pen-Strep and 1% NEAA) which enhanced with anti-CD3 (3ug/ml) anti-CD28 (2ug/ml) antibodies.
• APCs were treated with Mitomycin (50ug/ml) for 30 minutes at 37 °C, 5% C0 2 incubator, then added to culture mix (APC:T-eff 2: 1) as a proliferation co- stimulator.
• Cell mixture was incubated at 37 °C, 5% C0 2 for 6 days before being re-stained with T cell surface markers (CD4, CD25) and sent for FACS analysis (FIGS. 1A-1B, 4 and 5).
• Molecule 11702 and 11704 were added to treat groups respectively at a concentration gradient of 5uM, 25uM and 50uM.
• CFSE peaks extend successively to left and become less fluorescent (toward negative range). The more cell population moves to left, the stronger the proliferation.
• T-reg involved, molecule starts to show more effective inhibition of T cell expanding at 25uM (decreases 33.9%) and most effectively at 50uM (decreases 55.9% of proliferation compared to base line) (FIGS. 3D-3F, 4 and 5).
• Example 5 - GITR agonist 11702 inhibits melanoma growth through Teff proliferation and Treg inhibition in the tumor

Landscapes

• Health & Medical Sciences (AREA)
• Life Sciences & Earth Sciences (AREA)
• Veterinary Medicine (AREA)
• Public Health (AREA)
• General Health & Medical Sciences (AREA)
• Animal Behavior & Ethology (AREA)
• Pharmacology & Pharmacy (AREA)
• Medicinal Chemistry (AREA)
• Chemical & Material Sciences (AREA)
• Epidemiology (AREA)
• Organic Chemistry (AREA)
• Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
• General Chemical & Material Sciences (AREA)
• Chemical Kinetics & Catalysis (AREA)
• Engineering & Computer Science (AREA)
• Bioinformatics & Cheminformatics (AREA)
• Molecular Biology (AREA)
• Immunology (AREA)
• Pain & Pain Management (AREA)
• Rheumatology (AREA)
• Oncology (AREA)
• Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
• Medicines Containing Material From Animals Or Micro-Organisms (AREA)
• Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
• Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
• Micro-Organisms Or Cultivation Processes Thereof (AREA)
• Peptides Or Proteins (AREA)
• Cell Biology (AREA)
• Hematology (AREA)
• Biomedical Technology (AREA)
• Biotechnology (AREA)
• Developmental Biology & Embryology (AREA)
• Virology (AREA)
• Zoology (AREA)

Priority Applications (9)

Applications Claiming Priority (2)

Publications (1)

Family

ID=69415674

Family Applications (1)

Country Status (7)

Cited By (2)

Citations (9)

Family Cites Families (3)

• 2019
  • 2019-08-08 KR KR1020217006602A patent/KR102753455B1/ko active Active
  • 2019-08-08 JP JP2021506687A patent/JP7530346B2/ja active Active
  • 2019-08-08 CN CN201980062092.7A patent/CN112739314A/zh active Pending
  • 2019-08-08 KR KR1020257000546A patent/KR20250025409A/ko active Pending
  • 2019-08-08 CA CA3108796A patent/CA3108796A1/en active Pending
  • 2019-08-08 EP EP19848154.1A patent/EP3833323A4/en active Pending
  • 2019-08-08 US US17/266,488 patent/US20210299176A1/en active Pending
  • 2019-08-08 CN CN202410436075.8A patent/CN118662499A/zh active Pending
  • 2019-08-08 WO PCT/US2019/045742 patent/WO2020033715A1/en not_active Ceased
• 2024
  • 2024-07-26 JP JP2024120839A patent/JP2024156758A/ja active Pending

Patent Citations (9)

Non-Patent Citations (25)

Also Published As

Similar Documents

Legal Events