WO2019224717A2 - Anti-cd3 antibodies and uses thereof - Google Patents
Anti-cd3 antibodies and uses thereof Download PDFInfo
- Publication number
- WO2019224717A2 WO2019224717A2 PCT/IB2019/054188 IB2019054188W WO2019224717A2 WO 2019224717 A2 WO2019224717 A2 WO 2019224717A2 IB 2019054188 W IB2019054188 W IB 2019054188W WO 2019224717 A2 WO2019224717 A2 WO 2019224717A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- seq
- antigen
- antibodies
- nos
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2809—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39541—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against normal tissues, cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2866—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3069—Reproductive system, e.g. ovaria, uterus, testes, prostate
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/51—Complete heavy chain or Fd fragment, i.e. VH + CH1
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/515—Complete light chain, i.e. VL + CL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/71—Decreased effector function due to an Fc-modification
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/75—Agonist effect on antigen
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
Definitions
- the disclosure provided herein relates to anti-cluster of differentiation 3 (CD3)- antibodies, and antigen-binding fragments thereof, capable of specifically binding to human and non-human CD3, and in particular to anti-CD3 antibodies and antigen-binding fragments that are cross-reactive with CD3 of a non-human mammal (e.g., a cynomolgus monkey); prostate specific membrane antigen (PSMA)-antibodies, and antigen-binding fragments thereof, capable of specifically binding to human and non-human PSMA; IL1RAP antibodies, and antigen binding fragments thereof, capable of specifically binding to human and non-human IL1RAP; CD33 antibodies, and antigen-binding fragments thereof, capable of specifically binding to human and non-human CD33; and bispecific antibodies that are capable of specifically binding CD3; PSMA; IL1RAP; CD33; CD3 and PSMA; CD3 and IL1RAP; or CD3 and CD33.
- the disclosure also pertains to uses of such antibodies and antigen-
- bispecific antibodies and antibody fragments have been explored as a means to recruit cytolytic T cells to kill tumor cells.
- the clinical use of many T cell-recruiting bispecific antibodies has been limited by challenges including unfavorable pharmacokinetics, potential immunogenicity, and manufacturing issues. There thus exists a considerable need for bispecific antibodies that recruit cytolytic T cells to kill tumor cells that exhibit reduced toxicity and favorable manufacturing profiles.
- the human CD3 T cell antigen receptor protein complex is composed of six distinct chains: a CD3y chain (SwissProt P09693), a CD35 chain (SwissProt P04234), two CD3e chains (SwissProt P07766), and one O03z chain homodimer (SwissProt P20963) (e g: e d:zz), which is associated with the T cell receptor a and b chain.
- This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways.
- the CD3 complex mediates signal transduction, resulting in T cell activation and proliferation. CD3 is required for immune response.
- isolated recombinant anti-CD3 antibodies comprising: a heavy chain comprising a heavy chain complementarity determining region (HCDR) 1 comprising SEQ ID NO: 662; a HCDR2 comprising SEQ ID NO: 663; and a HCDR3 comprising SEQ ID NO: 664 and a light chain comprising a light chain complementarity determining region (LCDR) 1 comprising SEQ ID NO: 671, a LCDR2 comprising SEQ ID NO: 673, and a LCDR3 comprising SEQ ID NO: 690; a heavy chain variable region comprising SEQ ID NO: 652 and a light chain variable region comprising SEQ ID NO: 661; a heavy chain comprising SEQ ID NO: 640 and a light chain comprising SEQ ID NO: 676; or comprising: a heavy chain comprising a HCDR1 comprising SEQ ID NO: 662; a HCDR2 comprising SEQ ID NO:
- isolated recombinant anti-CD3 antibodies or antigen-binding fragments thereof that specifically bind Macaca fascicularis or human CD3d, or CD3e, or CD3e and CD3d with a binding affinity of about 300 nM or less.
- the isolated recombinant anti-CD3 antibodies or antigen-binding fragments thereof have one, two, three, or four, of the following properties:
- the antibodies or antigen-binding fragments thereof described herein comprise the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2, and the LCDR3 of SEQ ID NOs:662, 663, 664, 671, 673, and 690, respectively; a VH and a VL of SEQ ID NOs:652 and 661, respectively; or a HC and a LC of SEQ ID NOs:640 and 676, respectively.
- the antibodes or antigen-binding fragments thereof described herein comprise the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2, and the LCDR3 of SEQ ID NOs:662, 663, 664, 773, 673, and 690, respectively; a VH and a VL of SEQ ID NOs:657 and 678, respectively or a HC and a LC of SEQ ID NOs:675 and 677, respectively.
- bispecific antibodies comprising a first domain that specifically binds CD3 and a second domain that specifically binds a second antigen, wherein the first domain comprises an antibody or antigen-binding fragment thereof described herein.
- the bispecific antibodies described herein can comprise a first domain that comprises the HCDR1, HCDR2, the HCDR3, the LCDR1 , the LCDR2, and the LCDR3 of SEQ ID NOs:662, 663, 664, 671, 673, and 670, respectively; and a second domain that comprises the the HCDR1, HCDR2, the HCDR3, the LCDR1, the LCDR2, and the LCDR3 of SEQ ID NOs:697, 683, 698, 699, 792, and 686, respectively;
- the bispecific antibodies described herein can comprise a first domain that comprises the VH and VL of SEQ ID NOs:652 and 661, respectively; and a second domain that comprises the VH and VL of SEQ ID NOs:68l and 682, respectively.
- the bispecific antibodies described herein can comprise a first domain that comprises the HC and LC of SEQ ID NOs:640 and 676, respectively; and a second domain that comprises the HC and LC of SEQ ID NOs:679 and 680, respectively.
- the bispecific antibodies described herein can comprise a first domain that comprises the HCDR1, HCDR2, the HCDR3, the LCDR1 , the LCDR2, and the LCDR3 of SEQ ID NOs:662, 663, 664, 671, 673, and 670, respectively; and a second domain that comprises the the HCDR1, HCDR2, the HCDR3, the LCDR1, the LCDR2, and the LCDR3 of SEQ ID NOs:704, 705, 706, 707, 708, and 709, respectively.
- the bispecific antibodies described herein can comprise a first domain that comprises the VH and VL of SEQ ID NOs:652 and 661, respectively; and a second domain that comprises the VH and VL of SEQ ID NOs:702 and 703, respectively.
- the bispecific antibodies described herein can comprise a first domain that comprises the HC and LC of SEQ ID NOs:640 and 676, respectively; and a second domain that comprises the HC and LC of SEQ ID NOs:700 and 701, respectively.
- the disclosure further provides isolated bispecific CD3 xPSMA antibodies comprising a first domain that binds to cells expressing recombinant Macaca fascicularis or human CD3d or CD3e with an affinity of 300 nM or less, wherein the binding to cells is measured by flow cytometry, and a second domain that specifically bind PSMA.
- the bispecific CD3 /PSMA antibody comprises a first domain that:
- compositions comprising the antibodies described herein and a pharmaceutically acceptable carrier.
- the disclosure further provides methods of producing the antibodies described herein, comprising culturing a host cell comprising a vector comprising a polynuceotide encoding the antibodies or antigen-binding fragments thereof described herein in conditions that the antibody is expressed, and recovering the antibody produced by the host cell.
- the methods of producing the bispecific CD3 xPSMA antibody can comprise combining a monospecific bivalent CD3 antibody having two identical HC1 and two identical LC1 and a monospecific bivalent PSMA antibody having two identical HC2 and two identical LC2 in a mixture of about 1 : 1 molar ratio; introducing a reducing agent into the mixture; incubating the mixture about ninety minutes to about six hours; removing the reducing agent; and purifying the bispecific CD3 xPSMA antibody that comprises the HC1, the LC1, the HC2 and the LC2.
- kits comprising the antibodies described herein.
- the kits can further comprise reagents for detecting the antibodies and instructions of use.
- Figs. 1A and IB show anti-CD3 antibodies produced in OmniRat.
- VH Fig. 1 A
- VL Fig. 1B
- sequences of active anti-CD3 mAbs produced in OmniRat were aligned with human germline sequences from IMGT. CDR regions are underlined. Sequence divergence is shown in bold.
- Fig. 1A discloses SEQ ID NOS 651, 651, 653, 656, 655, 20, 654 and 717
- Fig. 1B discloses SEQ ID NOS 658, 688, 660, 659, 659, 659, 659 and 718, all respectively, in order of appearance.
- Fig. 2 shows a cell-based binding assay to assess the binding capacity of individual rat hybridoma supernatants to human purified CD3+ T lymphocytes.
- Fig. 3 shows a cell-based binding assay to assess the binding capacity of individual rat hybridoma supernatants to cynomolgus purified CD3+ T lymphocytes.
- Fig. 4 shows competition assay results of hybridoma supernatants assessed for their ability to compete with commercial anti-human CD3 antibody SP34-2, which has a known epitope and is cross-reactive with cynomolgus CD3.
- Fig. 5 shows representative binding curves of anti-CD3 antibodies on primary human T cells.
- Fig. 6 shows representative competition binding curves of anti-CD3 antibodies with AlexaFluor 488 conjugated SP34-2 on primary human T cells.
- Fig. 7 shows binding of light chain (LC) engineered BLW-2E6 mAbs to primary human
- Fig. 8 shows binding of heavy chain (HC) engineered BLW-2E6 to primary human T cells.
- IC50 values were derived to be 29 and 60 nM respectively.
- Fig. 11 shows sensorgrams of BLW-2E6 variants binding to hCD3e(l-27)-Tn25.
- Figs. 12A-12E shows thermal stability of anti-CD3 antibodies CD3B376 (Fig. 12A),
- CD3B450 (Fig. 12B), CD3B389 (Fig. 12C), CD3B467 by DSC (Fig. 12D), and overlay of the thermograms for all the candidates (Fig. 12E).
- Figs. 13A-13C show comparisons of the thermal stability of anti-CD3 antibodies overlay of thermograms for CD3B376 and CD3B389 (Fig. 13A); overlay of thermograms for CD3B450 and CD3B467 (Fig. 13B); and overlay of thermograms for CD3B376, CD3B450 and CD3B219 (Fig. 13C).
- Fig. 14 shows LNCAP cell binding of a subset of affinity-matured PSMA/CD3 bispecific antibodies.
- Fig. 15 shows LNCAP cell binding of a subset of affinity-matured PSMA/CD3 bispecific antibodies.
- Fig. 16 shows PSMA-negative PC3 cell binding results of affinity-matured PSMA/CD3 bispecific antibodies.
- Fig. 17 shows results of PSMA*CD3 Affinity Matured Bispecific Abs in a Functional Cell Killing Assay.
- Fig. 19 shows antibody-antigen interactions in the CD3B334:CD3 complex.
- CD3 residues are in ellipses, CD3B334 residues are in boxes.
- Fig. 20 shows a primary human and cynomolgus monkey T cell based assay used to determine the capacity of the hybridoma hits to activate T cells as measured by CD69 activation.
- Fig. 21 shows anti-tumor efficacy of PS3B79 in LnCAP AR.TB human prostate xenografts in T cell humanized NSG mice.
- Subcutaneous LnCAP AR.TB tumors were measured twice weekly and the results presented as the mean tumor volume, expressed in mm 3 ⁇ SEM (*, pO.OOOl).
- Fig. 22 shows anti -tumor efficacy of PS3B90 in LnCAP AR.TB human prostate xenografts in T cell humanized NSG mice.
- Subcutaneous LnCAP AR.TB tumors were measured twice weekly and the results presented as the mean tumor volume, expressed in mm 3 ⁇ SEM (*, p ⁇ 0.00l).
- Figs. 23A-23D show titration curves for Anti-PSMA phage panning hits binding to human LNCaP cells.
- Fig. 23A shows titration curves for hits G9-PSM Ml 8, M25, M50, M52, M56, M57, and M59;
- Fig. 23B shows M52 and Ml 10; Fig.
- Fig. 23C shows M85, M87, and M81; and Fig. 23D shows M52 and M84.
- Fig. 23D Mammalian-expressed supernatants were normalized for Fab expression via octet, and titrated against either human LNCAP, PSMG5 (Cyno-PSMA HEK), or PSMG9 (chimp-PSMA HEK) cells using flowcytometry.
- Geometric mean fluorescence intensity (GeoMFI) was ploted vs. Fab concertation using GraphPad Prizm.
- Figs. 24A-24D show titration curves for Anti-PSMA phage panning hits binding to Chimpanzee-PSMA expressing HEK cells shows.
- Fig. 24A shows titration curves for hits G9-PSM Ml 8, M25, M50, M52, M56, M57, and M59;
- Fig. 24B shows M52 and Ml 10;
- Fig. 24C shows M81, M52, M85, and M87; and
- Fig. 24D shows M52 and M84.
- Fig. 24D shows M52 and M84.
- Mammalian-expressed supernatants were normalized for Fab expression via octet, and titrated against either human LNCAP, PSMG5 (Cyno-PSMA HEK), or PSMG9 (chimp-PSMA HEK) cells using flowcytometry.
- Geometric mean fluorescence intensity was ploted vs. Fab concertation using GraphPad Prizm.
- Figs. 25A-25D show titration curves for Anti-PSMA phage panning hits binding to Cynomolgus monkey PSMA-expressing HEK cells.
- Fig. 25A shows titration curves for hits G9-PSM Ml 8, M25, M50, M52, M56, M57, and M59;
- Fig. 25B shows M52 and Ml 10;
- Fig. 25C shows M81, M52, M85, and M87; and
- Fig. 25D shows M52 and M84.
- Fig. 26 shows the overall structure of PSMM84 Fab bound to human PSMA ECD homodimer.
- Fig. 27 shows a close view of PSMA main interactions with the PSMB83 Light Chain.
- Fig. 28 shows a close view of PSMA main interactions with the PSMB83 Heavy Chain.
- Fig. 29 shows the comparison of epitope residues of PSMB83 within the sequences of human (SEQ ID NO: 719), mouse (SEQ ID NO: 720) and cynomolgus monkey (cyno) (SEQ ID NO: 721) PSMA. Epitope residues are shaded and sequence divergence is shown by underline.
- Fig. 30 shows the paratope residues of PSMB83. CDRs are underlined and paratope residues are shaded. Fig. 30 discloses SEQ ID NOS 722-727, respectively, in order of appearance.
- Fig. 31 shows an interaction map with direct contacts made between PSMA and
- Fig. 32 shows expression levels of anti-PSMA Fab clones derived from PSMM84 as compared to expression of parent PSMB83. Raw luminescence numbers were plotted against the log concentration
- Fig. 33 shows binding to human PSMA of anti-PSMA Fab clones derived from PSMB83 as compared to binding of parent PSMM84.
- Raw luminescence numbers were plotted against the log concentration.
- Fig. 34 shows binding to cyno PSMA of anti-PSMA Fab clones derived from PSMB83 as compared to binding of parent PSMB83.
- Raw luminescence numbers were plotted against the log concentration.
- Fig. 35 shows IC3B19 and IC3B34 Ex Vivo Mediated T cell Cytotoxicity of LAMA-84 cells in Whole Blood after 48 hours.
- the concentration of IC3B19 and IC3B34 is provided in the table in the lower part of the figure.
- Fig. 36 shows IC3B19 and IC3B34 Ex Vivo Mediated T-cell Activation in Whole Blood after 48 hours.
- the concentration of IC3B19 and IC3B34 is provided in the table in the lower part of the figure.
- Figs. 37-56 show IC3B19 and IC3B34 mediated engagement of T cells and IL1RAP+ target cell line LAMA-84 (endogenous and exogenously added tumor cells).
- Figs. 37A-37B show T cell IL-lbeta release mediated by IC3B19 and IC3B34 (Fig. 37A) and corresponding 4PL regression parameter estimates (Fig. 37B) after 24 hours.
- Figs. 38A-38B show T cell IL-lbeta release mediated by IC3B19 and IC3B34 (Fig. 38A) and corresponding 4PL regression parameter estimates (Fig. 38B) after 48 hours.
- Figs. 39A-39B show T cell IL-2 release mediated by IC3B19 and IC3B34 (Fig. 39A) and corresponding 4PL regression parameter estimates (Fig. 39B) after 24 hours.
- Figs. 40A-40B show T cell IL-2 release mediated by IC3B19 and IC3B34 (Fig. 40A) and corresponding 4PL regression parameter estimates (Fig. 40B) after 48 hours.
- Figs. 41A-41B show T cell IL-4 release mediated by IC3B19 and IC3B34 (Fig. 41 A) and corresponding 4PL regression parameter estimates (Fig. 41B) after 24 hours.
- Fig. 42 shows T cell IL-4 release mediated by IC3B19 and IC3B34 after 48 hours.
- Figs. 43A-43B show T cell IL-6 release mediated by IC3B19 and IC3B34 (Fig. 43A) and corresponding 4PL regression parameter estimates (Fig. 43B) after 24 hours.
- Fig. 44 shows T cell IL-6 release mediated by IC3B19 and IC3B34 after 48 hours.
- Fig. 45 shows T cell IL-8 release mediated by IC3B19 and IC3B34 after 24 hours.
- Fig. 46 shows T cell IL-8 release mediated by IC3B19 and IC3B34 after 48 hours.
- Figs. 47A-47B show T cell IL-10 release mediated by IC3B19 and IC3B34 (Fig. 47 A) and corresponding 4PL regression parameter estimates (Fig. 47B) after 24 hours.
- Figs. 48A-48B show T cell IL-10 release mediated by IC3B19 and IC3B34 (Fig. 48A) and corresponding 4PL regression parameter estimates (Fig. 48B) after 48 hours.
- Fig. 49 shows T cell IL-l2p70 release mediated by IC3B19 and IC3B34 after 24 hours.
- Fig. 50 shows T cell IL-l2p70 release mediated by IC3B19 and IC3B34 after 48 hours.
- Fig. 51 shows T cell IL-13 release mediated by IC3B19 and IC3B34 after 24 hours.
- Figs. 52A-52B show T cell IL-13 release mediated by IC3B19 and IC3B34 (Fig. 52A) and corresponding 4PL regression parameter estimates (Fig. 52B) after 48 hours.
- Figs. 53A-53B show T cell IFN-gamma release mediated by IC3B19 and IC3B34 (Fig. 53A) and corresponding 4PL regression parameter estimates (Fig. 53B) after 24 hours.
- Figs. 54A-54B show T cell IFN-gamma release mediated by IC3B19 and IC3B34 (Fig. 54A) and corresponding 4PL regression parameter estimates (Fig. 54B) after 48 hours.
- Figs. 55A-55B show T cell TNF-alpha release mediated by IC3B19 and IC3B34 (Fig. 55A) and corresponding 4PL regression parameter estimates (Fig. 55B) after 24 hours.
- Figs. 56A-56B show T cell TNF-alpha release mediated by IC3B19 and IC3B34 (Fig. 56A) and corresponding 4PL regression parameter estimates (Fig. 56BB) after 48 hours.
- Fig. 57 shows IC3B19 and IC3B34, but not the bispecific antibodies with null arms (IAPB57/B23B49 or B23B39/CD3B219), induced target specific cytotoxicity in NCI-H1975 cells.
- the cytotoxicity EC50s vary three-fold between IC3B19 and IC3B34, with values of 0.018 and 0.057 nM, respectively.
- Fig. 58 shows Anti-Tumor Efficacy of IAPB57xCD3B376 in H1975 Human NSCLC
- Fig. 59 shows a comparison of isoelectric points for various anti-PSMA constructs.
- Fig. 60 plots change in wavelength compared to CNT05825 control molecule. Control
- CNTO607 shows characteristically strong self-interaction. Error bars represent standard deviations from triplicate measurements.
- Fig. 61 shows a comparison of retention times on IgG and control columns in an anti- PSMA cross-interaction assay.
- Figs. 62A-62B show ex vivo assessment of CD33xCD3 bispecific antibodies using anti-
- FIG. 2A shows the percent of total cell cytotoxicity of AML cells using CD33 bispecific antibodies or the CD3xnull controls.
- FIG. 2B shows T cell activation induced by CD33 bispecific antibodies or the CD3xnull controls. No Fc blocker was added.
- Figs. 63A-63C show CD33xCD3 T-cell mediated cytotoxicity assays.
- CD33xCD3 bispecific antibodies using anti-CD3 arm CD3B219 and anti-CD3B376 were incubated with human pan T cells and AML cell lines that are either wildtype (KG1, FIG. 3 A), heterozygous (SH2, FIG. 3B) or homozygous (OCIAML3, FIG. 3C) for the CD33 SNP rsl24594l9 mutation. After 48 hr at 37°C, 5% CO2, total tumor cell cytotoxicity was measured by flow cytometry.
- Figs. 64A-64B show ex vivo assessment of C33B904 antibodies paired with either
- Figs. 65A-65B show ex vivo assessment of CD33xCD3 bispecific antibodies using anti-
- FIG. 5A shows the percent of total cell cytotoxicity of CD33 + CDl4 + cyno monocytes using CD33 bispecific antibodies or their CD3xnull controls.
- FIG. 5B shows T cell activation induced by CD33 bispecific antibodies or their CD3xnull controls. No Fc blocker was added.
- Fig. 66 shows anti-tumor efficacy of C3CB189 in MOLM-13 human AML xenografts in
- Fig. 67 shows survival of animals treated with C3CB189 in MOLM-13 Human AML xenografts in T cell humanized NSG mice. Survival of MOLM-13 bearing mice is graphically represented using a Kaplan-Meier curve and evaluated by Log-rank (Mantel-Cox) test. *p ⁇ 0.0001 for treatment vs. control groups.
- Fig. 68 shows anti-tumor efficacy of C3CB88 in MOLM-13 human AML xenografts in T cell humanized NSG mice.
- Fig. 69 shows survival of animals treated with C3CB88 in MOLM-13 human AML xenografts in T cell humanized NSG mice. Survival of MOLM-13 bearing mice is graphically represented using a Kaplan-Meier curve and evaluated by Log-rank (Mantel-Cox) test. *p ⁇ 0.05 for treatment vs. control groups.
- FIG. 70 shows the alignment of select anti-TMEFF2 antibody heavy chain variable regions (VH).
- VH regions are identified by their SEQ ID NO: at the beginning of each row.
- FIG 71 shows the alignment of select anti-TMEFF2 antibody light chain variable regions (VL).
- VL select anti-TMEFF2 antibody light chain variable regions
- Figure 72 shows the reduction in mean tumor volume of each mouse treated with 0.5 mg/kg TMCB132 in an ex vivo LnCaP prostate cancer model in male NGS mice.
- Figure 73 shows efficacy of TMEB762xCD3B376 in established LNCaP Xenografts in T Cell Humanized NS G Mice.
- Figure 74 shows T-cell activation in LnCaP prostatec cancer cells in response to administration of TMCB132.
- Figure 75 shows T cell-mediated cytotoxicity of TMCB132.
- Figure 76 shows the antitumor efficacity of TMCB132 in T-cell humanized mice.
- “Specific binding” or“specifically binds” or“binds” refers to an antibody binding to an antigen or an epitope within the antigen with greater affinity than for other antigens.
- the antibody binds to the antigen or the epitope within the antigen with an equilibrium dissociation constant (KD) of about 5x10 -8 M or less, for example about lxl 0 -9 M or less, about lxl O -10 M or less, about lxl 0 -11 M or less, or about lxl 0 -12 M or less, typically with the KD that is at least one hundred-fold less than its KD for binding to a non-specific antigen (e.g., BSA, casein).
- the dissociation constant may be measured using standard procedures.
- Antibodies that specifically bind to the antigen or the epitope within the antigen may, however, have cross reactivity to other related antigens, for example to the same antigen from other species
- homologs such as human or monkey, for example Macaca fascicularis (cynomolgus, cyno) or Pan troglodytes (chimpanzee, chimp). While a monospecific antibody specifically binds one antigen or one epitope, a bispecific antibody specifically binds two distinct antigens or two distinct epitopes.
- Antibodies is meant in a broad sense and includes immunoglobulin molecules including monoclonal antibodies including murine, human, humanized and chimeric monoclonal antibodies, antigen binding fragments, bispecific or multispecific antibodies, dimeric, tetrameric or multimeric antibodies, single chain antibodies, domain antibodies and any other modified configuration of the immunoglobulin molecule that comprises an antigen binding site of the required specificity.
- “Full length antibody molecules” are comprised of two heavy chains (HC) and two light chains (LC) inter-connected by disulfide bonds as well as multimers thereof (e.g. IgM). Each heavy chain is comprised of a heavy chain variable region (VH) and a heavy chain constant region (comprised of domains CH1, hinge, CH2 and CH3).
- Each light chain is comprised of a light chain variable region (VL) and a light chain constant region (CL).
- VL light chain variable region
- CL light chain constant region
- the VH and the VL regions may be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with framework regions (FR).
- CDR complementarity determining regions
- FR framework regions
- Each VH and VL is composed of three CDRs and four FR segments, arranged from amino-to-carboxy- terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4.
- CDR complementarity determining regions
- CDR CDR
- HCDR1 CDR1
- HCDR2 CDR3
- LCDR1 CDR2
- LCDR3 CDR3
- Immunoglobulins may be assigned to five major classes, IgA, IgD, IgE, IgG and IgM, depending on the heavy chain constant domain amino acid sequence.
- IgA and IgG are further sub-classified as the isotypes IgAl, IgA2, IgGl, IgG2, IgG3 and IgG4.
- Antibody light chains of any vertebrate species may be assigned to one of two clearly distinct types, namely kappa (K) and lambda (l), based on the amino acid sequences of their constant domains.
- Antigen binding fragment refers to a portion of an immunoglobulin molecule that binds an antigen.
- Antigen binding fragments may be synthetic, enzymatically obtainable or genetically engineered polypeptides and include the VH, the VL, the VH and the VL, Fab, F(ab')2, Fd and Fv fragments, domain antibodies (dAb) consisting of one VH domain or one VH domain, shark variable IgNAR domains, camelized VH domains, minimal recognition units consisting of the amino acid residues that mimic the CDRs of an antibody, such as FR3-CDR3-FR4 portions, the HCDR1, the HCDR2 and/or the HCDR3 and the LCDR1, the LCDR2 and/or the LCDR3.
- VH and VH domains may be linked together via a synthetic linker to form various types of single chain antibody designs where the VFHVH domains may pair intramolecularly, or
- a monovalent antigen binding site such as single chain Fv (scFv) or diabody; described for example in Int. Patent Publ. Nos. W01998/44001,
- “Monoclonal antibody” refers to an antibody obtained from a substantially homogenous population of antibody molecules, i.e., the individual antibodies comprising the population are identical except for possible well-known alterations such as removal of C-terminal lysine from the antibody heavy chain or post-translational modifications such as amino acid isomerization or deamidation, methionine oxidation or asparagine or glutamine deamidation.
- Monoclonal antibodies typically bind one antigenic epitope.
- a bispecific monoclonal antibody binds two distinct antigenic epitopes.
- Monoclonal antibodies may have heterogeneous glycosylation within the antibody population.
- Monoclonal antibody may be monospecific or multispecific such as bispecific, monovalent, bivalent or multivalent.
- Isolated antibody refers to an antibody or antibody fragment that is substantially free of other antibodies having different antigenic specificities (e.g., an isolated antibody specifically binding an antigen is substantially free of antibodies that specifically bind antigens other than the antigen). In the case of bispecific CD3 antibodies, the bispecific antibody specifically binds both CD3 a second antigen. “Isolated antibody” encompasses antibodies that are isolated to a higher purity, such as antibodies that are 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%,
- Humanized antibody refers to an antibody in which at least one CDR is derived from non-human species and at least one framework is derived from human immunoglobulin sequences. Humanized antibody may include substitutions in the frameworks so that the frameworks may not be exact copies of expressed human immunoglobulin or human
- Human antibody refers to an antibody that is optimized to have minimal immune response when administered to a human subject. Variable regions of human antibody are derived from human immunoglobulin sequences. If human antibody contains a constant region or a portion of the constant region, the constant region is also derived from human
- Human antibody comprises heavy and light chain variable regions that are“derived from” sequences of human origin if the variable regions of the human antibody are obtained from a system that uses human germline immunoglobulin or rearranged
- immunoglobulin genes Such exemplary systems are human immunoglobulin gene libraries displayed on phage, and transgenic non-human animals such as mice or rats carrying human immunoglobulin loci.
- Human antibody typically contains amino acid differences when compared to the immunoglobulins expressed in humans due to differences between the systems used to obtain the human antibody and human immunoglobulin loci, introduction of somatic mutations or intentional introduction of substitutions into the frameworks or CDRs, or both.
- “human antibody” is at least about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%,
- “human antibody” may contain consensus framework sequences derived from human framework sequence analyses, for example as described in Knappik et al., (2000) J Mol Biol 296:57-86, or synthetic HCDR3 incorporated into human immunoglobulin gene libraries displayed on phage, for example as described in Shi et al., (2010) J Mol Biol 397:385-96, and in Int. Patent Publ. No. W02009/085462.
- Percent (%) amino acid sequence identity with respect to a reference polypeptide sequence is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
- % amino acid sequence identify values are generated using the sequence comparison computer program ALIGN-2.
- the ALIGN-2 sequence comparison computer program was authored by Genentech. Inc., and the source code has been filed with user documentation in the U.S. Copyright Office, Washington D.C., 20559, where it is registered under U.S. Copyright Registration No. TXU510087.
- the ALIGN-2 program is publicly available from Genentech. Inc., South San Francisco, Calif., or may be compiled from the source code.
- ALIGN-2 The ALIGN-2 program should be compiled for use on a UNIX operating system, including digital UNIX V4.0D. All sequence comparison parameters are set by the ALIGN-2 program and do not vary. Where ALIGN-2 is employed for amino acid sequence comparisons, the % amino acid sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B (which can alternatively be phrased as a given amino acid sequence A that has or comprises a certain % amino acid sequence identity to, with, or against a given amino acid sequence B) is calculated as follows:
- Antibodies in which antigen binding sites are derived from a non-human species are not included in the definition of“human antibody”.
- “Recombinant” refers to DNA, antibodies and other proteins that are prepared, expressed, created or isolated by recombinant means when segments from different sources are joined to produce recombinant DNA, antibodies or proteins.
- Epitope refers to a portion of an antigen to which an antibody specifically binds.
- Epitopes typically consist of chemically active (such as polar, non-polar or hydrophobic) surface groupings of moieties such as amino acids or polysaccharide side chains and may have specific three-dimensional structural characteristics, as well as specific charge characteristics.
- An epitope may be composed of contiguous and/or discontiguous amino acids that form a conformational spatial unit. For a discontiguous epitope, amino acids from differing portions of the linear sequence of the antigen come in close proximity in 3 -dimensional space through the folding of the protein molecule.
- Antibody“epitope” depends on the methodology used to identify the epitope.
- “Paratope” refers to a portion of an antibody to which an antigen specifically binds.
- a paratope may be linear in nature or may be discontinuous, formed by a spatial relationship between non-contiguous amino acids of an antibody rather than a linear series of amino acids.
- a “light chain paratope” and a“heavy chain paratope” or“light chain paratope amino acid residues” and“heavy chain paratope amino acid residues” refer to antibody light chain and heavy chain residues in contact with an antigen, respectively, or in general,“antibody paratope residues” refer to those antibody amino acids that are in contact with antigen.
- Bispecific refers to an antibody that specifically binds two distinct antigens or two distinct epitopes within the same antigen.
- the bispecific antibody may have cross-reactivity to other related antigens, for example to the same antigen from other species (homologs), such as human or monkey, for example Macaca fascicularis (cynomolgus, cyno) or Pan troglodytes, or may bind an epitope that is shared between two or more distinct antigens.
- Multispecific refers to an antibody that specifically binds two or more distinct antigens or two or more distinct epitopes within the same antigen.
- the multispecific antibody may have cross-reactivity to other related antigens, for example to the same antigen from other species (homologs), such as human or monkey, for example Macaca fascicularis (cynomolgus, cyno) or Pan troglodytes, or may bind an epitope that is shared between two or more distinct antigens.
- “Variant” refers to a polypeptide or a polynucleotide that differs from a reference polypeptide or a reference polynucleotide by one or more modifications, for example one or more substitutions, insertions or deletions.
- Vector refers to a polynucleotide capable of being duplicated within a biological system or that can be moved between such systems.
- Vector polynucleotides typically contain elements, such as origins of replication, promoter, polyadenylation signal and selection markers, that function to facilitate the duplication or maintenance of these polynucleotides in a biological system, such as a cell, virus, animal, plant, and reconstituted biological systems utilizing biological components capable of duplicating a vector.
- the vector polynucleotide may be DNA or RNA molecules or a hybrid of these, single stranded or double stranded.
- “Expression vector” refers to a vector that can be utilized in a biological system or in a reconstituted biological system to direct the translation of a polypeptide encoded by a polynucleotide sequence present in the expression vector.
- Polynucleotide refers to a molecule comprising a chain of nucleotides covalently linked by a sugar-phosphate backbone or other equivalent covalent chemistry. Double and single- stranded DNA and RNA are typical examples of polynucleotides. “Polynucleotide” may refer to a synthetic molecule comprising a chain of nucleotides covalently linked by a sugar-phosphate backbone or other equivalent covalent chemistry. cDNA is an exemplary synthetic
- Polypeptide or“protein” refers to a molecule that comprises at least two amino acid residues linked by a peptide bond to form a polypeptide. Small polypeptides of less than 50 amino acids may be referred to as“peptides”.
- Flow cytometry is a technology that is used to analyze the physical and chemical characteristics of particles in a fluid as it passes through at least one laser. Cell components are fluorescently labelled and then excited by the laser to emit light at varying wavelengths (Adan, et al, Critical Reviews in Biotechnology (2016) 1549-7801).
- Anti-idiotypic (anti-id) antibody is an antibody that recognizes the antigenic determinants (e.g. the paratope or CDRs) of the antibody. It is generally known in the art the process of producing or preparing an anti-idiotypic antibody. (Lathey, J. et al Immunology 1986 57(l):29-35).
- the anti-id antibody may be antigen-blocking or non-blocking.
- the antigen blocking anti-id antibody may be used to detect the free antibody in a sample, e.g. CD3.
- the non-blocking anti-id antibody may be used to detect the total antibody (free, partially bound to antigen, or fully bound to antigen) in a sample.
- An anti-id antibody may be prepared by immunizing an animal with the antibody to which an anti-id antibody is being prepared. In some embodiments described herein, the anti-idiotypic antibody is used for detecting the level of the therapeutic antibodies in a sample.
- An anti-id antibody may also be used as an immunogen to induce an immune response in yet another animal, producing a so-called anti-anti-Id antibody.
- An anti-anti-Id antibody may be epitopically identical to the original mAb, which induced the anti-id antibody.
- Anti-Id antibodies may be varied (thereby producing anti-id antibody variants) and/or derivatized by any suitable technique, such as those described elsewhere herein with respect to the anti-CD3 antibodies.
- PSMA refers to Prostate Specific Membrane Antigen.
- the amino acid sequence of Pan troglodytes also referred to as chimpanzee or chimp) PSMA is shown in SEQ ID NO: 49.
- the extracellular domain spans residues 44 - 750, the transmembrane domain spans residues 20 - 43 and the cytoplasmic domain spans residues 1 - 19 of SEQ ID NO: 49.
- the amino acid sequence of the Macaca fascicularis (also referred to as cynomolgus monkey, macaque or cyno) PSMA is shown in SEQ ID NO: 50.
- the amino acid sequence of the human PSMA is shown in SEQ ID NO: 51.
- “CD3-specific” or“specifically binds CD3” or“anti-CD3 antibody” refers to antibodies that bind specifically to the CD3 -epsilon polypeptide (SEQ ID NO:635), including antibodies that bind specifically to the CD3-epsilon extracellular domain (ECD) (SEQ ID NO: 636).
- CD3-epsilon together with CD3-gamma, -delta and -zeta, and the T- cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex.
- This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways.
- the CD3 complex mediates signal transduction, resulting in T cell activation and proliferation. CD3 is required for the immune response.
- the terms“interleukin- 1 receptor accessory protein”,“IL1RAP” and “IL1-RAP” specifically include the human IL1RAP protein, for example as described in
- IL1RAP is also known in the scientific literature as IL1 R3, C3orfl3, FLJ37788, IL-l RAcP and EG3556.
- CD33 refers to cluster of differentiation 33 protein.
- CD33 is a 67 kilodalton (kD) single pass transmembrane glycoprotein and is a member of the sialic acid-binding
- CD33 is primarily considered to be a myeloid differentiation antigen, with low expression in myeloid progenitors, neutrophils and
- Human CD33 extracellular domain (Uniprot P20138) (SEQ ID NO:636) and cynomolgus CD33
- XP 005590138.1 are examples of proteins for use in generating CD33-specific antibodies according to the present disclosure.
- TEFF2 refers to human transmembrane protein with EGF like and two follistatin like domains 2, also called tomoregulin 2
- the amino acid sequence of the full length human T.MEFF2 is shown in SEQ ID NO: 77.
- the extracellular domain of TMEFF2 is shown in SEQ ID NO: 575 and spans residues 40-374 of the full length TMEFF2.
- T.MEFF2 extracellular domain liarbors three distinct subdomains, the Kazal-like 1 (residues 85-137), the Kazal-like 2 (residues 176-229) and the EGF domain (residues 261-301).
- the T.MEFF2 EGF domain is shown in SEQ ID NO: 577.
- the T.MEFF2“membrane proximal region” refers to the TMEFF2 reqion of SEQ ID NO; 629, which encompasses the EGF domain and the N- C-terminal tinker regions (e g. residues 230-320 of full length human TMEFF2 of SEQ ID NO. 77). All references to proteins, polypeptides and protein fragments herein are intended to refer to the human version of the respective protein, polypeptide or protein fragment unless explicitly specified as being from a non-human species. Thus“TY1EFF2” means human TMEFF2 unless specified as being from a non-human species, e.g.,‘‘mouse TMEFF2” or“monkey TMEFF2” etc.
- TMEFF2 positive cancer refers to a cancer tissue or a cancer cell that displays measurable level of TMFFF2 protein.
- Level of TMEFF2 protein may be measured using well known assays using, for example ELISA, immunofluorescence, flow cytometry or
- radioimmunoassay on live or lysed cells “Overexpress”,“overexpressed” and“overexpressing” interchangeably refers to a sample such as a cancer cell, malignant cell or cancer tissue that has measurably higher levels of tumor antigen when compared to a reference sample.
- the overexpression may be caused by gene amplification or by increased transcription or translation.
- Expression and overexpression of protein in the sample may be measured using well-known assays using, for example ELISA, immunofluorescence, flow cytometry or radioimmunoassay on live or lysed cells.
- Expression and overexpression of a polynucleotide in the sample may be measured, for example, using fluorescent in situ hybridization, Southern blotting, or PCR techniques.
- a protein or a polynucleotide is overexpressed when the level of the protein or the polynucleotide in the sample is at least 1.5 -fold higher when compared to the reference sample. Selection of the reference sample is well known.
- sample refers to a collection of similar fluids, cells, or tissues isolated from a subject, as well as fluids, cells, or tissues present within a subject.
- exemplary samples are biological fluids such as blood, serum and serosal fluids, plasma, lymph, urine, saliva, cystic fluid, tear drops, feces, sputum, mucosal secretions of the secretory tissues and organs, vaginal secretions, ascites fluids such as those associated with non-solid tumors, fluids of the pleural, pericardial, peritoneal, abdominal and other body cavities, fluids collected by bronchial lavage, liquid solutions contacted with a subject or biological source, for example, cell and organ culture medium including cell or organ conditioned medium, lavage fluids and the like, tissue biopsies, fine needle aspirations or surgically resected tumor tissue.
- biological fluids such as blood, serum and serosal fluids, plasma, lymph, urine, saliva, cystic fluid, tear drops, feces, sput
- A“cancer cell” or a“tumor cell” as used herein refers to a cancerous, pre-cancerous or transformed cell, either in vivo, ex vivo, or in tissue culture, that has spontaneous or induced phenotypic changes. These changes do not necessarily involve the uptake of new genetic material. Although transformation may arise from infection with a transforming virus and incorporation of new genomic nucleic acid or uptake of exogenous nucleic acid, it can also arise spontaneously or following exposure to a carcinogen, thereby mutating an endogenous gene.
- Transformation/cancer is exemplified by morphological changes, immortalization of cells, aberrant growth control, foci formation, proliferation, malignancy, modulation of tumor specific marker levels, invasiveness, tumor growth in suitable animal hosts such as nude mice, and the like, in vitro, in vivo, and ex vivo (Freshney, Culture of Animal Cells: A Manual of Basic Technique (3rd ed. 1994)).
- suitable animal hosts such as nude mice, and the like
- any numerical values, such as a concentration or a concentration range described herein are to be understood as being modified in all instances by the term “about.”
- a numerical value typically includes ⁇ 10% of the recited value.
- a concentration of 1 mg/mL includes 0.9 mg/mL to 1.1 mg/mL.
- a concentration range of 1% to 10% (w/v) includes 0.9% (w/v) to 11% (w/v).
- the use of a numerical range expressly includes all possible subranges, all individual numerical values within that range, including integers within such ranges and fractions of the values unless the context clearly indicates otherwise.
- “Effector antigens” are antigens from cells of the immune system that can stimulate or trigger cytotoxicity, phagocytosis, antigen presentation, and/or cytokine release. Such effector antigens are from, for example but not limited to, T cells and natural killer (NK) cells. Examples of suitable specificities for effector antigens include but are not limited to CD3 or CD3 subunits such as CD3e for T cells and CD16 for NK cells. Such cell surface molecules of effector cells are suitable for mediating cell killing. Effector cells are cells of the immune system that can stimulate or trigger cytotoxicity, phagocytosis, antigen presentation, and/or cytokine release.
- effector cells are, for example but not limited to, T-cells, natural killer (NK) cells, granulocytes, monocytes, macrophages, dendritic cells, and antigen-presenting cells.
- suitable specificities for effector cells include but are not limited to CD2, CD3 and CD3 subunits such as CD3e, CD5, CD28 and other components of the T-cell receptor (TCR) for T cells; CD16, CD 16 A, CD25, CD38, CD44, CD56, CD69, CD94, CD335 (NKp46), CD336, (NKp44), CD337 (NKp30), NKp80, NKG2C and NKG2D, DNAM, NCRs for NK cells; CD18, CD64 and CD89 for granulocytes; CD18, CD32, CD64, CD89 and mannose receptor for monocytes and macrophages; CD64 and mannose receptor for dendritic cells; as well as CD35.
- those specificities, i.e. cell surface molecules, of effector cells are suitable for mediating cell killing upon binding of a bispecific or multispecific molecules to such cell surface molecule and, thereby, inducing cytolysis or apoptosis.
- “Bispecific CD3 antibody” refers to a molecule comprising at least one binding domain specifically binding CD3 and at least one binding domain specifically binding a second antigen, such as a bispecific antibody comprising a first domain that specifically binds CD3 and a second domain that specifically binds a second antigen.
- the domains specifically binding CD3 and a second antigen are typically VH/VL pairs.
- the bispecific CD3 antibody may be monovalent in terms of its binding to either CD3 or the second antigen.
- the second, or target, antigen is a cell surface antigen that is expressed on a target cell other than an immune effector cell.
- the second antigen a tumor associated antigen (TAA).
- TAAs are PSMA, CD33, IL1RAP, and TMEFF2.
- “Bispecific PSMA/CD3 antibody”,“PSMA/CD3 antibody”,“bispecific anti- PSMA/CD3 antibody” or“anti-PSMA/CD3 antibody” and the like refer to a molecule comprising at least one binding domain specifically binding PSMA and at least one binding domain specifically binding CD3.
- the domains specifically binding PSMA and CD3 are typically VH/VL pairs.
- the bispecific anti-PSMA/CD3 antibody may be monovalent in terms of its binding to either PSMA or CD3.
- “Bispecific CD33xCD3 antibody”,“CD33/CD3 antibody”,“bispecific anti-CD33 xCD3 antibody” or“anti-CD33/CD3 antibody” and the like refer to a molecule comprising at least one binding domain specifically binding CD33 and at least one binding domain specifically binding CD3.
- the domains specifically binding CD33 and CD3 are typically VH/VL pairs.
- the bispecific anti-CD33xCD3 antibody may be monovalent in terms of its binding to either CD33 or CD3.
- ILlRAPxCD3 antibody or“anti- IL1RAP/CD3 antibody” and the like refer to a molecule comprising at least one binding domain specifically binding IL1RAP and at least one binding domain specifically binding CD3.
- the domains specifically binding IL1RAP and CD3 are typically VH/VL pairs.
- the bispecific anti- ILlRAPxCD3 antibody may be monovalent in terms of its binding to either IL1RAP or CD3.
- TMEFF2/CD3 antibody TMEFF2xCD3 antibody and the like refer to an antibody that binds TMEFF2 and CD3.
- Value refers to the presence of a specified number of binding sites specific for an antigen in a molecule.
- the terms“monovalent”,“bivalent”,“tetravalent”, and “hexavalent” refer to the presence of one, two, four and six binding sites, respectively, specific for an antigen in a molecule.
- “Multivalent” refers to the presence of two or more binding sites specific for an antigen in a molecule.
- An antigen specific CD4+ or CD8+ T cell refers to a CD4+ or CD8+ T cell activated by a specific antigen, or immunostimulatory epitope thereof.
- Subject includes any human or nonhuman animal.
- Nonhuman animal includes all vertebrates, e.g., mammals and non-mammals, such as nonhuman primates, sheep, dogs, cats, horses, cows chickens, amphibians, reptiles, etc. Except when noted, the terms“patient” or “subject” are used interchangeably.
- the present invention provides anti-CD3 antibodies and antigen-binding fragments thereof, antibodies and antigen-binding fragments thereof that specifically bind PSMA, antibodies and antigen-binding fragments thereof that specifically bind CD33, antibodies and antigen-binding fragments thereof that specifically bind IL1RAP, multispecific antibodies comprising a first domain that specifically binds CD3 and a second domain that specifically binds a second antigen, and multispecific antibodies that specifically bind CD3 and one or more of PSMA, CD33, IL1RAP, and TMEFF2.
- the present invention provides polypeptides and polynucleotides encoding the antibodies of the invention or complementary nucleic acids thereof, vectors, host cells, and methods of making and using them.
- the anti-CD3 antibodies or antigen-binding fragments described herein include variants having single or multiple amino acid substitutions, deletions, or additions that retain the biological properties (e.g., binding affinity or immune effector activity) of the described anti- CD3 antibodies or antigen-binding fragments.
- substitution of an amino acid in a given position is written as e.g. K409R which means a substitution of a Lysine in position 409 with an Arginine; and ii) for specific variants the specific three or one letter codes are used, including the codes Xaa and X to indicate any amino acid residue.
- substitution of Arginine for Lysine in position 409 is designated as: K409R, or the substitution of any amino acid residue for Lysine in position 409 is designated as K409X.
- deletion of Lysine in position 409 it is indicated by K409*.
- the skilled person may produce variants having single or multiple amino acid substitutions, deletions, or additions.
- variants may include: (a) variants in which one or more amino acid residues are substituted with conservative or nonconservative amino acids, (b) variants in which one or more amino acids are added to or deleted from the polypeptide, (c) variants in which one or more amino acids include a substituent group, and (d) variants in which the polypeptide is fused with another peptide or polypeptide such as a fusion partner, a protein tag or other chemical moiety, that may confer useful properties to the polypeptide, such as, for example, an epitope for an antibody, a polyhistidine sequence, a biotin moiety and the like.
- Antibodies or antigen-binding fragments described herein may include variants in which amino acid residues from one species are substituted for the corresponding residue in another species, either at the conserved or nonconserved positions. In other embodiments, amino acid residues at nonconserved positions are substituted with conservative or nonconservative residues.
- the techniques for obtaining these variants, including genetic (deletions, mutations, etc.), chemical, and enzymatic techniques, are known to persons having ordinary skill in the art.
- the antibodies or antigen-binding fragments described herein may be an IgM, an IgD, an IgG, an IgA or an IgE isotype.
- the antibody isotype is an IgGl, an IgG2, an IgG3, or an IgG4 isotype. In some embodiments, the antibody is an IgGl isotype.
- the antibody is an IgG2 isotype. In some embodiments, the antibody is an IgG3 isotype. In some embodiments, the antibody is an IgG4 isotype.
- the specificity of the antibody or antigen-binding fragment thereof is in part determined by the amino acid sequence and arrangement, of the CDRs. Therefore, the CDRs of one isotype may be transferred to another isotype without altering antigen specificity. Accordingly, such antibody isotypes are within the scope of the described antibodies or antigen-binding fragments.
- the IgG class is divided in four isotypes: IgGl, IgG2, IgG3 and IgG4 in humans. They share more than 95% homology in the amino acid sequences in the CH1, CH2 and CH3 regions but show major differences in the amino acid composition and structure of the hinge region.
- the Fc region mediates effector functions, such as antibody-dependent cellular cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP) and complement-dependent cytotoxicity (CDC).
- ADCC antibody-dependent cellular cytotoxicity
- ADCP antibody-dependent cellular phagocytosis
- CDC complement-dependent cytotoxicity
- the Fc region binds to Fc receptors (FcyRs) on the surface of immune effector cells such as natural killer cells and macrophages, leading to the lysis of the targeted cells.
- FcyRs Fc receptors
- the antibodies mediate targeted cell killing by triggering the complement cascade at the cell surface.
- ADCP the antibody mediates elimination of antibody-coated target cells by
- the antibodies described herein include antibodies with the described features of the variable domains in combination with any of the IgG isotypes, including modified versions in which the Fc region has been modified to modulate the various effector functions.
- Fc-mediated effector functions are not desired as they may potentially pose a safety risk due to cell depletion.
- Modifying effector functions can be achieved by engineering the Fc regions to reduce their binding to FcyRs or the complement factors. The binding of IgG to the activating (FcyRI, FcyRI la, FcyRI I la and
- FcyRIIIb and inhibitory (FcyRIIb) FcyRs or the first component of complement (Clq) depends on residues located in the hinge region and the CH2 domain. Mutations may be introduced in IgGl, IgG2 and IgG4 to reduce or silence Fc-mediated effector functions.
- the antibodies described herein may include these modifications.
- the anti-CD3, the anti-PSMA, the anti-CD33, and/or the anti- IL1RAP antibodies comprise an engineered Fc region having one or more of the following properties: (a) reduced effector function when compared to the parental Fc; (b) reduced affinity to FcyRI, FcyRI I a, FcyRIIb, FcyRIIIb and/or FcyRIIIa; (c) reduced affinity to FcyRI; (d) reduced affinity to FcyRIIa; (e) reduced affinity to FcyRIIIb; or (f) reduced affinity to FcyRIIIa.
- the anti-CD3, the anti-PSMA, the anti-CD33, and/or the anti- IL1RAP antibodies are, e.g., IgGl, IgG2, IgG3, or IgG4 isotypes.
- the antibody contains S228P, F234A, and L235A substitutions in its Fc region when compared to the wild-type IgG4.
- the antibody contains L234A, and L235A
- the anti-CD3, the anti-PSMA, the anti-CD33, and/or the anti- IL1RAP antibodies are an IgG4 isotype, optionally comprising a heavy chain substitution S228P.
- the anti-CD3, the anti-PSMA, the anti-CD33, and/or the anti- IL1RAP antibodies are an IgGl isotype, optionally comprising heavy chain substitutions L234A, G237A, P238S, H268A, A330S and P331S when compared to the wild type IgGl.
- the anti-CD3, the anti-PSMA, the anti-CD33, and/or the anti- IL1RAP antibodies are an IgG2 isotype, optionally comprising heavy chain substitutions L234A, G237A, P238S, H268A, V309L, A330S and P331S when compared to the wild type IgG2.
- labelled anti-CD3, anti-PSMA, anti-CD33, and/or anti-ILlRAP antibodies are provided.
- Exemplary labels or moieties that are detected directly e.g., fluorescent, chromophoric, electron-dense, chemiluminescent, and radioactive labels
- labels and moieties e.g., enzymes or ligands
- exemplary labels include radiolabels (e.g., 32 P, 14 C, 111 I, 125 I, 3H, 131 I), fluorescent labels (such as Dy Light® 649), epitope tags, biotin, chromophore labels, ECL labels, or enzymes.
- the described labels include ruthenium, 111 In-DOTA, 1 1 An- diethylenetriaminepentaacetic acid (DTP A), horseradish peroxidase, alkaline phosphatase and beta-galactosidase, poly-histidine (HIS tag), acridine dyes, cyanine dyes, fluorone dyes, oxazin dyes, phenanthridine dyes, rhodamine dyes, Alexafluor® dyes, and the like.
- DTP A An- diethylenetriaminepentaacetic acid
- HIS tag poly-histidine
- acridine dyes cyanine dyes
- fluorone dyes oxazin dyes
- phenanthridine dyes phenanthridine dyes
- rhodamine dyes Alexafluor® dyes, and the like.
- polynucleotide sequences capable of encoding the described antibodies and antigen-binding fragments are also provided, as are cells expressing the anti-CD3, anti-PSMA, anti-CD33, and/or anti-ILlRAP antibodies or antigen-binding fragments provided herein. Also described are cells capable of expressing the disclosed vectors. These cells may be mammalian cells (such as 293F cells, CHO cells), insect cells (such as Sf7 cells), yeast cells, plant cells, or bacteria cells (such as E. coli). The described antibodies may also be produced by hybridoma cells.
- the anti-CD3, the anti-PSMA, the anti-CD33, the anti-TMEFF2, and/or the anti-ILlRAP antibodies of the invention are human.
- the anti-CD3, the anti-PSMA, the anti-CD33, the anti-TMEFF2, and/or the anti-ILlRAP antibodies of the invention are humanized.
- Monospecific antibodies of the invention described herein may be generated using various technologies. For example, the hybridoma method of Kohler and Milstein, Nature 256:495, 1975 may be used to generate monoclonal antibodies.
- a mouse or other host animal such as a hamster, rat or chicken, is immunized with human, chimpanzee, or macaque PSMA, CD33, IL1RAP, TMEFF2, or CD3 or fragments of PSMA, CD33, IL1RAP, TMEFF2, or CD3, such as the extracellular domain of PSMA, CD33, IL1RAP, TMEFF2, or CD3, followed by fusion of spleen cells from immunized animals with myeloma cells using standard methods to form hybridoma cells (Goding, Monoclonal Antibodies:
- Colonies arising from single immortalized hybridoma cells are screened for production of antibodies with desired properties, such as specificity of binding, cross-reactivity or lack thereof, and affinity for the antigen.
- Various host animals may be used to produce the anti-CD3, the anti-PSMA, the anti-
- Balb/c mice may be used to generate mouse anti-human PSMA antibodies.
- the antibodies made in Balb/c mice and other non-human animals may be humanized using various technologies to generate more human-like sequences.
- Exemplary humanization techniques including selection of human acceptor frameworks are known and include CDR grafting (U.S. Patent No. 5,225,539), SDR grafting (U.S. Patent No. 6,818,749), Resurfacing (Padlan, (1991) Mol Immunol 28:489-499), Specificity Determining Residues Resurfacing (U.S. Patent Publ. No. 2010/0261620), human framework adaptation (U.S. Patent No. 8,748,356) or superhumanization (U.S. Patent No. 7,709, 226).
- CDRs of parental antibodies are transferred onto human frameworks that may be selected based on their overall homology to the parental frameworks, based on similarity in CDR length, or canonical structure identity, or a combination thereof.
- Humanized antibodies may be further optimized to improve their selectivity or affinity to a desired antigen by incorporating altered framework support residues to preserve binding affinity (backmutations) by techniques such as those described in Int. Patent Publ. Nos.
- Transgenic animals such as mice or rat carrying human immunoglobulin (Ig) loci in their genome may be used to generate human antibodies against a target protein, and are described in for example U.S. Patent No. 6,150,584, Int. Patent Publ. No. W099/45962, Int. Patent Publ. Nos. W02002/066630, WO2002/43478, W02002/043478 and WOl 990/04036, Lonberg et al (1994) Nature 368:856-9; Green et al (1994) Nature Genet. 7: 13-21; Green & Jakobovits (1998) Exp. Med.
- the endogenous immunoglobulin loci in such animal may be disrupted or deleted, and at least one complete or partial human immunoglobulin locus may be inserted into the genome of the animal using homologous or non-homologous recombination, using transchromosomes, or using minigenes. Companies such as Regeneron
- Human antibodies may be selected from a phage display library, where the phage is engineered to express human immunoglobulins or portions thereof such as Fabs, single chain antibodies (scFv), or unpaired or paired antibody variable regions (Knappik et al, (2000) J Mol Biol 296:57-86; Krebs et al., (2001) J Immunol Meth 254:67-84; Vaughan et al., (1996) Nature Biotechnology 14:309-314; Sheets et al, (1998) PITAS (USA) 95:6157-6162; Hoogenboom and Winter (1991) J Mol Biol 227:381; Marks et al, (1991) J Mol Biol 222:581).
- human immunoglobulins or portions thereof such as Fabs, single chain antibodies (scFv), or unpaired or paired antibody variable regions
- the antibodies of the invention may be isolated for example from phage display library expressing antibody heavy and light chain variable regions as fusion proteins with bacteriophage pIX coat protein as described in Shi et al., (2010) J Mol Biol 397:385-96, and Int. Patent Publ. No. WO09/085462).
- the libraries may be screened for phage binding to human and/or cyno PSMA, CD33, IL1RAP, TMEFF2, or CD3 and the obtained positive clones may be further characterized, the Fabs isolated from the clone lysates, and expressed as full length IgGs.
- Such phage display methods for isolating human antibodies are described in for example: U.S. Patent Nos. 5,223,409,
- immunogenic antigens and monoclonal antibody production may be performed using any suitable technique, such as recombinant protein production.
- the immunogenic antigens may be administered to an animal in the form of purified protein, or protein mixtures including whole cells or cell or tissue extracts, or the antigen may be formed de novo in the animal’s body from nucleic acids encoding said antigen or a portion thereof.
- the invention provides bispecific and multispecific antibodies comprising a first domain that specifically binds CD3 and a second domain that specifically binds a second antigen.
- the second antigen may be a tumor associated antigen (TAA) or an antigen on pathogenic cells.
- TAA tumor associated antigen
- Exemplary anti-CD3 antibodies that may be used to engineer bispecific and multispecific antibodies comprising a first domain that specifically binds CD3 and a second domain that specifically binds a second antigen include CD3 antibodies comprising the VH/VL sequences and heavy /light chain CDRs shown in Table 7A and 7B, respectively, and the engineered variants thereof described in Table 10 and Table 11, and accompanying text.
- the CDRs and/or the VH/VL domains of the CD3 antibodies CD3B312, CD3B313, CD3B314, CD3B315, CD3B316, CD3B317, CD3B337, CD3B373, CD3B376, CD3B389, CD3B450, and CD3B467 described herein may be used to generate bispecific and multispecific antibodies comprising a first domain that specifically binds CD3 and a second domain that specifically binds a second antigen.
- the herein described anti-CD3 antibody CDRs and/or the VH/VL domains may be incorporated into bispecific antibodies comprising a first domain that specifically binds CD3 and a second domain that specifically binds a second antigen.
- the herein described anti-CD3 antibody CDRs and/or the VH/VL domains may be incorporated into bispecific antibodies comprising PSMA binding VH/VL domains described herein and in Table 23.
- the herein described anti-CD3 antibodies and/or the VH/VL domains may be incorporated into bispecific antibodies comprising IL1RAP binding VH/VL domains described herein and in Table 30.
- the herein described anti-CD3 antibody CDRs and/or the VH/VL domains may be incorporated into bispecific antibodies comprising CD33 binding VH/VL domains described herein and in Table 38.
- Exemplary TAAs are PSMA, CD33, TMEFF2, and IL1RAP.
- the exemplary multispecific PSMAxCD3, CD33 xCD3, TMEFF2,xCD3, and ILlRAPxCD3 antibodies provided herein have a first domain that specifically bind CD3 and a second domain that specifically binds PSMA, CD33, TMEFF2, or IL1RAP.
- Exemplary anti -PSMA antibodies that may be used to engineer bispecific PSMAxCD3 molecules are those described herein, which may comprise heavy and light chain sequences including but not limited to the heavy and light chain sequences listed in Table 23.
- Exemplary anti-ILlRAP antibodies that may be used to engineer bispecific ILlRAPxCD3 molecules are those described herein, which may comprise heavy and light chain variable region sequences including but not limited to the heavy and light chain variable region sequences provided in Table 35.
- Exemplary anti-CD33 antibodies that may be used to engineer bispecific CD33xCD3 molecules are those described herein, which may comprise heavy and light chain variable region sequences including but not limited to the heavy and light chain variable region sequences provided in Table 43.
- Exemplary anti-TMEFF2 antibodies that may be used to engineer bispecific TMEFF2xCD3 molecules are those described herein, which may comprise heavy and light chain variable region sequences including but not limited to the heavy and light chain variable region sequences provided in Tables 59, 66-68.
- the generated bispecific antibodies may be tested for their binding to CD3 and/or the second antigen and/or for their desired functional characteristics, such as T-cell mediated killing of cells that express the second antigen.
- the bispecific antibodies provided herein include antibodies having a full-length antibody structure.
- Fab-arm or“half molecule” refers to one heavy chain-light chain pair that specifically binds an antigen.
- Full length bispecific antibodies as described herein may be generated for example using Fab arm exchange (or half molecule exchange) between two monospecific bivalent antibodies by introducing substitutions at the heavy chain CH3 interface in each half molecule to favor heterodimer formation of two antibody half molecules having distinct specificity either in vitro in cell-free environment or using co-expression.
- the Fab arm exchange reaction is the result of a disulfide-bond isomerization reaction and dissociation-association of CH3 domains. The heavy chain disulfide bonds in the hinge regions of the parental monospecific antibodies are reduced.
- the resulting free cysteines of one of the parental monospecific antibodies form an inter heavy- chain disulfide bond with cysteine residues of a second parental monospecific antibody molecule and simultaneously CH3 domains of the parental antibodies release and reform by dissociation- association.
- the CH3 domains of the Fab arms may be engineered to favor heterodimerization over homodimerization.
- the resulting product is a bispecific antibody having two Fab arms or half molecules, which each bind a distinct epitope, i.e. an epitope on CD3 and an epitope on the second antigen.
- “Homodimerization” refers to an interaction of two heavy chains having identical CH3 amino acid sequences. “Homodimer” refers to an antibody having two heavy chains with identical CH3 amino acid sequences.
- Heterodimerization refers to an interaction of two heavy chains having non-identical
- heterodimer refers to an antibody having two heavy chains with non-identical CH3 amino acid sequences.
- the bispecific antibodies include designs such as the
- Triomab/Quadroma Trion Pharma/Fresenius Biotech
- Knob-in-Hole Genetech
- CrossMAbs (Roche) and the electrostatically-matched (Chugai, Amgen, NovoNordisk, Oncomed)
- the LUZ- Y Genentech
- SEEDbody Strand Exchange Engineered Domain body
- EMD Serono EMD Serono
- Biclonic Biclonic
- DuoBody ® Technology Genmab A/S.
- Triomab quadroma technology may be used to generate full-length bispecific antibodies, incorporating the VH and VL of the anti-CD3 antibodies of the invention.
- Triomab technology promotes Fab arm exchange between two parental chimeric antibodies, one parental mAh having IgG2a and the second parental mAh having rat IgG2b constant regions, yielding chimeric bispecific antibodies.
- The“knob-in-hole” strategy may be used to generate full-length bispecific antibodies. Briefly, selected amino acids forming the interface of the CH3 domains in human IgG can be mutated at positions affecting CH3 domain interactions to promote heterodimer formation. An amino acid with a small side chain (hole) is introduced into a heavy chain of an antibody specifically binding a first antigen and an amino acid with a large side chain (knob) is introduced into a heavy chain of an antibody specifically binding a second antigen.
- a heterodimer is formed as a result of the preferential interaction of the heavy chain with a“hole” with the heavy chain with a“knob”.
- Exemplary CH3 substitution pairs forming a knob and a hole are (expressed as modified position in the first CH3 domain of the first heavy chain/ modified position in the second CH3 domain of the second heavy chain): T366Y/F405A, T366W/F405W, F405W/Y407A, T394W/Y407T, T394S/Y407A, T366W/T394S, F405W/T394S and T366W/T366S_L368A_Y407V.
- the CrossMAb technology may be used to generate full-length bispecific antibodies.
- CrossMAbs in addition to utilizing the“knob-in-hole” strategy to promoter Fab arm exchange, have in one of the half arms the CH1 and the CL domains exchanged to ensure correct light chain pairing of the resulting bispecific antibody (see e.g. U.S. Patent No. 8,242,247).
- heterodimerization may be promoted by following substitutions (expressed as modified position in the first CH3 domain of the first heavy chain/ modified position in the second CH3 domain of the second heavy chain):
- LUZ-Y technology may be utilized to generate bispecific antibodies.
- a leucine zipper is added into the C terminus of the CH3 domains to drive the heterodimer assembly from parental mAbs that is removed post- purification as described in Wranik et al, (2012) J Biol Chem 287(52): 42221-9.
- SEEDbody technology may be utilized to generate bispecific antibodies.
- SEEDbodies have, in their constant domains, select IgG residues substituted with IgA residues to promote heterodimerization as described in U.S. Patent No. US20070287170.
- the bispecific antibodies described herein may be generated in vitro in a cell-free environment by introducing asymmetrical mutations in the CH3 regions of two monospecific homodimeric antibodies and forming the bispecific heterodimeric antibody from two parent monospecific homodimeric antibodies in reducing conditions to allow disulfide bond isomerization according to methods described in Int. Patent Publ. No. WO2011/131746).
- the first monospecific bivalent antibody i.e., the antibody that specifically binds the second antigen; e.g., anti-PSMA, anti-CD33, anti-TMEFF2 or anti-ILlRAP antibody
- the second monospecific bivalent antibody i.e., anti-CD3 antibody
- the antibodies are incubated together under reducing conditions sufficient to allow the cysteines in the hinge region to undergo disulfide bond isomerization; thereby generating the bispecific antibody by Fab arm exchange. The incubation conditions are restored to non-reducing.
- Exemplary reducing agents that may be used are 2- mercaptoethylamine (2-MEA), dithiothreitol (DTT), dithioerythritol (DTE), glutathione, tris(2-carboxyethyl)phosphine (TCEP), L-cysteine and beta- mercaptoethanol.
- 2-MEA 2- mercaptoethylamine
- DTT dithiothreitol
- DTE dithioerythritol
- glutathione glutathione
- tris(2-carboxyethyl)phosphine (TCEP) tris(2-carboxyethyl)phosphine
- L-cysteine beta- mercaptoethanol
- the bispecific antibody comprising a first domain that specifically binds CD3 and a second domain that specifically binds a second antigen comprises at least one substitution in an antibody CH3 constant domain.
- the at least one substitution in the antibody CH3 constant domain is K409R, F405L or F405L and R409K substitution, wherein residue numbering is according to the EU Index.
- Antibody domains and numbering are well known. “Asymmetrical” refers to non identical substitutions in the two CH3 domains in two separate heavy chains in an antibody.
- An IgGl CH3 region typically consists of residues 341-446 on IgGl (residue numbering according to the EU index).
- the bispecific antibody is an IgGl isotype and comprises a F405L substitution in an antibody first heavy chain (HC1) and a K409R substitution in an antibody second heavy chain (HC2) when compared to the wild-type IgGl .
- the bispecific antibody is an IgGl isotype and comprises a K409R substitution in an antibody first heavy chain (HC1) and a F405L substitution in an antibody second heavy chain (HC2) when compared to the wild-type IgGl .
- the bispecific antibody is an IgG4 isotype and comprises a S228P substitution in the HC1 and S228P, F405L and R409K substitutions in the HC2 when compared to the wild-type IgG4.
- the bispecific antibody is an IgG4 isotype and comprises S228P, F405L and R409K substitutions in the HC1 and a S228P substitution in the HC2 when compared to the wild-type IgG4.
- the bispecific antibody is an IgG4 isotype and comprises S228P, F234A and L235A substitutions in the HC1 and S228P, F234A, L235A,
- the bispecific antibody is an IgG4 isotype and comprises S228P, F234A, L235A, F405L and R409K substitutions in the HC1 and a S228P, F234A and L235A substitutions in the HC2 when compared to the wild-type IgG4.
- the bispecific antibody of the invention comprises at least one, two, three, four, five, six, seven or eight asymmetrical substitutions in the HC1 and the HC2 at residue positions 350, 366, 368, 370, 399, 405, 407 or 409, when residue numbering is according to the EU index.
- the bispecific antibody of the invention comprises at least one, two, three or four asymmetrical substitutions in the HC1 and the HC2 at residue positions 350, 370, 405 or 409, when residue numbering is according to the EU index.
- the bispecific antibody of the invention comprises at least one asymmetrical substitution in the HC1 and the HC2 at residue positions 405 or 409, when residue numbering is according to the EU index.
- substitutions are typically made at the DNA level to a molecule such as the constant domain of the antibody using standard methods.
- the antibodies of the invention may be engineered into various well-known antibody forms.
- the bispecific antibody of the present invention is a cross-body.
- the bispecific antibodies of the invention include recombinant IgG-like dual targeting molecules, wherein the two sides of the molecule each contain the Fab fragment or part of the Fab fragment of at least two different antibodies; IgG fusion molecules, wherein full length IgG antibodies are fused to an extra Fab fragment or parts of Fab fragment; Fc fusion molecules, wherein single chain Fv molecules or stabilized diabodies are fused to heavy-chain constant-domains, Fc-regions or parts thereof; Fab fusion molecules, wherein different Fab-fragments are fused together; ScFv- and diabody-based and heavy chain antibodies (e.g., domain antibodies, nanobodies) wherein different single chain Fv molecules or different diabodies or different heavy-chain antibodies (e.g. domain antibodies, nanobodies) are fused to each other or to another protein or carrier molecule.
- IgG fusion molecules wherein full length IgG antibodies are fused to an extra Fab fragment or parts of Fab fragment
- Fc fusion molecules wherein
- recombinant IgG-like dual targeting molecules include Dual Targeting (DT)-Ig (GSK/Domantis), Two-in-one Antibody (Genentech) and mAb2 (F-Star).
- IgG fusion molecules include Dual Variable Domain (DVD)-Ig (Abbott), Ts2Ab (Medlmmune/AZ) and BsAb (Zymogenetics), HERCUFES (Biogen personal) and TvAb (Roche).
- Fc fusion molecules include to ScFv/Fc Fusions (Academic Institution), SCORPION (Emergent BioSolutions/Trubion, Zymogenetics/BMS) and Dual Affinity Retargeting Technology (Fc-DART) (MacroGenics).
- Fab fusion bispecific antibodies include F(ab)2
- ScFv-, diabody- based and domain antibodies include Bispecific T Cell Engager (BITE) (Micromet), Tandem Diabody (Tandab) (Affimed), Dual Affinity Retargeting Technology (DART) (MacroGenics), Single-chain Diabody (Academic), TCR-like Antibodies (AIT, ReceptorLogics), Human Serum Albumin ScFv Fusion (Merrimack) and COMBODY (Epigen Biotech), dual targeting nanobodies (Ablynx), dual targeting heavy chain only domain antibodies.
- BITE Bispecific T Cell Engager
- Tandab Tandem Diabody
- DART Dual Affinity Retargeting Technology
- AIT TCR-like Antibodies
- AIT TCR-like Antibodies
- AIT Human Serum Albumin ScFv Fusion
- COMBODY Epigen Biotech
- Table 2 summarizes exemplary monoclonal antibodies described herein that can be used to generate the bispecific antibodies of the invention.
- TMEFF2/CD3 molecules are those described herein, which may comprise heavy and light chain variable region sequences including but not limited to the heavy and light chain variable region sequences provided in Tables 59, 66-68.
- the anti-CD3 antibody is a multispecific antibody, for example a bispecific antibody comprising a first domain that specifically binds CD3 and a second domain that specifically binds a second antigen.
- the second, or target, antigen is a cell surface antigen that is expressed on a target cell other than an immune effector cell.
- the second antigen is a TAA.
- Exemplary TAAs are PSMA, CD33, TMEFF2, and IL1RAP.
- the invention provides a bispecific antibody comprising a first domain that specifically binds CD3 and a second domain that specifically binds a second antigen.
- the first domain comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2, and the LCDR3 of SEQ ID NOs:662, 663, 664, 671, 673, and 690, respectively.
- the first domain comprises the VH and VL of SEQ ID NOs: 652 and 661, respectively.
- the first domain comprises the HC and LC of SEQ ID NOs: 640 and 676, respectively.
- the first domain comprises the VH and VL of SEQ ID NOs: 657 and 678, respectively.
- the first domain comprises the HC and LC of SEQ ID NOs: 675 and 677, respectively.
- the first domain comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2, and the LCDR3 of SEQ ID NOs:662, 663, 664, 773, 673, and 690, respectively.
- the first domain comprises the VH and VL of SEQ ID NOs:657 and 678, respectively.
- the first domain comprises the HC and LC of SEQ ID NOs:675 and 677, respectively.
- the invention also provides the bispecific antibody comprising a first domain that specifically binds CD3 and a second domain that specifically binds a second antigen of the invention for use in therapy.
- the invention also provides the bispecific antibody comprising a first domain that specifically binds CD3 and a second domain that specifically binds a second antigen of the invention for use in treating a cell proliferative disporder.
- the invention also provides the bispecific antibody comprising a first domain that specifically binds CD3 and a second domain that specifically binds a second antigen of the invention for use in treating cancer.
- the invention also provides the bispecific antibody comprising a first domain that specifically binds CD3 and a second domain that specifically binds a second antigen of the invention for use in treating an autoimmune disease.
- the invention also provides the bispecific antibody comprising a first domain that specifically binds CD3 and a second domain that specifically binds a second antigen of the invention for use in the mantufacture of a medicament for treating cancer.
- the invention also provides the bispecific antibody comprising a first domain that specifically binds CD3 and a second domain that specifically binds a second antigen of the invention for use in the mantufacture of a medicament for treating an autoimmune disorder.
- a further aspect of the invention is a method of treating a cell proliferative disorder or an autoimmune disorder in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of the anti-CD3 antibody of the invention.
- the anti-CD3 antibody or the bispecific antibody comprising a first domain that specifically binds CD3 and a second domain that specifically binds a second antigen of the invention is administered to the subject in a dosage of about 0.01 mg/kg to about 10 mg/kg.
- the anti-CD3 antibody or the bispecific antibody comprising a first domain that specifically binds CD3 and a second domain that specifically binds a second antigen of the invention is administered to the subject in a dosage of about 0.1 mg/kg to about 10 mg/kg. In some embodiments, the anti-CD3 antibody or the bispecific antibody comprising a first domain that specifically binds CD3 and a second domain that specifically binds a second antigen of the invention is administered to the subject in a dosage of about 1 mg/kg. In some embodiments, the anti-CD3 antibodyor the bispecific antibody comprising a first domain that specifically binds CD3 and a second domain that specifically binds a second antigen of the invention is
- the anti-CD3 antibody or the bispecific antibody comprising a first domain that specifically binds CD3 and a second domain that specifically binds a second antigen of the invention is administered subcutaneously.
- the anti-CD3 antibody or the bispecific antibody comprising a first domain that specifically binds CD3 and a second domain that specifically binds a second antigen of the invention is administered subcutaneously.
- the cell proliferative disorder is cancer.
- the cancer is selected from the group consisting of esophageal cancer, stomach cancer, small intestine cancer, large intestine cancer, colorectal cancer, breast cancer, non-small cell lung cancer, non-Hodgkin's lymphoma (NHL), B cell lymphoma, B cell leukemia, multiple myeloma, renal cancer, prostate cancer, liver cancer, head and neck cancer, melanoma, ovarian cancer, mesothelioma, glioblastoma, germinal-center B-cell-like (GCB) DLBCL, activated B- cell-like (ABC) DLBCL, follicular lymphoma (FL), mantle cell lymphoma (MCL), acute myeloid leukemia (AML), chronic lymphoid leukemia (CLL), marginal zone lymphoma (MZL), small lymphocytic leukemia (SLL),
- NHL non-Hodgkin's lymph
- Intravascular large B-cell lymphoma Intravascular large B-cell lymphoma, ALK- positive large B-cell lymphoma, Plasmablastic lymphoma, Large B-cell lymphoma arising in HHV8-associated multicentric Castleman disease, Primary effusion lymphoma: B-cell lymphoma, unclassifiable, with features intermediate between diffuse large B-cell lymphoma and Burkitt lymphoma, and B-cell lymphoma, unclassifiable, with features intermediate between diffuse large B-cell lymphoma, classical Hodgkin lymphoma and light chain amyloidosis.
- the cancer is esophageal cancer.
- the cancer is an adenocarcinoma, for example, a metastatic adenocarcinoma (e.g., a colorectal
- adenocarcinoma adenocarcinoma, a gastric adenocarcinoma, or a pancreatic adenocarcinoma.
- the autoimmune disorder can be selected from the group consisting of rheumatoid arthritis, juvenile rheumatoid arthritis, systemic lupus erythematosus (SLE), Wegener's disease, inflammatory bowel disease, idiopathic
- IGP thrombocytopenic purpura
- TTP thrombotic thrombocytopenic purpura
- autoimmune thrombocytopenia multiple sclerosis, psoriasis, IgA nephropathy, IgM polyneuropathies, myasthenia gravis, vasculitis, diabetes mellitus, Reynaud's syndrome, Sjorgen's syndrome, glomerulonephritis, Neuromyelitis Optica (NMO), and IgG neuropathy.
- the invention features a kit comprising: (a) a composition comprising any one of the preceding anti-CD3 antibodies or the bispecific antibodies comprising a first domain that specifically binds CD3 and a second domain that specifically binds a second antigen of the invention and (b) a package insert comprising instructions for administering the composition to a subject to treat or delay progression of a cell proliferative disorder.
- a composition comprising any one of the preceding anti-CD3 antibodies or the bispecific antibodies comprising a first domain that specifically binds CD3 and a second domain that specifically binds a second antigen of the invention
- a package insert comprising instructions for administering the composition to a subject to treat or delay progression of a cell proliferative disorder.
- package insert is used to refer to instructions customarily included in commercial packages of therapeutic products, that contain information about the indications, usage, dosage,
- the subject can be a human.
- isolated polynucleotides that encode the anti-CD3 antibodies of the invention or the bispecific antibodies comprising a first domain that specifically binds CD3 and a second domain that specifically binds a second antigen of the invention.
- the isolated polynucleotides capable of encoding the variable domains provided herein may be included on the same, or different, vectors to produce antibodies or antigen-binding fragments of the invention.
- the polynucleotides of the invention include a polynucleotide encoding a leader sequence. Any leader sequence known in the art may be employed.
- the polynucleotide encoding the leader sequence may include, a restriction endonuclease cleavage site or a translation initiation site.
- vectors comprising the polynucleotides of the invention.
- the vectors can be expression vectors.
- the expression vector may contain one or more additional sequences such as but not limited to regulatory sequences (e.g., promoter, enhancer), a selection marker, and a polyadenylation signal.
- Vectors for transforming a wide variety of host cells are well known and include, but are not limited to, plasmids, phagemids, cosmids, baculoviruses, bacmids, bacterial artificial chromosomes (BACs), yeast artificial chromosomes (YACs), as well as other bacterial, yeast and viral vectors.
- Recombinant expression vectors within the scope of the description include synthetic, or cDNA-derived nucleic acid fragments that encode at least one recombinant protein which may be operably linked to suitable regulatory elements.
- suitable regulatory elements may include a transcriptional promoter, sequences encoding suitable mRNA ribosomal binding sites, and sequences that control the termination of transcription and translation.
- Expression vectors may also include one or more nontranscribed elements such as an origin of replication, a suitable promoter and enhancer linked to the gene to be expressed, other 5' or 3' flanking nontranscribed sequences, 5' or 3' nontranslated sequences (such as necessary ribosome binding sites), a polyadenylation site, splice donor and acceptor sites, or transcriptional termination sequences.
- An origin of replication that confers the ability to replicate in a host may also be incorporated.
- the transcriptional and translational control sequences in expression vectors to be used in transforming vertebrate cells may be provided by viral sources. Exemplary vectors may be constructed as described by Okayama and Berg, 3 Mol. Cell. Biol. 280 (1983).
- the antibody- or antigen-binding fragment-coding sequence is placed under control of a powerful constitutive promoter, such as the promoters for the following genes: hypoxanthine phosphoribosyl transferase (HPRT), adenosine deaminase, pyruvate kinase, beta-actin, human myosin, human hemoglobin, human muscle creatine, and others.
- a powerful constitutive promoter such as the promoters for the following genes: hypoxanthine phosphoribosyl transferase (HPRT), adenosine deaminase, pyruvate kinase, beta-actin, human myosin, human hemoglobin, human muscle creatine, and others.
- HPRT hypoxanthine phosphoribosyl transferase
- adenosine deaminase pyruvate kinase
- beta-actin beta-actin
- human myosin
- Such viral promoters include without limitation, Cytomegalovirus (CMV) immediate early promoter, the early and late promoters of SV40, the Mouse Mammary Tumor Virus (MMTV) promoter, the long terminal repeats (LTRs) of Maloney leukemia virus, Human Immunodeficiency Virus (HIV), Epstein Barr Virus (EBV), Rous Sarcoma Virus (RSV), and other retroviruses, and the thymidine kinase promoter of Herpes Simplex Virus.
- CMV Cytomegalovirus
- MMTV Mouse Mammary Tumor Virus
- LTRs long terminal repeats
- HCV Human Immunodeficiency Virus
- EBV Epstein Barr Virus
- RSV Rous Sarcoma Virus
- thymidine kinase promoter Herpes Simplex Virus
- the PSMA-specific antibody or antigen-binding fragment thereof coding sequence is placed under control of an inducible promoter such as the metallothionein promoter, tetracycline-inducible promoter, doxycycline-inducible promoter, promoters that contain one or more interferon-stimulated response elements (ISRE) such as protein kinase R 2', 5'- oligoadenylate synthetases, Mx genes, ADAR1, and the like.
- ISRE interferon-stimulated response elements
- Vectors described herein may contain one or more Internal Ribosome Entry Site(s) (IRES). Inclusion of an IRES sequence into fusion vectors may be beneficial for enhancing expression of some proteins.
- the vector system will include one or more polyadenylation sites (e.g., SV40), which may be upstream or downstream of any of the aforementioned nucleic acid sequences.
- Vector components may be contiguously linked, or arranged in a manner that provides optimal spacing for expressing the gene products (i.e., by the introduction of“spacer” nucleotides between the ORFs), or positioned in another way.
- Regulatory elements such as the IRES motif, may also be arranged to provide optimal spacing for expression.
- the vectors may comprise selection markers, which are well known in the art.
- Selection markers include positive and negative selection markers, for example, antibiotic resistance genes (e.g., neomycin resistance gene, a hygromycin resistance gene, a kanamycin resistance gene, a tetracycline resistance gene, a penicillin resistance gene), glutamate synthase genes, HSV-TK, HSV-TK derivatives for ganciclovir selection, or bacterial purine nucleoside phosphorylase gene for 6-methylpurine selection (Gadi et al., 7 Gene Ther. 1738-1743 (2000)).
- a nucleic acid sequence encoding a selection marker or the cloning site may be upstream or downstream of a nucleic acid sequence encoding a polypeptide of interest or cloning site.
- the vectors described herein may be used to transform various cells with the genes encoding the described antibodies or antigen-binding fragments.
- the vectors may be used to generate anti-CD3, anti-PSMA, anti-CD33, anti-TMEFF2, or anti-ILlRAP antibodies or antigen-binding fragment-producing cells.
- the invention also provides a host cell comprising the vectors of the invention.
- chromosome transfer e.g., cell fusion, chromosome mediated gene transfer, micro cell mediated gene transfer
- physical methods e.g., transfection, spheroplast fusion, microinjection
- Cells suitable for use in the expression of the antibodies or antigen-binding fragments described herein are preferably eukaryotic cells, more preferably cells of plant, rodent, or human origin, for example but not limited to NSO, CHO, CHOK1, perC.6, Tk-tsl3, BHK, HEK293 cells, COS-7, T98G, CV-l/EBNA, L cells, C127, 3T3, HeLa, NS1, Sp2/0 myeloma cells, and BHK cell lines, among others.
- expression of antibodies may be accomplished using hybridoma cells. Methods for producing hybridomas are well established in the art.
- Cells transformed with expression vectors of the invention may be selected or screened for recombinant expression of the antibodies or antigen-binding fragments of the invention.
- Recombinant-positive cells are expanded and screened for subclones exhibiting a desired phenotype, such as high level expression, enhanced growth properties, or the ability to yield proteins with desired biochemical characteristics, for example, due to protein modification or altered post-translational modifications. These phenotypes may be due to inherent properties of a given subclone or to mutation. Mutations may be effected through the use of chemicals, UV- wavelength light, radiation, viruses, insertional mutagens, inhibition of DNA mismatch repair, or a combination of such methods.
- the invention also provides for pharmaceutical compositions comprising the antibodies of the invention and a pharmaceutically acceptable carrier.
- the antibodies of the invention may be prepared as pharmaceutical compositions containing an effective amount of the antibody as an active ingredient in a pharmaceutically acceptable carrier.
- Carrier refers to a diluent, adjuvant, excipient, or vehicle with which the antibody of the invention is
- Such vehicles may be liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like.
- 0.4% saline and 0.3% glycine may be used.
- These solutions are sterile and generally free of particulate matter. They may be sterilized by conventional, well-known sterilization techniques (e.g., filtration).
- the compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate
- the concentration of the antibodies of the invention in such pharmaceutical formulation may vary, from less than about 0.5%, usually to at least about 1% to as much as 15 or 20% by weight and may be selected primarily based on required dose, fluid volumes, viscosities, etc., according to the particular mode of administration selected.
- Suitable vehicles and formulations, inclusive of other human proteins, e.g., human serum albumin are described, for example, in e.g. Remington: The Science and Practice of Pharmacy, 21 st Edition, Troy, D.B. ed., Lipincott Williams and Wilkins, Philadelphia, PA 2006, Part 5, Pharmaceutical Manufacturing pp 691-1092, See especially pp. 958-989.
- the mode of administration for therapeutic use of the antibodies of the invention may be any suitable route that delivers the antibody to the host, such as parenteral administration, e.g., intradermal, intramuscular, intraperitoneal, intravenous or subcutaneous, pulmonary, transmucosal (oral, intranasal, intravaginal, rectal), using a formulation in a tablet, capsule, solution, powder, gel, particle; and contained in a syringe, an implanted device, osmotic pump, cartridge, micropump; or other means appreciated by the skilled artisan, as well known in the art.
- parenteral administration e.g., intradermal, intramuscular, intraperitoneal, intravenous or subcutaneous
- pulmonary transmucosal
- oral intranasal, intravaginal, rectal
- a formulation in a tablet, capsule, solution, powder, gel, particle and contained in a syringe
- an implanted device osmotic pump, cartridge, micro
- Site specific administration may be achieved by for example intratumoral, intrarticular, intrabronchial, intraabdominal, intracapsular, intracartilaginous, intracavitary, intracelial, intracerebellar, intracerebroventricular, intracolic, intracervical, intragastric, intrahepatic, intracardial, intraosteal, intrapelvic, intrapericardiac, intraperitoneal, intrapleural, intraprostatic, intrapulmonary, intrarectal, intrarenal, intraretinal, intraspinal, intrasynovial, intrathoracic, intrauterine, intravascular, intravesical, intralesional, vaginal, rectal, buccal, sublingual, intranasal, or transdermal delivery.
- the antibodies of the invention may be administered to a subject by any suitable route, for example parentally by intravenous (i.v.) infusion or bolus injection, intramuscularly or subcutaneously or intraperitoneally.
- i.v. infusion may be given over for example 15, 30, 60, 90, 120, 180, or 240 minutes, or from 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 or 12 hours.
- the dose given to a subject is sufficient to alleviate or at least partially arrest the disease being treated (“therapeutically effective amount”) and may be sometimes 0.005 mg to about 100 mg/kg, e.g. about 0.05 mg to about 30 mg/kg or about 5 mg to about 25 mg/kg, or about 4 mg/kg, about 8 mg/kg, about 16 mg/kg or about 24 mg/kg , or for example about 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 mg/kg, but may even higher, for example about 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 40, 50, 60, 70, 80, 90 or 100 mg/kg.
- a fixed unit dose may also be given, for example, 50, 100, 200, 500 or 1000 mg, or the dose may be based on the patient's surface area, e.g., 500, 400, 300, 250, 200, or 100 mg/m2.
- 1 and 8 doses e.g., 1, 2, 3, 4, 5, 6, 7 or 8
- 1 and 8 doses may be administered to treat the patient, but 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more doses may be given.
- the administration of the antibodies of the invention may be repeated after one day, two days, three days, four days, five days, six days, one week, two weeks, three weeks, one month, five weeks, six weeks, seven weeks, two months, three months, four months, five months, six months or longer. Repeated courses of treatment are also possible, as is chronic administration.
- the repeated administration may be at the same dose or at a different dose.
- the antibodies of the invention described herein may be administered at 8 mg/kg or at 16 mg/kg at weekly interval for 8 weeks, followed by administration at 8 mg/kg or at 16 mg/kg every two weeks for an additional 16 weeks, followed by administration at 8 mg/kg or at 16 mg/kg every four weeks by intravenous infusion.
- the antibodies in the methods described herein may be provided as a daily dosage in an amount of about 0.1-100 mg/kg, such as 0.5, 0.9, 1.0, 1.1, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 40, 45, 50, 60, 70, 80, 90 or 100 mg/kg, per day, on at least one of day 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, or 40, or alternatively, at least one of week 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 after initiation of treatment, or any combination thereof, using single or divided doses of every 24, 12, 8, 6, 4, or 2 hours, or any combination thereof.
- 0.1-100 mg/kg such as 0.5, 0.9, 1.0, 1.1, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15,
- the antibodies in the methods described herein may also be administered.
- the antibodies provided herein may be lyophilized for storage and reconstituted in a suitable carrier prior to use. This technique has been shown to be effective with conventional protein preparations and well-known lyophilization and reconstitution techniques can be employed.
- kits for detecting CD3, PSMA, CD33, TMEFF2, or IF 1 RAP in a sample comprising obtaining the sample, contacting the sample with the anti-CD3, the anti- PSMA, the anti-CD33, anti- TMEFF2, or the anti-IPlRAP antibody of the invention and detecting the antibody bound to CD3, PSMA, CD33, TMEFF2, or IF 1 RAP in the sample.
- the sample may be derived from urine, blood, serum, plasma, saliva, ascites, circulating cells, circulating tumor cells, cells that are not tissue associated (i.e., free cells), tissues (e.g., surgically resected tumor tissue, biopsies, including fine needle aspiration), histological preparations, and the like.
- the antibodies of the invention may be detected using known methods. Exemplary methods include direct labeling of the antibodies using fluorescent or chemiluminescent labels, or radiolabels, or attaching to the antibodies of the invention a moiety which is readily detectable, such as biotin, enzymes or epitope tags.
- Exemplary labels and moieties are ruthenium, 111 In-DOTA, 111 In- diethylenetriaminepentaacetic acid (DTP A), horseradish peroxidase, alkaline phosphatase and beta-galactosidase, poly-histidine (HIS tag), acridine dyes, cyanine dyes, fluorone dyes, oxazin dyes, phenanthridine dyes, rhodamine dyes and Alexafluor® dyes.
- DTP A 111 In- diethylenetriaminepentaacetic acid
- HIS tag poly-histidine
- acridine dyes cyanine dyes
- fluorone dyes oxazin dyes
- phenanthridine dyes phenanthridine dyes
- rhodamine dyes Alexafluor® dyes.
- the antibodies provided herein may be used in a variety of assays to detect CD3, PSMA, CD33, IL1RAP, TMEFF2 or CD3 and the second antigenin the sample.
- exemplary assays are western blot analysis, radioimmunoassay, surface plasmon resonance, immunoprecipitation, equilibrium dialysis, immunodiffusion, electrochemiluminescence (ECL) immunoassay, immunohistochemistry, fluorescence-activated cell sorting (FACS) or ELISA assay.
- the invention also provides a kit comprising one or more of the anti-CD3, the anti- PSMA, the anti-CD33, anti-TMEFF2 or the anti-ILlRAP antibodies or the bispecific antibodies comprising a first domain that specifically binds CD3 and a second domain that specifically binds a second antigen of the invention or antigen-binding fragments thereof.
- the described kits may be used to carry out the methods of using the anti-CD3, the anti -PSMA, the anti-CD33, anti- TMEFF2 or the anti-ILlRAP antibodies or the bispecific antibodies comprising a first domain that specifically binds CD3 and a second domain that specifically binds a second antigen of the invention or other methods known to those skilled in the art.
- the described kits may include the antibodies or antigen-binding fragments described herein and reagents for use in detecting the presence of CD3 or the second antigen such as PSMA, CD33, IL1RAP, TMEFF2 in a biological sample
- the described kits may include one or more of the antibodies, or an antigen-binding fragment(s) thereof, described herein and a vessel for containing the antibody or fragment when not in use, instructions for use of the antibody or fragment, the antibody or fragment affixed to a solid support, and/or detectably labeled forms of the antibody or fragment, as described herein.
- the invention also provides a kit comprising the herein described antibody that specifically binds PSMA.
- the invention also provides a kit comprising the herein described antibody specifically binding CD33.
- the invention also provides a kit comprising the herein described antibody specifically binding IL1RAP.
- the invention also provides a kit comprising the herein described antibody specifically binding TMEFF2.
- the kit may be used for therapeutic uses and as diagnostic kits.
- the kit may be used to detect the presence of CD3, PSMA, CD33, IL1RAP, TMEFF2 and/or the second antigen in a biological sample.
- the kit comprises the antibody of the invention described herein and reagents for detecting the antibody.
- the kit can include one or more other elements including: instructions for use; other reagents, e.g., a label, a therapeutic agent, or an agent useful for chelating, or otherwise coupling, an antibody to a label or therapeutic agent, or a
- radioprotective composition devices or other materials for preparing the antibody for administration; pharmaceutically acceptable carriers; and devices or other materials for administration to a subject.
- the kit comprises the antibody of the invention in a container and instructions for use of the kit.
- the antibody in the kit is labeled.
- the anti-CD3 antibodies of the invention bind human CD3 and optionally cynomolgus CD3.
- the anti- CD3 antibodies of the invention and fragments thereof bind to human and cynomolgus CD3 with affinities within 5-fold of each other. In other words, the difference in antibody binding is less than a multiple of 5.
- the anti-CD3 antibody of the invention can be used for both preclinical evaluation of safety, activity and/or pharmacokinetic profile of CD3 in primates and as a drug in humans. Put in other words, the same CD3 -specific molecule can be used in preclinical animal studies as well as in clinical studies in humans.
- the anti- CD3 antibodies and fragments thereof of the invention bind an epitope formed by the CD3e/d subunits.
- the CD3 -specific antibodies may be human, humanized, or chimeric. Also
- OmniRat Open Monoclonal Technologies
- the anti-CD3 antibody or fragment thereof has one, two, three, four or five of the following properties:
- a) binds human and Macaca fascicularis CD3+ T lymphocytes with a calculated EC50 of 20 nM or less and binds Macaca fascicularis CD3 -expressing HEK cells with a calculated EC50 of 40 nM or less, wherein the difference in calculated EC50 between binding CD3+ T lymphocytes and binding Macaca fascicularis CD3 -expressing HEK cells is less than 5-fold, and wherein the calculated EC50 is measured in a whole cell binding assay at 0 °C using flow cytometry;
- b) binds recombinant CD3d from human (SEQ ID NO: 691), or binds recombinant CD3e from human (SEQ ID NO:636), or binds recombinant CD3e fromMacaca fascicularis (SEQ ID NO:693) with an equilibrium dissociation constant (KD) of 12 nM or less, wherein the KD is measured using Proteon surface plasmon resonance assay ProteOn XPR36 system at +25°C;
- c) displays no methionine or tryptophan oxidation, or displays no asparagine deamidation, or displays no asparagine isomerization as detected by peptide mapping analysis;
- e activates T cells or induces CD69 expression to a similar degree as cOKT3 or SP34-2 as determined by fluorescence-activated cell sorting assay.
- the anti-CD3 antibodies and fragments thereof of the invention have an in vitro binding affinity (Kd) to human T cells expressing human CD3 that is from about 5 nM to about 1000 nM, preferably from about 5 nM to about 50 nM, from about 50 nM to about 100 nM, from about 100 nM to about 200 nM, from about 200 nM to about 300 nM, from about 300 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, and from about 900 nM to about 1000 nM, more preferably from about 5 nM to about 300 nM, as determined by flow cytometry.
- Kd in vitro binding affinity
- the anti-CD3 antibodies and fragments thereof of the invention are bivalent antibodies having an in vitro binding affinity (Kd) to human T cells expressing human CD3 that is from about 5 nM to about 1000 nM preferably from about 5 nM to about 50 nM, from about 50 nM to about 100 nM, from about 100 nM to about 200 nM, from about 200 nM to about 300 nM, from about 300 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, and from about 900 nM to aboutlOOO nM, more preferably from about 5 nM to about 300 nM, most preferably about 100 nM, as determined by flow cytometry.
- Kd in vitro binding affinity
- the anti-CD3 antibodies and fragments thereof of the invention are monovalent constructs having an in vitro binding affinity (Kd) to human T cells expressing human CD3 that is from about 5 nM to about 1000 nM preferably from about 5 nM to about 50 nM, from about 50 nM to about 100 nM, from about 100 nM to about 200 nM, from about 200 nM to about 300 nM, from about 300 nM to about 400 nM, from about 400 nM to about 500 nM, from about 500 nM to about 600 nM, from about 600 nM to about 700 nM, from about 700 nM to about 800 nM, from about 800 nM to about 900 nM, and from about 900 nM to aboutl 000 nM, more preferably from about 100 nM to about 250 nM, most preferably about 250 nM, as determined by flow cytometry.
- Kd in vitro binding affinity
- the anti-CD3 antibodies and fragments thereof described herein compete with commercial CD3 antibody SP34-2 (BD Biosciences 551916) for binding of CD3, as determined by a competition binding assay using an AlexaFluor 488-conjugated SP34-2 antibody on primary human T cells measured using flow cytometry.
- the anti-CD3 antibodies and fragments thereof exhibit no post-translational modification, including no oxidation, no deamidation, and no aspartate isomerization, as determined by peptide mapping.
- the anti-CD3 antibodies and fragments thereof are effective in activating T cells and inducing CD69 expression to a similar degree as SP34-2 in human and cynomolgus monkey T cells and cOKT3 in human T cells, as determined by a T cell based assay using flow cytometry.
- the anti-CD3 antibodies and fragments thereof described herein have a total enthalpy of unfolding of about 400 kcal/mol or more, about 410 kcal/mol or more, about 420 kcal/mol or more, about 430 kcal/mol or more, about 440 kcal/mol or more, about 45 kcal/mol or more, about 460 kcal/mol or more, about 470 kcal/mol or more, about 480 kcal/mol or more, about 490 kcal/mol or more, about 500 kcal/mol or more, about 510 kcal/mol or more, about 520 kcal/mol or more, about 530 kcal/mol or more, about 540 kcal/mol or more, or about 550 kcal/mol or more.
- the anti-CD3 antibodies and fragments thereof of the invention have a total enthalpy of unfolding of about 418 kcal/mol, 545 kcal/mol, about 402 kcal/mol, or about 406 kcal/mol
- the anti-CD3 antibodies are CD3B376 (IgG4 PAA), CD3B450 (IgG4 PAA), CD3B389 (IgGlsigma), and CD3B467 (IgGlsigma) molecules, respectively.
- Exemplary such antibodies include CD3B311, CD3B312, CD3B313, CD3B314, CD3B315, CD3B316, CD3B317, CD3B334, CD3B376 CD3B389, CD3B450 and CD3B467, and CD3B376 and CD3B450 engineered into a monovalent format
- anti-CD3 antibodies or antigen-binding fragments of the invention can occur in a variety of forms, but will include one or more of the antibody variable domain segments or CDRs shown in Table 7A and engineered variants thereof, for example, those shown or described in Table 9 and Table 10, and the accompanying descriptions thereof.
- the invention also provides an anti-CD3 antibody, or an antigen-binding fragment thereof, comprising a heavy chain comprising a HCDR1, a HCDR2, and a HCDR3 of any one of the antibodies described in Table 7B.
- the invention also provides an anti-CD3 antibody or an antigen-binding fragment thereof, comprising a heavy chain comprising a HCDR1, a HCDR2, and a HCDR3 of any one of the antibodies described in Table 7B and a light chain comprising a LCDR1, a LCDR2, and a LCDR3 of any one of the antibodies described in Table 7B.
- invention competes for binding to CD3 with an antibody or antigen-binding fragment thereof comprising a heavy chain comprising a HCDR1 , a HCDR2, and a HCDR3 of any one of the antibodies described in Table 7B and a light chain comprising a LCDR1, a LCDR2, and a LCDR3 of any one of the antibodies described in Table 7B.
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises the HCDR1 , the HCDR2 and the HCDR3 contained within a heavy chain variable region (VH) of SEQ ID NOs:65l, 652, 653, 654, 655, 687, or 656, wherein the HCDR1 , the HCDR2 and the HCDR3 are defined by Chothia, Kabat, or IMGT.
- VH heavy chain variable region
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises the LCDR1 , the LCDR2 and the LCDR3 contained within a light chain variable region (VL) of SEQ ID NOs: 658, 659, 694, 660, 688, or 661, wherein the LCDR1, the LCDR2 and the LCDR3 are defined by Chothia, Kabat, or IMGT.
- VL light chain variable region
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises the HCDR1 , the HCDR2 and the HCDR3 of
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises the LCDR1 , the LCDR2 and the LCDR3 of
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises the HCDR1, HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3 of SEQ ID NOs: 662, 663, 664, 773, 669, and 670, respectively.
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises the HCDR1, HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3 of SEQ ID NOs: 662, 663, 664, 773, 673, and 670, respectively.
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises the HCDR1, HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3 of SEQ ID NOs: 662, 663, 664, 671, 669, and 670, respectively.
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises the HCDR1, HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3 of SEQ ID NOs: 662, 663, 664, 671, 673, and 690, respectively.
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises the HCDR1, HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3 of SEQ ID NOs: 662, 695, 664, 773, 669, and 670, respectively.
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises the HCDR1, HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3 of SEQ ID NOs: 662, 695, 664, 773, 673, and 670, respectively.
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises the HCDR1, HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3 of SEQ ID NOs: 662, 695, 664, 671, 669, and 670, respectively.
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises the HCDR1, HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3 of SEQ ID NOs: 662, 695, 664, 671, 673, and 670, respectively.
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises the HCDR1, HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3 of SEQ ID NOs: 665, 663, 664, 773, 669, and 670, respectively.
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises the HCDR1, HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3 of SEQ ID NOs: 665, 663, 664, 773, 673, and 670, respectively.
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises the HCDR1, HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3 of SEQ ID NOs: 665, 663, 664, 671, 669, and 670, respectively.
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises the HCDR1, HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3 of SEQ ID NOs: 665, 663, 664, 671, 673, and 670, respectively.
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises the HCDR1, HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3 of SEQ ID NOs: 665, 695, 664, 773, 669, and 670, respectively.
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises the HCDR1, HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3 of SEQ ID NOs: 665, 695, 664, 773, 673, and 670, respectively.
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises the HCDR1, HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3 of SEQ ID NOs: 665, 695, 664, 776, 669, and 670, respectively.
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises the HCDR1, HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3 of SEQ ID NOs: 665, 695, 664, 776, 673, and 670, respectively.
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises the HCDR1, HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3 of SEQ ID NOs: 666, 663, 664, 773, 669, and 670, respectively.
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises the HCDR1, HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3 of SEQ ID NOs: 666, 663, 664, 773, 673, and 670, respectively.
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises the HCDR1, HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3 of SEQ ID NOs: 666, 663, 664, 776, 669, and 670, respectively.
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises the HCDR1, HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3 of SEQ ID NOs: 666, 663, 664, 671, 673, and 670, respectively.
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises the HCDR1, HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3 of SEQ ID NOs: 666, 695, 664, 773, 669, and 670, respectively.
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises the HCDR1, HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3 of SEQ ID NOs: 666, 695, 664, 773, 673, and 670, respectively.
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises the HCDR1, HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3 of SEQ ID NOs: 666, 695, 664, 671, 669, and 670, respectively.
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises the HCDR1, HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3 of SEQ ID NOs: 666, 695, 664, 671, 673, and 670, respectively.
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises the HCDR1, HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3 of SEQ ID NOs: 662, 689, 664, 671, 673, and 670, respectively.
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises the HCDR1, HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3 of SEQ ID NOs: 662, 663, 664, 710, 673, and 670, respectively.
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises the HCDR1, HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3 of SEQ ID NOs: 662, 663, 664, 671, 673, and 690, respectively.
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises the HCDR1, HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3 of SEQ ID NOs: 662, 663, 664, 773, 673, and 690, respectively.
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises a heavy chain (HC) sequence of SEQ ID NO: 709, 640, 641, 642, 643, 675, or 644 and/or a light chain (LC) sequence of SEQ ID NO: 645, 716, 649, 676, 677, or 650.
- HC heavy chain
- LC light chain
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises a HC having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 709, 640, 641, 642, 643, 675, or 644, and a LC having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 645, 716, 649, 676, 677, or 650.
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises a HC having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 709, 640, 641, 642, 643, 675, or 644, and a LC having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO:645, 716, 649, 676, 677 or 650, wherein the variation in sequence does not occur in a CDR region.
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises a heavy chain variable region (VH) sequence of SEQ ID NO:65l, 652, 657, 653, 654, 655, 687, or 656 and/or a light chain variable region (VL) sequence of SEQ ID NO:658, 659, 694, 660, 688, 678, or 661.
- VH heavy chain variable region
- VL light chain variable region
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises a VH having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 651, 652, 657, 653, 654, 655, 687, or 656, and a VL having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NOS 658, 659, 694, 660, 688, 678, or 661.
- the anti-CD3 antibody of an antigen-binding fragment thereof of the invention comprises a VH having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 651, 652, 657, 653, 654, 655, 687, or 656, and a VL having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% or more, such as 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 658, 659, 694, 660, 688, 678, or 661, wherein the variation in sequence does not occur in a CDR region.
- PSMA-Specific Antibodies PSMA-Specific Antibodies
- the antibodies and fragments thereof that bind to PSMA bind to the chimpanzee target antigen.
- the antibodies and fragments thereof bind to the human and macaque PSMA target antigens with affinities within 5-fold of each other.
- the difference in antibody binding is less than a multiple of 5.
- the identical antibody molecule can be used both for preclinical evaluation of safety, activity and/or pharmacokinetic profile of PSMA in primates and as a drug in humans.
- the same PSMA- specific molecule can be used in preclinical animal studies as well as in clinical studies in humans. This leads to highly comparable results and a much-increased predictive power of the animal studies compared to species-specific surrogate molecules.
- the PSMA domain is cross-species specific, i.e. reactive with the human and macaque antigens
- the antibody or fragments thereof of the invention can be used both for preclinical evaluation of safety, activity and/or pharmacokinetic profile of these binding domains in primates and— in the identical form— as drug in humans.
- the present invention also provides for multispecific antibodies that specifically bind to PSMA.
- a bispecific, i.e. bifunctional, antibody can be used to engage two different therapeutic targets or perform two distinct functions. Such antibodies can be used for example to recruit an immune effector cell, e.g. T- or NK-cell, towards a particular target cell.
- Various antibody-fragment based molecules are known and under investigation, for example for cancer therapy.
- the present invention also provides for a PSMA /“effector antigen” bispecific antibody.
- the effector antigen of the PSMA /“effector antigen” bispecific antibody is CD3.
- PSMA/CD3 bispecific antibody wherein the identical molecule can be used in preclinical animal testing, as well as clinical studies and even in therapy in human. This is due to the identification of the PSMA/CD3 bispecific antibody, which, in addition to binding to human PSMA and human CD3, respectively, also binds to the homologs of antigens of chimpanzee and macaques.
- the PSMA/CD3 bispecific antibody of the invention can be used as a therapeutic agent against various diseases, including, but not limited, to cancer.
- the need to construct a surrogate target PSMA/CD3 bispecific antibody for testing in a phylogenetically distant (from humans) species disappears.
- the identical molecule can be used in animal preclinical testing as is intended to be administered to humans in clinical testing as well as following market approval and therapeutic drug administration.
- the isolated antibody or antibody fragment thereof specifically binding PSMA has one, two, three, four or five of the following properties: a. binds Pan troglodytes PSMA extracellular domain (ECD) with an equilibrium dissociation constant (KD) of 25 nM or less, wherein the KD is measured using ProteOn XPR36 system at +25°C,
- ECD Pan troglodytes PSMA extracellular domain
- KD equilibrium dissociation constant
- b. binds LNCaP cells with a calculated EC50 of 20 nM or less and binds Macaca fascicularis PSMA-expressing HEK cells with a calculated EC50 of 40 nM or less, wherein the difference in calculated EC50 between binding LNCaP cells and binding Macaca fascicularis PSMA-expressing HEK cells is less than 5-fold, and wherein the calculated EC50 is measured in a whole cell binding assay at 0 °C using flow cytometry,
- c. binds recombinant PSMA ECD from human (SEQ ID NO: 55), Pan troglodytes (SEQ ID NO: 52) and Macaca fascicularis (SEQ ID NO: 53) with an equilibrium dissociation constant (KD) of 12 nM or less, wherein the KD is measured using Proteon surface plasmon resonance assay ProteOn XPR36 system at +25°C;
- Exemplary such antibodies or fragments thereof are PSMA antibodies PSMB119, PSMB120, PSMB121, PSMB122, PSMB123, PSMB87, PSMB126, PSMB127, PSMB128, PSMB129, PSMB130, PSMB120, PSMB121, PSMB122, PSMB123, PSMB127, PSMB128, PSMB130, PSMB344, PSMB345, PSMB346, PSMB347, PSMB349, PSMB358, PSMB359, PSMB360, PSMB361, PSMB362, PSMB363, and PSMB365 described herein.
- the antibody specifically binding PSMA of the invention comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs:56, 57, 58, 59, 60, and 61, respectively.
- the antibody specifically binding PSMA of the invention comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs:62, 63, 64, 65, 60, and 66, respectively.
- the antibody specifically binding PSMA of the invention comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs:67, 68, 69, 70, 71, and 72, respectively.
- PSMA of the invention comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs:73, 74, 75, 76, 60, and 61, respectively.
- the antibody specifically binding PSMA of the invention comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs:78, 79, 80, 81, 82, and 83, respectively.
- the antibody specifically binding PSMA of the invention comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs:84, 85, 86, 87, 60, and 88, respectively.
- the antibody specifically binding PSMA of the invention comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs:89, 90, 91, 92, 93, and 94, respectively.
- the antibody specifically binding PSMA of the invention comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs:95, 96, 97, 65, 60, and 66, respectively.
- the antibody specifically binding PSMA of the invention comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs:84, 98, 99, 100, 82, and 101, respectively.
- the antibody specifically binding PSMA of the invention comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs:89, 90, 102, 103, 104, and 105, respectively.
- PSMA of the invention comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs:89, 90, 106, 103, 104, and 105, respectively.
- the antibody specifically binding PSMA of the invention comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs: 107, 108, 109, 76, 60, and 88, respectively.
- the antibody specifically binding PSMA of the invention comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs: 78, 1, 80, 81, 82, and 83, respectively.
- the antibody specifically binding PSMA of the invention comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs: 78, 1, 80, 81, 82, and 83, respectively.
- the antibody specifically binding PSMA of the invention comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs: 78, 1, 80, 4, 82, and 686, respectively.
- PSMA of the invention comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs: 78, 1, 80, 81, 792, and 686, respectively.
- the antibody specifically binding PSMA of the invention comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs: 78, 2, 80, 81, 82, and 83, respectively.
- the antibody specifically binding PSMA of the invention comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs: 78, 3, 80, 81, 82, and 5, respectively.
- the antibody specifically binding PSMA of the invention comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs: 78, 3, 80, 81, 82, and 83, respectively.
- the antibody specifically binding PSMA of the invention comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs: 78, 3, 80, 4, 82, and 686, respectively.
- PSMA of the invention comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs: 78, 3, 80, 81, 792, and 686, respectively.
- the antibody specifically binding PSMA of the invention comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs: 78, 2, 81, 81, 82, and 5, respectively.
- the antibody specifically binding PSMA of the invention comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs: 78, 2, 80, 4, 792, and 686, respectively.
- the antibody specifically binding PSMA of the invention comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs: 78, 2, 80, 4, 792, and 686, respectively.
- the antibody specifically binding PSMA of the invention comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs: 78, 683, 80, 81, 792, and 686, respectively.
- the antibody specifically binding PSMA of the invention comprises a heavy chain variable region (VH) of SEQ ID NOs: 6, 7, 8, 110, 112, 114, 116, 118, 120, 121, 123, 125, 126, 128, 130, or 681.
- the antibody specifically binding PSMA of the invention comprises a light chain variable region (VL) of SEQ ID NOs: 9, 111, 113, 115, 117, 119, 122, 124, 127, 129, 131, or 682.
- the antibody specifically binding PSMA of the invention comprises a heavy chain sequence of SEQ ID NOs: 12, 13, 132, 134,
- the antibody specifically binding PSMA of the invention comprises a light chain sequence of SEQ ID NOs: 14, 15, 75, 133, 135,
- the CD33 -specific antibodies of the invention possess one or more desirable functional properties, including but not limited to high-affinity binding to CD33 and/or CD3, high specificity to CD33 and/or CD3, and the ability to treat or prevent cancer when administered alone or in combination with other anti-cancer therapies.
- the isolated monoclonal antibodies or antigen-binding fragments thereof bind the C2 domain of CD33. In certain embodiments, the isolated monoclonal antibodies or antigen-binding fragments thereof bind the V domain of CD33.
- the full length human CD33 is provided by Uniprot P20138 (SEQ ID NO:244).
- an antibody that“specifically binds to CD33” refers to an antibody that binds to a CD33, preferably a human CD33, preferably the C2 domain of CD33, with a KD of 1 x 10 -7 M or less, preferably 1 x 10 -8 M or less, more preferably 5 x 10 -9 M or less, 1 x 10 -9 M or less, 5x 10 -10 M or less, or 1 x 10 -10 M or less.
- the antibodies or antigen-binding fragments described herein can occur in a variety of forms, but will include one or more of the antibody CDRs shown in Table 39 and 40.
- CD33 -specific antibodies or antigen binding fragments are human IgG, or derivatives thereof. While the CD33 -specific antibodies or antigen-binding fragments exemplified herein are human, the antibodies or antigen-binding fragments exemplified may be chimerized.
- an CD33-specific antibody, or an antigen-binding fragment thereof comprising a heavy chain comprising a CDR1, a CDR2, and a CDR3 of any one of the antibodies described in Table 39.
- an CD33- specific antibody, or an antigen-binding fragment thereof comprising a heavy chain comprising a CDR1, a CDR2, and a CDR3 of any one of the antibodies described in Table 39 and a light chain comprising a CDR1, a CDR2, and a CDR3 of any one of the antibodies described in Table 40.
- a CD33 -specific antibody, or antigen-binding fragment thereof comprising a heavy chain variable region shown in Table 38. In some embodiments are provided a CD33-specific antibody, or antigen-binding fragment thereof, comprising a light chain variable region shown in Table 38.
- the effector arm is a CD3 arm.
- the CD3 arm comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2, and the LCDR3 of SEQ ID NO: 1
- the CD3 arm comprises the VH and VL of SEQ ID NOs: 652 and 661, respectively. In some embodiments of the CD33xCD3 bispecific antibody, the CD3 arm comprises the HC and LC of SEQ ID NOs: 640 and 676, respectively.
- the CD3 arm comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2, and the LCDR3 of SEQ ID NO:
- the CD3 arm comprises the VH and VL of SEQ ID NOs:657 and 678, respectively. In some embodiments of the CD33xCD3 bispecific antibody, the CD3 arm comprises comprises the HC and LC of SEQ ID NOs:675 and 677, respectively.
- the anti-CD33 antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 95% identical to SEQ ID NO:267, 260, 275, 270, 262, 258, 257, 281, 292, 291, 261, 269, 280, 259, 263, 264, 265, 266, 272, 277, 279, 284, or 285, or a light chain variable region having a polypeptide sequence at least 95% identical to SEQ ID NO:287, 314, 309, 301, 298, 297, 290, 332, 331, 302, 310, 320, 300, 304, 305, 306, 307, 317, 319, 324, or 325; and the anti-CD3 antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 95% identical to SEQ ID NO:257 or 258, or a light chain variable region having a polypeptide sequence at least 95% identical to SEQ ID NO:2
- the terms“interleukin- 1 receptor accessory protein”,“IL1RAP” and “ILl-RAP” specifically include the human IL1RAP protein (SEQ ID NO: 576), for example as described in GenBank Accession No. AAB84059, NCBI Reference Sequence: NP_002l73. l and UniProtKB/Swiss-Prot Accession No. Q9NPH3-1 (see also Huang et al, 1997, Proc. Natl. Acad. Sci. USA. 94 (24), 12829-12832).
- IL1RAP is also known in the scientific literature as IL1 R3, C3orfl3, FLJ37788, IL-l RAcP and EG3556.
- the antibodies or antigen-binding fragments described herein can occur in a variety of forms, but will include one or more of the antibody CDRs shown in Table 29.
- IL1 RAP-specific antibodies or antigen binding fragments are human IgG, or derivatives thereof. While the IL1 RAP-specific antibodies or antigen-binding fragments exemplified herein are human, the antibodies or antigen-binding fragments exemplified may be chimerized.
- an IL1 RAP-specific antibody, or an antigen-binding fragment thereof comprising a heavy chain comprising a CDR1, a CDR2, and a CDR3 of any one of the antibodies described in Table 29.
- an IL1 RAP-specific antibody, or an antigen-binding fragment thereof comprising a heavy chain comprising a CDR1 , a CDR2, and a CDR3 of any one of the antibodies described in Table 29 and a light chain comprising a CDR1, a CDR2, and a CDR3 of any one of the antibodies described in Table 29.
- a IL1 RAP-specific antibody, or antigen-binding fragment thereof comprising a heavy chain variable region of any one of the antibodies shown in Table 30. In some embodiments are provided a IL1 RAP-specific antibody, or antigen-binding fragment thereof, comprising a light chain variable region of any one of the antibodies shown in Table 30. In some embodiments are provided a IL1 RAP-specific antibody, or antigen-binding fragment thereof, comprising a heavy chain variable region and a light chain variable region of any one of the antibodies shown in Table 30.
- the targeting arm is an anti-ILlRAP arm.
- the effector arm is a CD3 arm.
- the CD3 arm comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2, and the LCDR3 of SEQ ID NOs:662, 663, 664, 671, 673, and 670, respectively.
- the CD3 arm comprises the VH and VL of SEQ ID NOs: 652 and 661, respectively. In some embodiments of the ILlRAPxCD3 bispecific antibody, the CD3 arm comprises the HC and LC of SEQ ID NOs: 640 and 676, respectively.
- the CD3 arm comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1 , the LCDR2, and the LCDR3 of SEQ ID NOs:662, 663, 664, 773, 673, and 670, respectively.
- the CD3 arm comprises the VH and VL of SEQ ID NOs:657 and 678, respectively.
- the CD3 arm comprises comprises the HC and LC of SEQ ID NOs:675 and 677, respectively.
- TMEFF2-Specific Antibodies The invention provides an isolated anti-TMEFF2 antibody or an antigen binding fragment thereof that binds to a membrane proximal region of SEQ ID NO: 629 of TMEFF2.
- the anti-TMEFF2 antibodies of the invention binding the membrane proximal region of TMEFF2 are not internalized by cells. While wishing not to be bound by any particular theory, it can be expected that non-internalizing anti-TMEFF2 antibodies have improved oncogenic effect mediated by antibody effector functions resulting from lack of internalization and degradation of TMEFF2 when compared to internalizing anti-TMEFF2 antibodies.
- “Binds to a membrane proximal region” means that 90% of antibody epitope residues identified using hydrogen/deuterium exchange (H/D exchange) reside within the membrane proximal region of TMEFF2.
- the epitope residues are those which are protected by the test antibody by at least 5% difference in deuteration levels through H/D exchange.
- Exemplary such antibodies are TMEB675, TMEB570, TMEB674, TMEB565, TMEB762 and TMEB757 as described herein.
- the isolated anti-TMEFF2 antibody or the antigen binding fragment thereof binds within residues HGKCEHSINMQEPSC (SEQ ID NO: 592) or
- D AGYT GQHCEKKD Y S VL (SEQ ID NO: 600) is TMEB675.
- TNEB675 variants TMEB762 and TMEB757 are also expected to bind the membrane proximal region of TMEFF2 within residues DAGYTGQHCEKKDYSVL (SEQ ID NO: 600).
- H/D exchange assay In an H/D exchange assay, recombinantly expressed TMEFF2 ECD is incubated in the presence or absence of the antibody in deuterated water for predetermined times resulting in deuterium incorporation at exchangeable hydrogen atoms which are unprotected by the antibody, followed by protease digestion of the protein and analyses of the peptide fragments using LC- MS.
- H/D exchange assay can be performed using known protocols. An exemplary protocol is described in Example 5.
- the invention also provides an isolated anti-TMEFF2 antibody or an antigen binding fragment thereof, wherein the antibody or the antigen binding fragment thereof competes for binding to the membrane proximal region of TMEFF2 with a reference antibody comprising a heavy chain variable region (VH) of SEQ ID NO: 25 and a light chain variable region (VL) of SEQ ID NO: 28, the VH of SEQ ID NO: 589 and the VL of SEQ ID NO: 29, the VH of SEQ ID NO: 27 and the VL of SEQ ID NO: 30, the VH of SEQ ID NO: 589 and the VL of SEQ ID NO: 31, the VH of SEQ ID NO: 604 and the VL of SEQ ID NO: 607, or the VH of SEQ ID NO: 612 and the VL of SEQ ID NO: 613.
- VH heavy chain variable region
- VL light chain variable region
- Competition for binding of a test antibody to the membrane proximal region of TMEFF2 with the reference antibody may be assayed in vitro using well known methods. For example, binding of MSD Sulfo-TagTM NHS- ester-labeled test antibody to the membrane proximal region of TMEFF2 in the presence of an unlabeled reference antibody may be assessed by ELISA, or Bioacore analyses or flow cytometry may be used to demonstrate competition.
- the test antibody competes for binding to TMEFF2 with the reference antibody when the test antibody inhibits binding of the reference antibody to the membrane proximal region of TMEFF2 by 85% or more, for example 90% or more, or 95% or more.
- the invention also provides an isolated anti-TMEFF2 antibody or an antigen binding fragment thereof comprising a heavy chain complementarity determining region 1 (HCDR1), a HCDR2, a HCDR3, a light chain complementarity determining region 1 (LCDR1), a LCDR2 and a LCDR3 of
- the isolated anti-TMEFF2 antibody or the antigen binding fragment thereof of the invention binds to the membrane proximal region of TMEFF2 with an equilibrium dissociation constant (KD) of about 0.4 x 10 -9 M or less, wherein the KD is measured using surface plasmon resonance in acetate buffer at pH 4.5-5.0 at room temperature.
- KD equilibrium dissociation constant
- the isolated anti-TMEFF2 antibody or the antigen binding fragment thereof binds to the membrane proximal region of TMEFF2 with the KD of between about 0.1 x 10 -10 M and about 0.4 x 10 -9 M.
- the affinity of an antibody to the membrane proximal region of TMEFF2 may be determined experimentally using any suitable method.
- An exemplary method utilizes ProteOn XPR36, Biacore 3000 or KinExA instrumentation, ELISA or competitive binding assays known to those skilled in the art.
- the measured affinity of an antibody to TMEFF2 may vary if measured under different conditions (e.g., osmolarity, pH).
- affinity and other binding parameters e.g., KD, K on , and Koff
- KD, K on , and Koff are typically made with standardized conditions and a standardized buffer, such as the buffer described herein.
- the internal error for affinity measurements for example using Biacore 3000 or ProteOn can typically be within 5-33% for measurements within the typical limits of detection. Therefore, the term“about” when referring to a KD value reflects the typical standard deviation in the assay. For example, the typical SD for a KD of lxl 0 -9 M is up to +0.33xl0 -9 M.
- the invention also provides an isolated anti-TMEFF2 antibody or an antigen binding fragment thereof that binds to the membrane proximal region of TMEFF2, comprising a heavy chain variable region (VH) framework derived from VH3 3-23 (SEQ ID NO: 53) or VH1 1-69 (SEQ ID NO: 54).
- VH heavy chain variable region
- the invention also provides an isolated anti-TMEFF2 antibody or an antigen binding fragment thereof that binds to the membrane proximal region of TMEFF2, comprising a light chain variable region (VL) framework derived from VKI L l 1 (SEQ ID NO: 55) or VKIIII A27 (SEQ ID NO: 591).
- VL light chain variable region
- the invention also provides an isolated anti-TMEFF2 antibody or an antigen binding fragment thereof that binds to the membrane proximal region of TMEFF2, comprising a VH framework and a VL framework derived from VH3 3-23 of SEQ ID NO: 53 and VKI Ll 1 of SEQ ID NO: 55, respectively.
- the invention also provides an isolated anti-TMEFF2 antibody or an antigen binding fragment thereof that binds to the membrane proximal region of TMEFF2, comprising a VH framework and a VL framework derived from VH1 1-69 of SEQ ID NO: 54 and VKTTT A27 of SEQ ID NO: 591, respectively.
- the invention also provides an isolated anti-TMEFF2 antibody or an antigen binding fragment thereof that binds to the membrane proximal region of TMEFF2, comprising a VH framework and a VL framework derived from VH1 1-69 of SEQ ID NO: 54 and VKI Ll 1 of SEQ ID NO: 55, respectively.
- Antibodies comprising heavy or light chain variable regions“derived from” a particular framework or germline sequence refer to antibodies obtained from a system that uses human germline immunoglobulin genes, such as from transgenic mice, rats or chicken or from phage display libraries as discussed herein.
- An antibody containing particular framework derived from germline sequence may contain amino acid differences as compared to the sequence it was derived from, due to, for example, naturally-occurring somatic mutations or intentional substitutions.
- the invention also provides an isolated anti-TMEFF2 antibody or an antigen binding fragment thereof, comprising a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 582, 584, 587, 18, 588 and 22, respectively.
- the isolated anti-TMEFF2 antibody or the antigen-binding fragment thereof comprises a VH of SEQ ID NO: 25 and a VL of SEQ ID NO: 28.
- the VH is encoded by a polynucleotide of SEQ ID NO: 39 and the VL is encoded by a polynucleotide of SEQ ID NO: 42.
- the isolated anti-TMEFF2 antibody or the antigen binding fragment thereof comprises a HC of SEQ ID NO: 32 and a LC of SEQ ID NO: 35.
- the HC is encoded by a polynucleotide of SEQ ID NO: 46 and the VL is encoded by a polynucleotide of SEQ ID NO: 49.
- the invention also provides an isolated anti-TMEFF2 antibody or an antigen binding fragment thereof comprising a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 583, 585, 16, 19, 21 and 23, respectively.
- the isolated anti-TMEFF2 antibody or the antigen-binding fragment thereof comprises a VH of SEQ ID NO: 589 and a VL of SEQ ID NO: 29.
- the VH is encoded by a polynucleotide of SEQ ID NO: 40 and the VL is encoded by a polynucleotide of SEQ ID NO: 43.
- the isolated anti-TMEFF2 antibody or the antigen binding fragment thereof comprises a HC of SEQ ID NO: 33 and a LC of SEQ ID NO: 36.
- the HC is encoded by a polynucleotide of SEQ ID NO: 47 and the LC is encoded by a polynucleotide of SEQ ID NO: 50.
- the invention also provides an isolated anti-TMEFF2 antibody or an antigen binding fragment thereof comprising a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 582, 586, 17, 18, 588 and 24, respectively.
- the isolated anti-TMEFF2 antibody or the antigen binding fragment thereof comprises a VH of SEQ ID NO: 27 and a VL of SEQ ID NO: 30.
- the VH is encoded by a polynucleotide of SEQ ID NO: 41 and the VL is encoded by a polynucleotide of SEQ ID NO: 44.
- the isolated anti-TMEFF2 antibody or the antigen binding fragment thereof comprises a HC of SEQ ID NO: 34 and a LC of SEQ ID NO: 37.
- the HC is encoded by a polynucleotide of SEQ ID NO: 48 and the LC is encoded by a polynucleotide of SEQ ID NO: 51.
- the invention also provides an isolated anti-TMEFF2 antibody or an antigen binding fragment thereof comprising a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 583, 585, 16, 18, 588 and 22, respectively.
- the isolated anti-TMEFF2 antibody or the antigen binding fragment thereof comprises a VH of SEQ ID NO: 589 and a VL of SEQ ID NO: 31.
- the VH is encoded by a polynucleotide of SEQ ID NO: 40 and the VL is encoded by a polynucleotide of SEQ ID NO: 45.
- the isolated anti-TMEFF2 antibody or the antigen binding fragment thereof comprises a HC of SEQ ID NO: 33 and a LC of SEQ ID NO: 38.
- the HC is encoded by a polynucleotide of SEQ ID NO: 47 and the LC is encoded by a polynucleotide of SEQ ID NO: 590.
- the invention also provides an isolated anti-TMEFF2 antibody or an antigen binding fragment thereof comprising a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 582, 584, 587, 18, 588 and 603, respectively.
- the isolated anti-TMEFF2 antibody or the antigen-binding fragment thereof comprises a VH of SEQ ID NO: 604 and a VL of SEQ ID NO: 607.
- the VH is encoded by a polynucleotide of SEQ ID NO: 618 and the VL is encoded by a polynucleotide of SEQ ID NO: 619.
- the isolated anti-TMEFF2 antibody or the antigen binding fragment thereof comprises a HC of SEQ ID NO: 614 and a LC of SEQ ID NO: 615.
- the HC is encoded by a polynucleotide of SEQ ID NO: 620 and the LC is encoded by a polynucleotide of SEQ ID NO: 621.
- the invention also provides an isolated anti-TMEFF2 antibody or an antigen binding fragment thereof comprising a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 582, 584, 587, 18, 588 and 603, respectively.
- the isolated anti-TMEFF2 antibody or the antigen binding fragment thereof comprises a VH of SEQ ID NO: 612 and a VL of SEQ ID NO: 613.
- the VH is encoded by a polynucleotide of SEQ ID NO: 622 and the VL is encoded by a polynucleotide of SEQ ID NO: 623.
- the isolated anti-TMEFF2 antibody or the antigen binding fragment thereof comprises a HC of SEQ ID NO: 616 and a LC of SEQ ID NO: 617.
- the HC is encoded by a polynucleotide of SEQ ID NO: 624 and the LC is encoded by a polynucleotide of SEQ ID NO: 625.
- the isolated anti-TMEFF2 antibody or the antigen binding fragment thereof is a multispecific antibody.
- the isolated anti-TMEFF2 antibody or the antigen binding fragment thereof is a bispecific antibody. In some embodiments, the isolated anti-TMEFF2 bispecific antibody or the antigen binding fragment thereof binds a T cell antigen.
- the isolated anti-TMEFF2 bispecific antibody or the antigen binding fragment thereof binds CD3.
- the isolated anti-TMEFF2 bispecific antibody or the antigen binding fragment thereof binds CD3 epsilon.
- VH, the VL, the HCDR, the LCDR, the HC and the LC sequences of exemplary anti- TMEFF2 antibodies of the invention are shown in Tables 60-67.
- variable domains may be used to screen for variable domains capable of forming a two-domain specific antigen-binding fragment capable of binding to TMEFF2.
- the screening may be accomplished by phage display screening methods using for example hierarchical dual combinatorial approach disclosed in Int. Patent Publ. No. W01992/01047.
- the invention also provides an isolated bispecific anti-TMEFF2/anti-CD3 antibody or an antigen binding fragment thereof comprising a first domain that binds TMEFF2 and a second domain that binds CD3, wherein the antibody binds to the membrane proximal region of
- TMEFF2 While not wishing to be bound by any particular theory, bispecific antibodies binding to the membrane proximal region of TMEFF2 may be more efficient in mediating T-cell mediated killing of tumor cells.
- the invention also provides an isolated bispecific anti-TMEFF2/anti-CD3 antibody or an antigen binding fragment thereof comprising a first domain that binds TMEFF2 and a second domain that binds CD3, wherein the antibody competes for binding to the membrane proximal region of TMEFF2 with a reference antibody comprising a heavy chain variable region (VH) of SEQ ID NO: 25 and a light chain variable region (VL) of SEQ ID NO: 28, the VH of SEQ ID NO: 589 and the VL of SEQ ID NO: 29, the VH of SEQ ID NO: 27 and the VL of SEQ ID NO: 30, the VH of SEQ ID NO: 589 and the VL of SEQ ID NO: 31, the VH of SEQ ID NO: 604 and the VL of SEQ ID NO: 607, or the VH of SEQ ID NO: 612 and the VL of SEQ ID NO: 613.
- VH heavy chain variable region
- VL light chain variable region
- the isolated bispecific anti-TMEFF2/anti-CD3 antibody or an antigen binding fragment thereof binds the membrane proximal region of TMEFF2 with a dissociation constant (KD) of about 0.4 x 10 -9 M or less, wherein the KD is measured using surface plasmon resonance in acetate buffer at pH 4.5-5.0 at room temperature.
- KD dissociation constant
- the isolated bispecific anti-TMEFF2/anti-CD3 antibody or the antigen binding fragment thereof binds the membrane proximal region TMEFF2 with the KD of between about 0.1 x 10 -10 M and about 0.4 x 10 -9 M.
- the invention also provides an isolated bispecific anti-TMEFF2/anti-CD3 antibody or an antigen binding fragment thereof, wherein the first domain comprises a HCDR1 , a HCDR2, a HCDR3, a LCDR1 , a LCDR2 and a LCDR3 of
- the invention also provides an isolated bispecific anti-TMEFF2/anti-CD3 antibody or an antigen binding fragment thereof, wherein the second domain comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs: 662, 663, 664, 671, 673, and 690, respectively.
- the invention also provides an isolated bispecific anti-TMEFF2/anti-CD3 antibody or an antigen binding fragment thereof, wherein the first domain comprises
- the invention also provides an isolated bispecific anti-TMEFF2/anti-CD3 antibody or an antigen binding fragment thereof, wherein the second domain comprises
- the second domain comprises the VH of SEQ ID NO: 657 and the
- the invention also provides an isolated bispecific anti-TMEFF2/anti-CD3 antibody or an antigen binding fragment thereof comprising a first domain that binds TMEFF2 and a second domain that binds CD3, wherein
- the first domain comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 582, 584, 587, 18, 588 and 22, respectively
- the second domain comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs: 662, 663, 664, 671, 673, and 690, respectively;
- the first domain comprises a VH of SEQ ID NO: 25 and a VL of SEQ ID NO: 28, and the second domain comprises the VH of SEQ ID NO: 652 and the VL of SEQ ID NO: 661 ;
- the first domain comprises a VH of SEQ ID NO: 25 and a VL of SEQ ID NO: 28, and the second domain comprises the VH of SEQ ID NO: 657 and the VL of SEQ ID NO: 678;
- the bispecific anti-TMEFF2/anti-CD3 antibody or the antigen binding fragment thereof comprises a HC1 of SEQ ID NO: 32, a LC1 of SEQ ID NO: 35, a HC2 of SEQ ID NO: 640 and a LC2 of SEQ ID NO: 676;
- the bispecific anti-TMEFF2/anti-CD3 antibody or the antigen binding fragment thereof comprises a HC1 of SEQ ID NO: 32, a LC1 of SEQ ID NO: 35, a HC2 of SEQ ID NO: 675 and a LC2 of SEQ ID NO: 677.
- the invention also provides an isolated bispecific anti-TMEFF2/anti-CD3 antibody or an antigen binding fragment thereof comprising a first domain that binds TMEFF2 and a second domain that binds CD3, wherein
- the first domain comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 583, 585, 16, 19, 21, and 23, respectively
- the second domain comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs: 662, 663, 664, 671, 673, and 690, respectively;
- the first domain comprises a VH of SEQ ID NO: 589 and a VL of SEQ ID NO: 29, and the second domain comprises the VH of SEQ ID NO: 652 and the VL of SEQ ID NO: 661;
- the first domain comprises a VH of SEQ ID NO: 589 and a VL of SEQ ID NO: 29, and the second domain comprises the VH of SEQ ID NO: 657 and the VL of SEQ ID NO: 678 and/or
- the bispecific anti-TMEFF2/anti-CD3 antibody or the antigen binding fragment thereof comprises a HC1 of SEQ ID NO: 33, a LC1 of SEQ ID NO: 36, a HC2 of SEQ ID NO: 640 and a LC2 of SEQ ID NO: 676;
- the bispecific anti-TMEFF2/anti-CD3 antibody or the antigen binding fragment thereof comprises a HC1 of SEQ ID NO: 33, a LC1 of SEQ ID NO: 36, a HC2 of SEQ ID NO: 675 and a LC2 of SEQ ID NO: 677.
- the invention also provides an isolated bispecific anti-TMEFF2/anti-CD3 antibody or an antigen binding fragment thereof comprising a first domain that binds TMEFF2 and a second domain that binds CD3, wherein
- the first domain comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 582, 586, 17, 18, 588 and 24, respectively
- the second domain comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs: 662, 663, 664, 671, 673, and 690, respectively;
- the first domain comprises a VH of SEQ ID NO: 27 and a VL of SEQ ID NO: 30, and the second domain comprises the VH of SEQ ID NO: 652 and the VL of SEQ ID NO: 661 ;
- the first domain comprises a VH of SEQ ID NO: 27 and a VL of SEQ ID NO: 30, and the second domain comprises the VH of SEQ ID NO: 657 and the VL of SEQ ID NO: 678, and/or the bispecific anti-TMEFF2/anti-CD3 antibody or the antigen binding fragment thereof comprises a HC1 of SEQ ID NO: 34, a LC1 of SEQ ID NO: 37, a HC2 of SEQ ID NO: 640 and a LC2 of SEQ ID NO: 676;
- the bispecific anti-TMEFF2/anti-CD3 antibody or the antigen binding fragment thereof comprises a HC1 of SEQ ID NO: 34, a LC1 of SEQ ID NO: 37, a HC2 of SEQ ID NO: 675 and a LC2 of SEQ ID NO: 677.
- the invention also provides an isolated bispecific anti-TMEFF2/anti-CD3 antibody or an antigen binding fragment thereof comprising a first domain that binds TMEFF2 and a second domain that binds CD3, wherein
- the first domain comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 583, 585, 16, 18, 588 and 22, respectively
- the second domain comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs: 662, 663, 664, 671, 673, and 690, respectively;
- the first domain comprises a VH of SEQ ID NO: 589 and a VL of SEQ ID NO: 31, and the second domain comprises the VH of SEQ ID NO: 652 and the VL of SEQ ID NO: 661;
- the first domain comprises a VH of SEQ ID NO: 589 and a VL of SEQ ID NO: 31, and the second domain comprises the VH of SEQ ID NO: 657 and the VL of SEQ ID NO: 678;
- the bispecific anti-TMEFF2/anti-CD3 antibody or the antigen binding fragment thereof comprises a HC1 of SEQ ID NO: 33, a LC1 of SEQ ID NO: 38, a HC2 of SEQ ID NO:640 and a LC2 of SEQ ID NO: 676;
- the bispecific anti-TMEFF2/anti-CD3 antibody or the antigen binding fragment thereof comprises a HC1 of SEQ ID NO: 33, a LC1 of SEQ ID NO: 38, a HC2 of SEQ ID NO:675 and a LC2 of SEQ ID NO: 677.
- the invention also provides an isolated bispecific anti-TMEFF2/anti-CD3 antibody or an antigen binding fragment thereof comprising a first domain that binds TMEFF2 and a second domain that binds CD3, wherein
- the first domain comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a LCDR3 of SEQ ID NOs: 582, 584, 587, 18, 588 and 603, respectively
- the second domain comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs: 662, 663, 664, 671, 673, and 690, respectively;
- the first domain comprises a VH of SEQ ID NO: 604 and a VL of SEQ ID NO: 607
- the second domain comprises the VH of SEQ ID NO: 652 and the VL of SEQ ID NO: 661
- the first domain comprises a VH of SEQ ID NO: 604 and a VL of SEQ ID NO: 607
- the second domain comprises the VH of SEQ ID NO: 657 and the VL of SEQ ID NO: 678
- the bispecific anti-TMEFF2/anti-CD3 antibody or the antigen binding fragment thereof comprises a HC1 of SEQ ID NO: 614, a LC1 of SEQ ID NO: 615, a HC2 of SEQ ID NO: 640 and a LC2 of SEQ ID NO: 676;
- the bispecific anti-TMEFF2/anti-CD3 antibody or the antigen binding fragment thereof comprises a HC1 of SEQ ID NO: 614, a LC1 of SEQ ID NO: 615, a HC2 of SEQ ID NO: 675 and a LC2 of SEQ ID NO: 677.
- the invention also provides an isolated bispecific anti-TMEFF2/anti-CD3 antibody or an antigen binding fragment thereof comprising a first domain that binds TMEFF2 and a second domain that binds CD3, wherein
- the first domain comprises a HCDR1, a HCDR2, a HCDR3, a LCDR1, a LCDR2 and a
- the second domain comprises the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2 and the LCDR3 of SEQ ID NOs: 662, 663, 664, 671, 673, and 690, respectively;
- the first domain comprises a VH of SEQ ID NO: 612 and a VL of SEQ ID NO: 613
- the second domain comprises the VH of SEQ ID NO: 652 and the VL of SEQ ID NO: 661
- the first domain comprises a VH of SEQ ID NO: 612 and a VL of SEQ ID NO: 613
- the second domain comprises the VH of SEQ ID NO: 657 and the VL of SEQ ID NO: 678;
- the bispecific anti-TMEFF2/anti-CD3 antibody or an antigen binding fragment thereof comprises a HC1 of SEQ ID NO: 616, a LC1 of SEQ ID NO: 617, a HC2 of SEQ ID NO: 640 and a LC2 of SEQ ID NO: 676;
- the bispecific anti-TMEFF2/anti-CD3 antibody or an antigen binding fragment thereof comprises a HC1 of SEQ ID NO: 616, a LC1 of SEQ ID NO: 617, a HC2 of SEQ ID NO: 675 and a LC2 of SEQ ID NO: 677.
- This invention provides the following non-limiting embodiments.
- HCDR heavy chain complementarity determining region
- HCDR2 comprising SEQ ID NO: 663
- HCDR3 comprising SEQ ID NO: 664 and a light chain comprising a light chain complementarity determining region (LCDR) 1 comprising SEQ ID NO: 671, a LCDR2 comprising SEQ ID NO: 673, and a LCDR3 comprising SEQ ID NO: 690;
- a heavy chain comprising a HCDR1 comprising SEQ ID NO: 662; a HCDR2 comprising SEQ ID NO: 663; and a HCDR3 comprising SEQ ID NO: 664 and a light chain comprising a LCDR1 comprising SEQ ID NO: 773, a LCDR2 comprising SEQ ID NO: 673, and a LCDR3 comprising SEQ ID NO: 690;
- An isolated recombinant anti-CD3 antibody or antigen-binding fragment thereof wherein the antibody or antigen-binding fragment specifically binds Macaca fascicularis or human CD3d, or CD3e, or CD3e and CD3d with a binding affinity of about 300 nM or less.
- a) binds human and Macaca fascicularis CD3+ T lymphocytes with a calculated EC50 of 300 nM or less and binds Macaca fascicularis CD3-expressing HEK cells with a calculated EC50 of 300 nM or less, wherein the difference in calculated EC50 between binding CD3+ T lymphocytes and binding Macaca fascicularis CD3 -expressing HEK cells is less than 5-fold, and wherein the calculated EC50 is measured in a whole cell binding assay at 0 °C using flow cytometry; b) binds recombinant CD3d from human (SEQ ID NO: 691), or binds recombinant CD3e from human (SEQ ID NO:636), or binds recombinant CD3d fromMacaca fascicularis (SEQ ID NO: 692), or binds recombinant CD3e fromMacaca fascicularis (SEQ ID NO:693) with an equilibrium dissociation constant (KD)
- d) activates T cells or induces CD69 expression to a similar degree as cOKT3 or SP34-2 as determined by fluorescence-activated cell sorting assay.
- residue numbering is according to the ELI Index.
- the antibody or antigen-binding fragment thereof of any one of the previous embodiments comprising the HCDR1, the HCDR2, the HCDR3, the LCDR1, the LCDR2, and the LCDR3 of SEQ ID NOs:662, 663, 664, 671, 673, and 690, respectively.
- HCDR1 comprising the HCDR1 , the HCDR2, the HCDR3 , the LCDR1 , the LCDR2, and the LCDR3 of SEQ ID NOs:662, 663, 664, 773, 673, and 690, respectively.
- An antibody or antigen-binding fragment thereof comprising the HCDR1, the HCDR2, the HCDR3, the LCDR1 , the LCDR2, and the LCDR3 of SEQ ID NOs: 662, 663, 664, 671, 673, and 690, respectively.
- An antibody or antigen-binding fragment thereof comprising a VH and a VL of SEQ ID NOs:652 and 661, respectively.
- An antibody or antigen-binding fragment thereof comprising a HC and a LC of SEQ ID NOs:640 and 676, respectively.
- An antibody or antigen-binding fragment thereof comprising the HCDR1 , the HCDR2, the HCDR3, the LCDR1 , the LCDR2, and the LCDR3 of SEQ ID NOs: 662, 663, 664, 773, 673, and 690, respectively.
- An antibody or antigen-binding fragment thereof comprising a VH and a VL of SEQ ID NOs:657 and 678, respectively.
- An antibody or antigen-binding fragment thereof comprising a HC and a LC of SEQ ID NOs:675 and 677, respectively.
- the antibody of embodiment 19 wherein the antibody is an IgG4 or IgGl isotype.
- 21 The antibody of embodiment 20, comprising one, two, three, four, five, six, seven, eight, nine or ten substitutions in the antibody Fc.
- residue numbering for light chain substitutions is according to SEQ ID No: 661, and for heavy chain substitutions is according to SEQ ID No: 652.
- a bispecific antibody comprising a first domain that specifically binds CD3 and a second domain that specifically binds a second antigen, wherein the first domain comprises the HCDR1 , the HCDR2, the HCDR3 , the LCDR1 , the LCDR2, and the LCDR3 of SEQ ID NO:
- first domain and second domain are an IgG4 isotype, and wherein the first or the second domain comprises S228P, F234A, L235A, F405L and R409K heavy chain substitutions and the other domain of the first or the second domain comprises S228P, F234A and L235A heavy chain substitution, wherein residue numbering is according to the EU Index.
- the bispecific antibody of claim 24, wherein the first domain comprises the VH and the VL of SEQ ID NOs: 652 and 661, respectively.
- the bispecific antibody of claim 24, wherein the first domain comprises the VH and the VL of SEQ ID NOs:657 and 678, respectively.
- the bispecific antibody of claim 24, wherein the first domain comprises the HC and the LC of SEQ ID NOs:675 and 677, respectively.
- the second domain comprises the HCDR1, HCDR2, the HCDR3, the LCDR1 , the LCDR2, and the LCDR3 of SEQ ID NO:
- VL of SEQ ID NOs:652 and 661 respectively; and wherein the second domain comprises the VH and VL of SEQ ID NOs: 116 and 117, respectively.
- the bispecific antibody of embodiment 31, wherein the first domain comprises the HCDR1, HCDR2, the HCDR3, the LCDR1 , the LCDR2, and the LCDR3 of SEQ ID NOs: 662, 663,
- the second domain comprises the HCDR1, HCDR2, the HCDR3, the LCDR1 , the LCDR2, and the LCDR3 of SEQ ID NOs: 363, 404, 445, 485, 527, and 569, respectively.
- a pharmaceutical composition comprising the antibody of any one of the previous
- embodiments and a pharmaceutically acceptable carrier.
- a vector comprising the polynucleotide of embodiment 52.
- a host cell comprising the vector of embodiment 53.
- a method of treating a cancer in a subject comprising administering a therapeutically effective amount of the isolated antibody of any one of embodiments 1-50 to the subject in need thereof for a time sufficient to treat the cancer.
- the solid tumor is a prostate cancer, a colorectal cancer, a gastric cancer, a clear cell renal carcinoma, a bladder cancer, a lung cancer, a squamous cell carcinoma, a glioma, a breast cancer, a kidney cancer, a neovascular disorder, a clear cell renal carcinoma (CCRCC), a pancreatic cancer, a renal cancer, a urothelial cancer or an adenocarcinoma to the liver.
- CCRCC clear cell renal carcinoma
- prostate cancer is a refractory prostate cancer, a prostatic intraepithelial neoplasia, an androgen independent prostate cancer, or a malignant prostate cancer.
- hematological malignancy is acute myeloid leukemia (AML), myelodysplastic syndrome (MDS), acute lymphocytic leukemia (ALL), diffuse large B-cell lymphoma (DLBCL), chronic myeloid leukemia (CML) or blastic plasmacytoid dendritic cell neoplasm (DPDCN).
- AML acute myeloid leukemia
- MDS myelodysplastic syndrome
- ALL acute lymphocytic leukemia
- DLBCL diffuse large B-cell lymphoma
- CML chronic myeloid leukemia
- DPDCN blastic plasmacytoid dendritic cell neoplasm
- Hybridoma supernatants from fusions BLW (with magnetic bead depletion of lymphocytes) and BLX (without magnetic bead depletion of lymphocytes) were analyzed a) by a cell-based ELISA (CELISA) on cells transiently transfected with human and cynomolgus cDNA cloned into screening vectors: pOPT-CD3e-hum-epsilon-TCE.OMT + pOPT-CD3d-hum- delta.OMT, 1 : 1 (pOPT-CD3e/d-hum-mix) and pcDNA3. l-CD3e-cyn-delta + pcDNA3.
- l-CD3d- cyn-delta 1 : 1 (pcDNA3. l-CD3e/d-cyn-mix).
- Human and cynomolgus cDNA sequences are provided in Table 4.
- CELISA negative control non-transfected mammalian cells were incubated with hybridoma supernatants and detected with the secondary Bethyl antibody.
- CELISA transfection control mammalian cells, transfected with the constructs described above, were detected with anti-tag antibody.
- Hybridoma supernatants were further analyzed by flow cytometry (FACS) on CD3 positive and CD3 negative Jurkat cells: Jurkat CD3+ (E6-1) and Jurkat CD3- (J.RT3-T3.5).
- FACS negative control CD3 negative Jurkat cells (J.RT3-T3.5), were incubated with dilution buffer and detected with Southern anti-rat Ig HRP and Bethyl anti-rat IgGl, 2a, 2b, 2c- HRP secondary antibodies.
- Anti-human CD3 antibodies were generated in OmniRats (OMT, Palo Alto, California, USA). Variable region (“V region”) sequences of these clones were extracted from the genomic sequences and analyzed. All sequences obtained were either human IgG heavy chain or lambda light chain and the sequences, especially LC, showed high homology. Aligning the sequences to germline showed some mutations in the framework (Fig. 1). The V-region DNA sequences were synthesized and cloned into mammalian expression vectors, heavy chain sequences into human IgGl vector and light chain sequences into human lambda vector. Sequences are shown in Tables 6 and 7. Seven mAbs were assigned protein identifiers (Table 5 A).
- CD3B312 was chosen as the most representative clone and the heavy chain sequences were cloned into human IgGl sigma and IgG4 PAA with S228P, F234A, L235A mutations and assigned protein identifiers as shown in Table 5B. These were used to generate bispecific antibodies and to demonstrate T cell redirection functionality through cytotoxicity.
- Table 5 A Peptide ID and protein ID of clones
- CD3B312 was chosen as the most representative clone and the heavy chain sequences were cloned into human IgGl sigma and IgG4 PAA with mutations and assigned protein identifiers.
- Table 7A VH and VL sequences with HC and LC isotype of 7 monoclonal CD3 antibodies from the first panel of 9 described above (see Table 3). All HC isotypes were huIgGl_Glm(l7). All LC isotypes were huLambda 2.
- HC isotypes were hu!gGl Glm(l7). All LC isotypes were huLambda 2.
- a cell-based binding assay was designed to assess the binding capacity of individual rat hybridoma supernatants to human (Fig. 2) and cynomolgus (Fig. 3) purified CD3+ T lymphocytes.
- the T cells were counted, diluted to 1 c 10 L 6 cells/mL and incubated with 0.5 ul/mL of Live/Dead Fixable Green Dead Cell Stain (Life Technologies, L-2301). Next the cells were aliquoted into a U-bottom (Falcon 353077) plate at lOOul/well (1c10 L 5 cells/well). The plates were centrifuged at 300g for 5 minutes to pellet the cells and the supernatant removed. The plate was vortexed briefly to resuspend the cells.
- the hybridoma supernatants were diluted in FACS staining buffer (BSA, BD Biosciences 554657) to 4.5 mg/mL and then serially diluted 6 times at 1 :3 dilutions to the lowest concentration of 0.006 mg/mL.
- BSA FACS staining buffer
- a positive control of mouse anti-human CD3 (SP34-2, BD Biosciences 551916) and negative isotype control (mouse IgGl BD Biosciences 556648) were also diluted to 4.5 mg/mL. 50m1 of each sample was added to the T cells and incubated at 4°C for 1 hour.
- the cells were washed once with staining buffer and secondary AF647 Goat anti-mouse IgG (Life Technologies, A21235) or AF647 goat anti-rat IgG (Life Technologies, A21247) was added at 10 mg/mL in 50 pl was added according to the appropriate species (anti-rat for hybridoma samples and anti-mouse for the control antibodies).
- the plates were incubated at 4°C for 45 minutes and washed with staining buffer twice.
- the cells were resuspended in 25 m ⁇ of running buffer (staining buffer + 1 mM EDTA (Life technologies, AM9260G) + 0.1% pluronic F-68 (Life Technologies 24040-032)) and read on the Intellicyt system (Intellicyt Corp.). The results are shown in Figs. 2 and 3.
- purified human T cells were plated at 1.1 x 10 L 5 cells/well in U- bottom plates. The plates were centrifuged at 300g for 5 minutes to pellet the cells and the supernatant removed. The plate was vortexed briefly to resuspend the cells. The hybridoma supernatants were diluted in FACS staining buffer (BSA, BD Biosciences 554657) to 30ug/mL and then serially diluted 11 times at 1 :3 dilutions to the lowest concentration of 0.000l7ug/mL. 50ul of each sample was added to the T cells and incubated at 4C for 1 hour.
- FACS staining buffer (BSA, BD Biosciences 554657)
- the cells were washed once with staining buffer and secondary Dylight 650 goat anti-rat IgG (Bethyl, Al 10- 239D5) was added at lOug/mL in 50ul was added. The plates were incubated at 4C for 1 hour and washed with staining buffer twice. The cells were resuspended in 30ul of FACS buffer and read on the Hypercyte flow cytometer (Intellicyt Corp.). Representative dose-response curves for the anti-CD3 clones binding to primary human T cells are shown in Fig. 5.
- the hybridoma supernatants were also assessed for their ability to compete with commercial anti-human CD3 antibody SP34-2 which has a known epitope and is cross-reactive with cynomolgus CD3.
- First a concentration titration curve of AF488 fluorescently labelled SP34-2 (BD, 557705) was performed to determine a fixed concentration of SP34-2 for the following competition assays. Briefly, human purified T cells were diluted to lxl 0 L 6 cell/mL in PBS.
- Fc block Human TruStain Fc Block, Biolegend, 422302
- AF488 SP34-2 and the AF488 labelled isotype control were serially diluted from 50 mg/mL to 0.049mg/mL in a 1 :2 dilution scheme.
- the plates were centrifuged at 300xg for 5 minutes to pellet the cells and the supernatant removed. The plate was gently vortexed briefly to resuspend the cells. 50mL of each AF488 SP34-2 dilution was added to the cells and incubated at 4C for 1 hour.
- the plates were washed with staining buffer twice and once with running buffer (staining buffer + lmM EDTA (Life technologies, AM9260G) + 0.1% pluronic F-68 (Life Technologies 24040-032)).
- the cells were resuspended in 25 mL of running buffer and read on the HTFC Screening System (IntelliCyt Corporation). Based on the dose response curve, a fixed concentration of 2ug/mL SP34-2 was chosen for the competition assay.
- Fc block at 5mL per lOOmL cells Human TruStain Fc Block, Biolegend, 422302
- Live/Dead Fixable Far Red Dead Cell Stain at 0.5mL per mL cells Life Technologies L10120 were added to the cells and incubated for 15 minutes at 4 ° C.
- 10 5 cells per well lxl 0 L 5 cells/well
- the plates were centrifuged at 300xg for 5 minutes to pellet the cells and the supernatant removed. The plate was gently vortexed briefly to resuspend the cells.
- the hybridoma supernatants and the control antibodies were diluted in FACS staining buffer (BSA, BD Biosciences 554657) at 2X the desired final concentration. 35mL of the 2X hybridoma supernatants and the control antibodies were mixed with 35uL of 2X AF488 SP34-2 (4mg/mL) to give the desired IX concentration of hybridoma supernatants, IX concentration of control antibodies and 2mg/mL AF488 SP34-2.
- the hybridoma supernatants and control antibodies were assayed using a 7-point titration with a concentration range.
- Hybridoma supernatants were assayed from 200mg/mL to 0.08 mg/mL and control antibodies were assayed from 1 OOmg/mL to 0.04mg/mL. 50uL of the IX hybridoma supernatants or IX control antibodies with 2mg/mL AF488 SP34-2 were added to the T cells and incubated at 4 ° C for 2 hours. The plates were washed with staining buffer twice and once with running buffer (staining buffer + lmM EDTA (Life technologies, AM9260G) + 0.1% pluronic F-68 (Life Technologies 24040-032)).
- the cells were resuspended in 25mL of running buffer and read on the HTFC Screening System (IntelliCyt Corporation).
- Representative competition binding curves with SP34-2 (a commercial anti-human CD3 antibody which has a known epitope and is cross-reactive with cynomolgus CD3) are shown in Fig. 4 and Fig. 6.
- the initial screening results are summarized in Table 8. Six of the clones showed positive binding and also competed with SP34-2 for binding to primary human T cells.
- a primary human and cynomolgus monkey T cell based assay was used to determine the capacity of the hybridoma hits to activate T cells. This was accomplished by coating antibodies to a plate to mimic the cross-linking effect of TCR activation. Upon activation, T cells are known to upregulate the surface expression of the protein, CD69.
- the experiment was conducted by coating 50m1 of a lOmg/ml antibody preparation with unknown samples or controls (positive control: in house, Okt-3 BISB264.002, BD Bioscience SP-34-2 #551916; negative control: anti- CD20 in house BISB266.004) to a 96 well plate (Costar #3361). The plates were incubated overnight at 4 ° C. The next day the plates were washed twice with PBS. Frozen primary T cells (human sourced from Biological Specialities or Hemacare; cynomolgus sourced from
- the OKT3 anti-CD3 clone did not bind cynomolgus CD3 and did not induce CD69 upregulation.
- the negative control in both human and cynomolgus T cells was an anti-CD20 which is not expressed on T cells.
- several induced CD69 expression to a similar degree as the positive control, namely 2B4, 2E6, 3B4, 1F8, 2E9, 3F4, 3G8, 4E5, 5H7, 8B4, 8G8 and 1F1.
- Most also bound and activated cynomolgus T cells except for 5H7, 8B4, and 8G8.
- Clones showed high homology and carried framework mutations comparing to human immunoglobulin germline sequences (Figs. 1A and IB). Clone 2E6 was selected to adapt the standard framework sequence. All 6 mutations on HC and 7 mutations on LC were mutated back to human germline sequence, either individually or combined (Table 9). The mutated V-region DNA sequences were synthesized and cloned into the same mammalian expression vectors as their parental constructs. The HC and LC constructs were paired via matrix format to generate proteins carrying individual or combinatorial mutations and protein activity was tested. V48 on LC could not be changed back to germline. All other back mutations were not critical but reduced activity to some degree. Table 9. BLW-2E6 framework variants.
- Framework mutations were engineered to one hybridoma clone, BLW-2E6, resulting in 80 mutant clones, some of which are indicated in Table 10.
- the 80 mutant clones were assayed for binding to primary human T cells (Figs. 7 and 8).
- the T cells were counted, diluted to l xl 0 L 6 cells/mL and incubated with 5mL Fc block (Human TruStain Fc Block, Biolegend, 422302) per lOOmL cells and 0.5m1 per mL of Live/Dead Fixable Green Dead Cell Stain (Life Technologies, L-2301) per lOOmL cells.
- the cells were aliquoted into a 96-well U-bottom plate (Falcon 353077) at 100mL/well (1c10 L 5 cells/well). The plates were centrifuged at 300xg for 5 minutes to pellet the cells and the supernatant removed. The plate was gently vortexed briefly to resuspend the cells. The hybridoma supernatants were diluted in FACS staining buffer (BSA, BD Biosciences 554657) to 7.5mg/mL, l .5ug/mL, 0.3 mg/mL, and 0.06 mg/mL. 50mL of each sample was added to the T cells and incubated at 4°C for 1 hour.
- FACS staining buffer (BSA, BD Biosciences 554657)
- the cells were washed once with staining buffer, and 50mL of 5mg/mL secondary AF647 goat anti-Human IgG F(ab')2 (Jackson ImmunoResearch catalog 109-605-097) was added to the cells.
- the plates were incubated at 4°C for 45 minutes and washed with staining buffer twice and once with running buffer (staining buffer + lmM EDTA (Life technologies, AM9260G) + 0.1% pluronic F-68 (Life Technologies 24040-032)).
- the cells were resuspended in 25 mL of running buffer and read on the HTFC Screening System (IntelliCyt Corporation).
- CD3B450 were cloned as IgG4PAA (IgG4 with S228P, F234A, L235A mutations).
- VH amino acid sequence of CD3H219 (SEQ ID NO: 652) : qvqlqqsgprlvrpsqtlsltcaisgdsvfnnnaawswirqspsrglewlgrtyyrskw lydyavsvksritvnpdtsrnqftlqlnsvtpedtalyycargysss fdywgqgtlvtv ss
- VL amino acid sequence of CD3L150 (SEQ ID NO: 661) : qsaltqpasvsgsmgqsitisctgtssnigtykfvswyqqhpdkapkvllyevskrpsg vssrfsgsksgntasltisglqaedqadyhcVsyagsgtll fgggtkltvl
- VL amino acid sequence of CD3L197 (SEQ ID NO: 678) :
- the binding surface was regenerated for the next interaction cycle using a 18 second pulse of 0.8% phosphoric acid to remove the antigen and the bound mAh.
- the raw data were processed by subtracting two sets of reference data from the response data: 1) the inter-spot signals to correct for the non-specific interactions between the Ag and the empty chip surface; 2) the buffer channel signals to correct for baseline drifting due to the dissociation of
- Far Red Live/Dead stain (Life Technologies, AKA Invitrogen # L34974) (50 mL of DMSO into a vial) was added at 1 mL per lxl 0 L 6 cells; and FcR blocker (Miltenyi Biotec #130-059-901) (1 mL of a 1 :20 dilution per 0.5c10 L 6 cells) were added to the cells for 10 minutes each. Cells were plated at 50,000 cells/well and washed. Increasing concentrations of the AlexaFluor488 SP-34 anti-CD3 were added to the T cells for 2 hours at 4 °C. Cells were washed to remove un-bound antibody, fixed for 15 minutes, washed, and re-suspended in FACS Staining buffer containing lmM EDTA.
- the iQue Intellicyte Flow Cytometer was used to measure binding. Cells were gated for T cell population, followed by cell singlets, followed by Live Cells (FL4). Geometric mean of staining (FL1) was determined for each well.
- the acquired mean fluorescence intensity values were plotted as a function of the antibody molecule concentration and analyzed using Prism software in a one-site binding analysis (Total Binding) (Fig. 9).
- the software calculates the corresponding Kd value that describes the binding of the antibody molecule to a receptor (the CD3 on Human Pan T cells) that follows the law of mass action.
- Kd values were derived for each donor, and the mean value obtained.
- CD3B376 and CD3B450 (Fig. 10)
- T cells Human pan T cells were used to determine the binding affinity of the test mAbs.
- the tracer used was the commercially available AlexaFluor488 SP-34 anti-CD3 (BioScience #557705) and the saturation binding constant for this tracer is described above.
- T cells were cryogenically-stored in nitrogen tanks until used. T cells were thawed, washed with PBS, re-suspended in FACS Staining buffer, counted with viability noted, and re suspended at 0.5* 10 6 cells/mL.
- Far Red Live/Dead stain (Life Technologies, AKA Invitrogen # L34974) (50 mL of DMSO into a vial) was added at 1 mL per lxl 0 L 6 cells; and FcR blocker (Miltenyi Biotec #130-059-901) (1 mL of a 1 :20 dilution per 0.5c10 L 6 cells) was added to the cells for 10 minutes each. Cells were plated at 50,000 cells/well and washed.
- the mixture was added to the T cells for 2 hours at 4 °C. Cells were then washed to remove un-bound antibody, fixed for 15 minutes, washed, and re-suspended in FACS Staining buffer containing lmM EDTA.
- Kd is the affinity of the competitor (unlabeled molecule); IC50 in nM of the test compound; [T] is concentration of the tracer (16.6 nM); K d T is the K d of the tracer determined by saturation binding (5.6 nM for human).
- the bispecific CD3 antibodies of the present invention may be generated through controlled Fab-arm exchanged (FAE) as described in Labrijn et al, 2013, PNAS, vol. 110(13): 5145-5150; PCT Publ. WO 2011/131746; or in Labrijn et al., 2014, Nat Protoc, 9(l0):2450-63.
- FAE controlled Fab-arm exchanged
- Mutations that may be used to favor heterodimer formation are F405L in one parental antibody and R409K in the other prental antibody for IgGl antibodies, or F405L and K409R one parental antibody while retaining wild-type CH3 for IgG4 antibodies.
- the monospecific antibodies were expressed in HEK cell lines under CMV promoters.
- the parental antibodies were purified using a protein A column with an elution buffer of lOOmM NaAc pH3.5 and a neutralization puffer of 2M Tris pH 7.5 and 150 mM NaCl.
- the mabs were desalted using PD 10 (Sephadex G25M) column and dialyzed intoD-PBS, pH 7.2 buffer.
- the parental antibodies were mixed under reducing conditions in 75mM cysteamine-HCl and incubated at 3 l°C for 4h.
- the recombination reactions were based on molar ratios, where a set amount of target parent (eg, lOmg, or -71.8 nanomoles) was combined with CD3 antibody (eg, -67.8 nanomoles), where the target parent antibody was added in a 6% excess of the CD3 antibody.
- the recombinations were subsequently dialyzed against PBS to remove the reductant.
- the bispecific antibody reactions were performed with an excess of the target parent antibody (ratio) to minimize the amount of unreacted CD3 parental antibody remaining after recombination.
- the reductant was removed via overnight dialysis into PBS.
- Fig. 10 shows the inhibition curves for the bivalent and monovalent anti CD3 constructs, CD3B376 and CD3B450, competing for binding against the AlexaFluor488 SP-34 anti CD3 tracer antibody.
- Increasing concentrations of the test anti CD3 antibodies decreased the binding of the AlexaFluor488 tracer antibody, thus decreasing the mean fluorescence intensity (MFI).
- MFI mean fluorescence intensity
- the CD3B376 binding site was tighter than the CD3B450 in both bivalent and monovalent form.
- Conformational stability of the anti-CD3 antibodies CD3B376, CD3B389 (IgGl sigma version of CD3B376; heavy chain is SEQ ID NO: 729; light chain is SEQ ID NO: 676), CD3B450, and CD3B467 (IgGl sigma version of CD3B450; heavy chain is SEQ ID NO: 728; light chain is SEQ ID NO: 677) was determined by differential scanning calorimetry (DSC). The mid-point of thermal transition, Tm, was determined from the thermal denaturation profiles of each of the Ab candidates.
- Fig. 12A - Fig. 12E show the thermal denaturation profiles of the anti-CD3 antibodies in PBS.
- Table 14 includes a summary of the Tm and the enthalpy values (AH) for the thermal unfolding of the anti-CD3 antibodies as determined by DSC.
- the DSC results indicate that all anti-CD3 antibodies CD3B376, CD3B389, CD3B450, and CD3B467 have folded domains. Based on the onset of unfolding, the relative stability of each antibody was as follows: CD3B389 ⁇ CD3B467 ⁇ CD3B376 ⁇ CD3B450.
- the anti-CD3 molecules tested by DSC displayed some differences in their thermal stability.
- the CD3B376 (IgG4 PAA) molecule displayed three partially unresolved transitions at 59.7, 62.4 and 69.2°C with a total enthalpy of unfolding of 417.6 kcal/mol, while the CD3B450 (IgG4 PAA) molecule displayed two unresolved transitions at 62.5 and 66.3°C with a total enthalpy of unfolding of
- CD3B389 (IgGlsigma) molecule displayed four transitions at 54.6, 58.2,
- Table 14 Summary of the thermal transition data for the anti-CD3 antibodies in PBS. Values represent averages of duplicate runs. Sequence information is provided for HC and LC peptides (SEQ ID NOs in parentheses).
- the two IgGl antibodies display lower stability compared to the corresponding IgG4 PAA antibodies (comparing the molecules with the same variable domains) with Tm of the first transition being 5-6°C lower (Fig. 13A and Fig. 13B and Table 14).
- Tm of the first transition being 5-6°C lower (Fig. 13A and Fig. 13B and Table 14).
- Anti-CD3 mAh CD3B334 (CD3H231/CD3L137) was modified to increase the “humanness” index by replacing a number of framework residues in the antibody by the human germline residues.
- This procedure yielded antibody CD3B334 with the following mutations: D43 G/L49M/L501/S 62N/ Q 85E/H89 Y in VL when compared to the parental VL CD3L124 and Rl 0G/R13K/V73I/R79K/T83 S/L96V in VH when compared to the paretal VH CD3H219.
- the His-tagged Fab fragment of CD3B334 was expressed in HEK 293Expi cells and purified using affinity and size-exclusion chromatography.
- the N-terminal 9-mer peptide of human CD3e was synthesized at New England Peptide (Lot VI 108-19/21) and mixed with Fab at molar ratio 10: 1 (excess of peptide).
- the complex was crystallized by the vapor-diffusion method from solution containing 4 M Na formate in 0.1 M Tris, pH 8.5.
- the crystals belong to the orthorhombic space group P212121 with unit cell dimensions of 66.5x69.4x100.4 A and one complex molecule in the asymmetric unit.
- the structure of the complex was determined at 1.8 A resolution by the molecular replacement method using the crystal structure of the Fab as a search model.
- CD3B334 bound residues 1-6 of CD3e.
- the N-terminal Gln of the peptide was in the pyroglutamate form and in a hydrophobic environment, between F107 of HCDR3 and L99 of LCDR3 (Fig. 18).
- Two arginine residues, R52 and R56, from HCDR2 were engaged in electrostatic interactions with the acidic residues of CD3.
- 16 residues formed the CD3B334 paratope.
- Residues from all CDRs except LCDR2 were in direct contact (within 4 A distance) with the CD3 peptide (see Fig. 19).
- Expression vectors presenting full-length chimpanzee PSMA (H2Q3K5 PANTR, SEQ ID NO: 49) or full length Cynomolgous monkey PSMA (EHH56646.1, SEQ ID NO: 50) were generated for use as screening tools to assess the anti-PSMA leads using an in-house expression vector with the CMV promoter using standard molecular biology techniques.
- Vectors were transiently transfected into HEK293F cells in suspension using standard methods. Transfected 293F suspension cells were plated in growth medium plus serum to become adherent and selected for stable plasmid integration.
- PSMA surface receptor expression was quantified by FACS using the (PSMAL antibody (Center) affinity Purified Rabbit Polycolonal Antibody (Catalog # OAAB02483, Aviva Systems Biology) as the primary antibody with a R-PE anti-rabbit secondary antibody (Catalog # 111- 116-144, Jackson ImmunoResearch Laboratories, Inc.) and a rabbit polyclonal IgG (Catalog # SC-532, Santa Cruz Biotechnology) as the isotype control).
- PSMAL antibody Center
- R-PE anti-rabbit secondary antibody Catalog # 111- 116-144, Jackson ImmunoResearch Laboratories, Inc.
- a rabbit polyclonal IgG Catalog # SC-532, Santa Cruz Biotechnology
- Human PSMA expressing cell lines were generated using lentivirus (Genecopoeia, cat # EX-G0050-Lvl 05-10) containing full length human PSMA (F OLH 1 HUMAN, SEQ ID NO:5l) and puromycin for selection of PSMA positive cells.
- HEK293F cells ATCC
- negative for PSMA were transduced with Lentiviral particles to overexpress human PSMA.
- cells positively expressing PSMA and the resistance marker were selected by treating pooled cells, grown in DMEM + 10% HI FBS (Life Technologies) and supplemented with varying concentrations of Puromycin (Life Technologies).
- LNCaP clone FGC cells (ATCC cat#CRL-l740) are a commercially available human prostate cancer cell lines.
- C4-2B cells were originally developed at MD Anderson and are derived from LNCaP FGC grown in vivo and metastasize to bone marrow (Thalmann, et al 1994, Cancer Research 54, 2577-81).
- chimpanzee PSMA Extra Cellular Domain (ECD) protein (Chimp PSMA ECD, SEQ ID NO: 52) was generated for panning and to assess the anti-PSMA leads using an in- house expression vector with the CMV promoter using standard molecular biology techniques.
- the chimp PSMA ECD gene fragment (amino acid 44 - 750 of SEQ ID NO:49) with N-terminal signal sequence (SEQ ID NO: 594), N-terminal Avitag (SEQ ID NO: 595) and 6-His tags (SEQ ID NO: 596) was cloned using an in-house expression vector with the CMV promoter using standard molecular biology techniques and transiently expressed in 293Expi cells (Invitrogen).
- cDNA was prepared using gene synthesis techniques (U.S. Pat. No. 6,670,127; U.S. Pat. No. 6,521,427). Supernatants were harvested and clarified by centrifugation. The proteins were purified using a two-step purification process: 1) IMAC purification with a HisTrap HP column (GE Healthcare) and 2) size exclusion purification (Superdex 200, Ge Healthcare) where the elution buffer is Dulbecco's phosphate- buffered saline, calcium, magnesium (Thermofisher, #14040) containing 0.5mM ZnCh to stabilize PSMA dimerization. Fractions containing the protein of interest were pooled and protein concentration was determined by A280. This material was used for binding and affinity measurements and is referred to as PSMG8.
- Chimp PSMA ECD was also biotinylated for panning.
- the BirA plasmid that was co- transfected into mammalian cells to biotinylate proteins containing the Avi tag was created in- house.
- the BirA coding region (SEQ ID NO: 597) was fused to the signal peptide from mouse IgG heavy chain (SEQ ID NO:598), and an ER retention signal (KDEL (SEQ ID NO: 716)) was added to the C-terminus to generate the BirA plasmid (SEQ ID NO: 599).
- the constructed gene was cloned into an expression vector under the control of the CMV promoter.
- the PSMA plasmid DNA was added in a 4-fold excess (w/w) to the BirA plasmid into the transfection mix.
- Biotinylation of the Chimp PSMA ECD protein was performed via the Avi tag by cotransfection of a BirA expression construct and the resulting secreted protein was purified using a two-step purification process: 1) IMAC purification with a HisTrap HP column (GE Healthcare) and 2) size exclusion purification (Superdex 200, Ge Healthcare) where the elution buffer is Dulbecco's phosphate-buffered saline, calcium, magnesium (Thermofisher, #14040) containing 0.5mM ZnCl2 to stabilize PSMA dimerization. The protein was tested for endotoxin prior to use in phage panning studies.
- cynomolgous monkey PSMA extracellular domain (ECD) protein (cyno PSMA ECD, SEQ ID NO:53), corresponding to amino acids 44-750 of SEQ ID NO:50 with N- terminal signal (SEQ ID NO: 594), N-termmal Avi- (SEQ ID NO: 595) and 6His- (SEQ ID NO: 596) tags was cloned and expressed as described previously for the chimp PSMA ECD.
- Biotinylation of the cyno PSMA ECD protein was performed via the Avi tag by cotransfection of a BirA expression construct and the resulting secreted protein was purified by a two-step purification using IMAC HisTrap HP column (GE Healthcare) and MonoAvidin columns. The protein was tested for endotoxin prior to use in phage panning studies. This material was also used for binding and affinity measurements and is referred to as PSMG1.
- CynoPSMA Fc SEQ ID NO: 54
- IgGl Fc SEQ ID NO: 593
- CynoPSMA Fc protein was transiently expressed in 293HEK-expi cells.
- Transient transfection of PSMG3 in HEK293 Expi cells were harvested 5 days after transfection, clarified by centrifugation (30 min, 6000 rpm) and filtered (0.2m PES membrane, Corning). The relative amount of IgG was determined with the Octet instrument (ForteBio) using a purified known IgG (same isotype) spiked into spent medium to generate the standard curve.
- Clarified Cyno PSMA Fc supernatant was loaded onto an equilibrated (dPBS, pH 7.2) HiTrap MabSelect Sure Protein A column (GE Healthcare) at a relative concentration of ⁇ 30 mg protein per ml of resin. After loading, the column was washed with dPBS, pH7.2 and protein eluted with 10 column volumes of 0.1 M Na- Acetate, pH 3.5. Peak fractions were pooled, neutralized with 2M Tris, pH 7, and filtered (0.2m). The neutralized protein sample was dialyzed against 3 changes of dPBS containing Ca2+, Mg2+, and 0.5 mM ZnCl2, pH 7.2 overnight at 4°C.
- sample was removed from dialysis, filtered (0.2m) and the protein concentration determined by absorbance at 280nm on a BioTek SynergyHTTM spectrophotometer.
- the quality of the purified proteins was assessed by SDS-PAGE and analytical size exclusion HPLC (Dionex HPLC system). Endotoxin levels were measured using a LAL assay (Pyrotell-T, Associates of Cape Cod). Purified proteins were stored at 4°C.
- Strepavidin beads (Invitrogen Cat# 112.05D, Lot# 62992920) coated with biotinylated Chimp PSMA ECD according to the manufacturer’s protocol, followed by phage capture on ProtG beads(Invitrogen, Cat#l0003D) coated with Cyno-PSMA-Fc according to the manufacturer’s protocol followed by phage capture on Sera-mag Double Speed magnetic Neutravidin beads (Thermo, Cat #7815-2104-011150) coated with biotinylated Chimp PSMA ECD according to the manufacturer’s protocol. This panning yielded two hits: PSMM18 and PSMM25.
- the phage libraries were pre-cleared on untransfected parental HEK293F cells overnight at 4°C with gentle rocking. Following PEG/NaCl precipitation, the pre-cleared libraries were incubated with chimp PSMA expressing HEK293 cells or LNCAP cells with gentle rocking for 2 hr at 4°C.
- Plasmid DNA was isolated from phage panned E. coli (Plasmid Plus Maxi Kit, Qiagen cat#l2963) and subjected to Nhel/Spel restriction digest. The resulting 5400 and lOObp fragments were separated on a 0.8% agarose gel and the 5400bp fragment was gel purified (MinElute PCR purification kit, Qiagen cat#28006). The purified 5400bp band was self-ligated using T4 ligase and the resulting product (encoding the Fab-his fusion) was transformed back into the TG-l E. coli strain and clonally isolated. Fab-His supernatants were generated from clones by overnight induction of cultures with lmM IPTG.
- a cell-based binding assay was designed to assess the binding capabilities of individual Fab-his fusions from E.coli supernatants to PSMA-expressing cells.
- Individual Fab clones were isolated from the round 3 output of all panning experiments following pIX excision. Fab clones were tested for binding to chimp and cyno PSMA expressing HEK cells, as well as to human PSMA on LNCaP cells. Briefly, PSMA expressing cells were aliquoted into a V-bottom plate (CoStar 3357) at a density of 200,000 per well and incubated with (100 m ⁇ ) supernatants expressing Fab fragments for 1 hour on ice.
- In-Fusion HD cloning (ClonTech cat#6389l 8) was utilized according to the manufacturer’s protocol. Briefly, nucleotide sequences of clones that have passed the primary screen and are to be moved into mammalian Fab format, are loaded into the“InFu Primer Finder vl.2.3” program (software developed in-house), which generates a list of isotype-specific PCR primers used to generate PCR fragments for In-Fusion cloning into the huKappa muIgGSP and huGl Fab expression vectors. These vectors are in-house vectors with CMV promotors based off of pcDNA3.
- PSMM48 showed high binding to cyno PSMA-expressing cells and some binding to chimp-PSMA expressing cells, but no binding to FNCaP cells expressing human PSMA.
- PSMM56 showed a similar profile, but with some binding to FNCaP cells.
- PSMM69 - 80 bound to FNCaP cells, but not to chimp- or cyno-PSMA expressing cells.
- Mammalian Fab sups PSMM52, M56 and M57 bound all three cell lines. PSMM50, M51, and M54, show more chimp or cyno binding. M58 showed slight chimp and cyno binding.
- Fig. 23 - Fig. 25 show titration curves for hits that demonstrated binding to all three PSMA-expressing cells.
- Figs. 23A, 23B, 23C and 23D show the titration curves for anti-PSMA panning hits vs. LNCaP cells.
- Figs. 24A, 24B, 24C, and 24D show the titration curves for anti-PSMA panning hits vs chimp-PSMA HEK cells.
- Figs. 25A, 25B, 25C, and 25D show the titration curves for anti-PSMA panning hits vs Cyno- PSMA HEK cells. Binding profiles among hits were compared across cell lines expressing different species of PSMA. PSMM52 supernatant was used as a positive control across experiments. Several hits were deprioritized because of N-linked glycosylation sites in CDRs, binding to the PSMA negative parental HEK cell line, or lack of binding to PSMA positive cell lines. Eleven Fab hits remained and 10 hits were cloned into human IgG4-PAA heavy chain constructs and used to generate PSMA/CD3 bispecific antibodies. These hits showed cross species binding within 3 -fold of each other and were moved into a bispecific antibody format to be tested for T cell redirection killing of PSMA positive targets. The panning antigens for each hit is shown in Table 20.
- the expression vector previously described was used to express the Heavy and Light Chains for each PSMA mab, where both vectors were co-transfected transiently into 293Expi or CHO cell lines for expression of the mAh.
- CDR sequences of cross-species positive PSMA Fabs generated from phage panning are shown below in Table 21.
- VH and VL sequences of the selected Fabs are shown below in Table 22.
- Heavy and light chain sequences of mAbs generated from the Fabs are shown in Table 23.
- a monospecific anti-PSMA antibody PSMB119 was generated comprising the VH and VL regions having the VH of SEQ ID NO: l30and the VL of SEQ ID NO: l3land an IgG4 constant region with S228P, F234A, and L235A substitutions.
- a monospecific anti-PSMA antibody PSMB120 was generated comprising the VH and VL regions having the VH of SEQ ID NO: 128 and the VL of SEQ ID NO: 129 and an IgG4 constant region with S228P, F234A, and L235A substitutions.
- a monospecific anti-PSMA antibody PSMB121 was generated comprising the VH and VL regions having the VH of SEQ ID NO: 126 and the VL of SEQ ID NO: 127 and an IgG4 constant region with S228P, F234A, and L235A substitutions.
- a monospecific anti- PSMA antibody PSMB122 was generated comprising the VH and VL regions having the VH of SEQ ID NO: 125 and the VL of SEQ ID NO: 111 and an IgG4 constant region with S228P, F234A, and L235A substitutions.
- a monospecific anti-PSMA antibody PSMB123 was generated comprising the VH and VL regions having the VH of SEQ ID NO: 123 and the VL of SEQ ID NO: 124 and an IgG4 constant region with S228P, F234A, and L235A substitutions.
- a monospecific anti-PSMA antibody PSMB124 was generated comprising the VH and VL regions having the VH of SEQ ID NO: 121 and the VL of SEQ ID NO: 122 and an IgG4 constant region with S228P, F234A, and L235A substitutions.
- a monospecific anti-PSMA antibody PSMB126 was generated comprising the VH and VL regions having the VH of SEQ ID NO: 118 and the VL of SEQ ID NO: 119 and an IgG4 constant region with S228P, F234A, and L235A substitutions.
- a monospecific anti-PSMA antibody PSMB127 was generated comprising the VH and VL regions having the VH of SEQ ID NO: 116 and the VL of SEQ ID NO: 117 and an IgG4 constant region with S228P, F234A, and L235A substitutions.
- a monospecific anti-PSMA antibody PSMB128 was generated comprising the VH and VL regions having the VH of SEQ ID NO: 114 and the VL of SEQ ID NO: 115 and an IgG4 constant region with S228P, F234A, and L235A substitutions.
- a monospecific anti-PSMA antibody PSMB129 was generated comprising the VH and VL regions having the VH of SEQ ID NO: 110 and the VL of SEQ ID NO: 111 and an IgG4 constant region with S228P, F234A, and L235A substitutions.
- a monospecific anti- PSMA antibody PSMB130 was generated comprising the VH and VL regions having the VH of SEQ ID NO: 112 and the VL of SEQ ID NO: 113 and an IgG4 constant region with S228P, F234A, and L235A substitutions.
- PSMA is a homodimeric protein expressed on the cell surface.
- PSMA is a type II integral glycoprotein of 750 residues per monomer, comprised of a large ECD domain (705 residues) with peptidase activity, a single pass TM domain, and a short 19 residue intracellular domain.
- ECD extracellular region
- the extracellular region of human PSMA (residues 44-750) was expressed in High FiveTM insect cells with an N-terminal gp67 signal peptide followed by a cleavable hexahistidine tag (SEQ ID NO: 596).
- the secreted protein was purified from supernatant by a three-step procedure comprising of an initial Ni 2+ -NTA affinity capture, TEV-mediated cleavage of the histidine tag followed by an inverse affinity chromatography step, and a final size-exclusion chromatography step.
- Purified PSMA-ECD was flash-frozen in liquid nitrogen and stored at -80 °C in 10 mM HEPES pH 7.4, 150 mM NaCl, 2 mM CaCk, 0.1 mM ZnCk
- PSMM84 which is the parental anti-PSMA Fab arm in bispecific antibody PS3B27
- PS3B27 was expressed in HEK293 Expi cells with a hexahistidine tag (SEQ ID NO: 596) and purified using affinity (HisTrap, GE Healthcare) and size-exclusion chromatography (SEC-300, Phenomenex Yarra).
- the Fab was stored at 4 °C in 50 mM NaCl, 20 mM Tris pH 7.4
- the human PSMA ECD/PSMB83 Fab complex was prepared by a three-step procedure. First, the Fab was buffer exchanged into 20mM MES pH 6.0, 150 mM NaCl.
- the Fab and PSMA were mixed (1.5 molar excess Fab over PSMA monomer) and incubated overnight at 4 °C while dialyzing into 20 mM MES pH 6.0. Finally, the complex was bound to a monoS 5/50 column in 20 mM MES pH 6.0 and eluted with a NaCl gradient.
- Crystals suitable for X-ray diffraction were obtained using the sitting drop vapor- diffusion method at 20 °C and a Mosquito FCP robot (TTP Fabtech). Crystals of PSMB83 Fab bound to human PSMA ECD were grown from 18% PEG 3 kDa, 0.2 M (NH 4 )2S0 4 , 0.1 M Tris pH 8.5 with micro-seeds and the PSMA/Fab complex initially at 7.3 mg/mF. Crystals of free PSMB83 Fab were obtained from 25% PEG 3 kDa, 0.2 M FiCl, 0.1 M acetate pH 4.5 with the Fab initially at 8.8 mg/mF.
- the MR search model for the PSMB83 (aka PSMM84) Fab structure was PDB code 4M60.
- the PSMA/Fab complex structure was solved using the crystal structures of PSMA (PDB code: 2C6G) and PSMB83 Fab (structure at 1.93 A resolution; data not shown) as MR search models.
- the structures were refined with PHENIX (Adams, et al, 2004) and model adjustments were carried out using COOT (Emsley and Cowtan, 2004). All other crystallographic calculations were performed with the CCP4 suite of programs (Collaborative Computational Project Number 4, 1994). All molecular graphics were generated with PyMol (PyMOF Molecular Graphics System, Version 1.4.1, Schrodinger, EEC.) and complementarity determining regions (CDRs) were determined using the Rabat definition.
- the PSMA/Fab structure includes Fab light chain residues 1-211, Fab heavy chain residues 1-224 (except for residues 138-146, which are disordered) and PSMA residues 56-750, which corresponds to the protease (residues 56-116 and 352-590), apical (residues 117-351) and helical (residues 591-750) domains, and seven of ten possible N-linked glycans (in Asn-76, -121, -140, -195, -459, -476, and -638) per PSMA dimer subunit.
- the PSMA active site is located at the interface between the three domains and it contains two zinc atoms coordinated by histidine (H377 and H553) and glutamate/aspartate (D387, catalytic E424, E425, and D453) residues and a water molecule.
- the crystal asymmetric unit contains one PSMA dimer with each subunit bound in a similar manner to a PSMB83 Fab.
- the Fab/PSMA combining site is well defined by the electron density map, which allows reliable positioning of the binding residues.
- the Fab and PSMA molecules are numbered sequentially in Fig. 26 - Fig. 31.
- PSMB83 which is the parental anti- PSMA Fab arm in bispecific antibody PS3B27, recognizes a conformational and discontinuous epitope in the apical domain of PSMA (Fig. 26).
- the PSMA surface area buried by the Fab is around 700 A 2 .
- the PSMB83 epitope residues are 1138, F235, P237, G238, D244, Y299, Y300, Q303, K304, E307, and K324-P326.
- Helix a7 (residues Y299-E307) is a prevalent region of the epitope and binds across the Fab heavy and light chain CDRs.
- Y299 and Y300 form an aromatic cluster with Fab residues Y57 H , W94 L and PSMA residues F235 and P237, while E307, at the other helix end, forms a salt bridge with R9l L and hydrogen bonds Y32 L .
- Fig. 27 and Fig. 28 show the main interactions of PSMA with the PSMB83 light and heavy chains.
- the PSMB83 epitope residues are conserved between human and cynomolgus monkey (Fig. 29) and the bispecific antibody PS3B27 was demonstrated to bind with similar affinity to human and cyno PSMA.
- the human to mouse G238A and, especially, Y300D epitope mutations are expected to lower PSMB83 binding affinity to mouse PSMA in comparison to human.
- the Y300D mutation disrupts a hydrogen bond contact with N59 H and a p stacking interaction with W94 L .
- the PSMB83 paratope is composed of residues from all CDRs except CDR-L2 and CDR-H1 (Fig. 30). Specifically, the paratope residues are light chain S30 L , Y32 L , R9l L , S92 L , W94 l , and heavy chain G56 H -N59 H , K65 H , G66 H , Yl0l H , Vl07 H , and Dl09 H .
- Fig. 31 shows the interaction contacts between PSMA and PSMB83. The accessible location of the epitope facilitates binding of the PSMB83 Fab arm in the PS3B27 bispecific antibody to membrane- bound PSMA, while the other Fab arm is still bound to CD3 in the T-cell membrane.
- PSMB83 is not expected to inhibit PSMA enzymatic activity since the antibody binds away from the active site and does not cause any significant structural changes in PSMA that could affect enzymatic function, such as loop movements that close the active site or displacement of catalytic residues (RMSD of 0.3 A for Ca superposition of PSMA molecules in Fab bound and unbound (Barinka et al, 2007) structures).
- RMSD loop movements that close the active site or displacement of catalytic residues
- CDR1 and CDR2 were randomized according to the design in Table 24 (PH9H9L1).
- the H-CDR3 fragment was PCR amplified from pDR000024032 and digested with SacII + Xhol. This fragment was cloned into the PH9H9L1/PH9L3 library. This was transformed into E.coli MC1061F’ cells and phage was generated displaying this Fab library.
- Fig. 33 and Fig. 34 The plate was washed and then there was a 2.5-hour incubation with 200ul 0.3% milk in PBST to wash away some of the weak affinity fabs. Then there was another 30 minutes incubation with fresh 200ul 0.3% milk in PBST to remove more weak affinity fabs.
- the plates were washed and lOOul of anti-F(ab’)2-HRP antibody was added for 1 hour. Plates were washed and developed with 1 OOul of peroxidase reagent and luminescence was read on the Envision (Fig. 33 and Fig. 34).
- Fig. 32 demonstrates that the protein expression of the parental Fab and affinity matured Fabs were similar.
- the y axis values represent the luminescence of the detection reagent which equates to the abundance of fab protein over the dilution curve; the higher the luminescence reading, the more protein in the well which decreased with successive two-fold dilutions. There was more protein in the wells with affinity mature fabs but the increase over the parental is at most five times greater as demonstrated by the EC50 values (which is the concentration of protein that gives half of the maximal response).
- Fig. 33 demonstrates improved binding of the affinity matured Fabs to the human recombinant antigen over the parental anti -PSMA Fab (PSMB83).
- the y axis of the graph represents luminescence values. In this case the larger the value means more Fab bound to the human PSMA protein. This is a measure of binding as increased concentrations of Fab (along the x axis) generate higher luminescence values. There was negligible binding of the parental Fab under these conditions as demonstrated by the absence of signal even at high concentrations (open circles along the x axis). Binding of the affinity matured fabs was observed over the concentrations tested which equates to stronger binding capacity to the human PSMA protein. Given that parental Fab binding to human PSMA protein was zero, no EC50 could be generated.
- Fig. 34 demonstrates improved binding of the affinity matured Fabs to the cynomolgus recombinant antigen over the parental anti-PSMA Fab (PSMB83).
- the y axis of the graph represents luminescence values. In this case the larger the value means more Fab bound to the cynomolgus PSMA protein. This is a measure of binding as increased concentrations of Fab (along the x axis) generate higher luminescence values. There was negligible binding of the parental Fab under these conditions as demonstrated by the absence of signal even at high concentrations (open circles along the x axis). Binding of the affinity matured Fabs was observed over the concentrations tested which equates to stronger binding capacity to the human PSMA protein. Given that parental Fab binding to human PSMA protein was zero, no EC50 could be generated for direct comparison.
- the phages’ Fab binding profiles demonstrate improved binding to the human and cynomolgus recombinant antigen over the parental anti-PSMA mAh (PSMB127). This improvement is not a result of differences in Fab expression profiles, as demonstrated by Fig. 34 and Fig. 35, showing binding of affinity mature Fabs normalized to Fab expression levels.
- the top five Fab candidates identified from the ELISA screen were produced in monoclonal antibody format on IgG4 PAA.
- Table 26 lists the subsequent Mab identifiers and Tables 27 and 28 depict sequences for their variable regions and the sequences for the heavy and light chains, respectively.
- Tables 30 and 31 depict the sequences for the matrix recombined variable regions and the sequences for the heavy and light chains, respectively.
- Table 32 shows the CDR sequences for all affinity-matured PSMA hits. Table 32. CDR sequences of affinity-matured PSMA hits 3 Preparation and Functional Evaluation of PSMA*CD3 Bispecific Antibodies
- affinity-matured PSMA/CD3 bispecific antibodies Two types were generated: one specific for the targeting arm (e.g. affinity matured anti-PSMA) recombined with a high affinity CD3 arm CD3B376 (VH SEQ ID NO:652, VL SEQ ID NO:66l; HC SEQ ID NO:640, LC SEQ ID NO: 676) CD3 arm or low affinity CD3B450 (VH SEQ ID NO: 657, VL SEQ ID NO: 678,
- HC SEQ ID NO:675 HC SEQ ID NO:675, LC SEQ ID NO:677) arm.
- These parental mAbs are in the GenMab format (Labrijn et al, 2013) where the targeting parent (PSMA) contains the 409R GenMab mutation (native amino acid for IgG4), while the killing parent (CD3) contains the F405L GenMab mutation and R409K mutation.
- the monospecific anti-CD3 antibody was expressed as IgG4, having Fc substitutions S228P, F234A, L235A, F405L, and R409K (CD3 arm) (numbering according to EU index) in their Fc regions.
- the targeting parent (PSMA) is on human IgG4 with Fc substitutions S228P, F234A, L235A.
- the monospecific antibodies were expressed in HEK cell lines under CMV promoters.
- the parental PSMA and CD3 antibodies were purified using a protein A column with an elution buffer of lOOmM NaAc pH3.5 and a neutralization buffer of2.5M Tris, pH 7.2.
- the neutralized parental mAbs were used to make PSMAxCD3 bispecific antibodies.
- a portion of parental mabs were further buffer exchanged into D-PBS, pH 7.2 buffer for analytical measurements and assays.
- Post purification, controlled Fab-arm exchange was performed to make bispecific antibodies.
- the parental PSMA antibodies were mixed with the desired parental CD3 antibody under reducing conditions in 75mM -2-MEA (2-Mercaptoethylamine) and incubated at 3l°C for 4h or at room temperature overnight.
- the recombination reactions were based on molar ratios, where 6% excess PSMA parental mAbs was used to minimize the CD3 parental mAb remaining after recombination.
- the recombinations were subsequently dialyzed against lxDPBS, pH 7.2 to remove the reductant.
- the final bispecific antibodies produced, along with the parental mAbs (i.e. PSMA, CD3, or Null) used in the recombination reactions are listed in Table 33.
- PSMA hits were also paired with a non-killing arm (Null) to create negative controls for testing purposes.
- B2M1 an RSV antibody in the IgG4 PAA format (VH SEQ ID NO: 610, VL SEQ ID NO: 611) was generated, purified and, combined with either the CD3 arm CD3B219 -F405L, R409K to generate CD3B288 (CD3 xnull) or PSMA arms, PSMB122, PSMB126, PSMB130 to generate PS3B37, PS3B39 and PS3B40 respectively (PSMAxnull).
- PSMA specific affinity matured Mabs were crossed (as in methods above) to CD3B219 and CD3B376 to generate the bispecific antibodies shown in Table 32.
- PSMA/CD3 bispecific antibodies were tested for binding to PSMA positive cell line, LNCAP, to PSMA negative cell line, PC3.
- LNCAP PSMA positive cell line
- PC3 PSMA negative cell line
- the cell-binding assay was utilized (described previously). Bispecific antibodies were normalized for protein concentration and then incubated with the same number of cells expressing either human or cyno PSMA. The MFI at each concentration was collected by flow cytometry and plotted as a function of concentration. Data was transformed via loglO and then plotted. Nonlinear regression of binding curves was done to determine EC50s.
- Figs. 14-16 show LNCAP binding of all bispecific antibodies prepared. In Fig. 16, none of the constructs demonstrated binding to the PSMA negative cell line. In Fig. 14 and Fig. 15, all of the affinity matured hits demonstrated increased binding affinity through left shifted curves and increased cMax as compared to the parental Mab, PS2B27.
- CD3B376, were further characterized for the ability to mediate PSMA specific, redirected T cell cytotoxicity.
- T-cell mediated killing was measured using a caspase cytotoxicity assay, which indirectly measures cell killing via cleavage of a fluorescent substrate by active caspase 3/7. Cleavage of the substrate results in a fluorescent DNA dye, with fluorescence restricted to the cell nucleus. Repeated fluorescence measurements are taken in each well throughout the course of the assay, using a motorized 10X objective, capable of precisely imaging well(s) at the same coordinates. Target cell populations are identified based on defined size restrictions and/or through the use of a secondary label.
- Pan CD3+ T-cells purchased from Biological Specialty Corporation, Colmar, PA
- Prostate cancer cells, expressing PSMA, (LNCaP, C42) were cultured in RPMI 1640 with 10% HI FBS + supplements (purchased from Life Technologies).
- T-cells and target cells were combined at an effector to target ratio (E:T) of 3: 1 in Phenol Red free RPMI + 10% FBS and supplements (Life Technologies), without selection reagents, and 0.6uL of NucView caspase reagent (Essen Bioscience) was added to each mL of cells, per manufacturer guidelines.
- E:T effector to target ratio
- a total volume of 0.1 mL cells were added to appropriate wells of a clear, 96-well flat-bottom plate (BD Falcon).
- PS3B27 (CD3xPSMA), CD3B288 (CD3xNull) or PS3B46 (PSMAxNull) Bispecific antibodies were prepared at 2X final concentration in Phenol Red free RPMI, prepared as indicated above, and 0.
- PS3B79 and PS3B90 were evaluated in established 3D LnCaP AR.TB human prostate cancer xenografts in male NOD.Cg-Prkdc scld I12rg mi1 Wjl /SzJ (NSG) mice humanized intraperitoneally ⁇ ip) with human T cells.
- PS3B79 and PS3B90 at 2.5 and 5 mg/kg or
- NullxCD3B376 antibody control was dosed q3d-q4d on Days 36, 39, 43, 47, 50, 53, 56, 60, and 63 for a total of 8 doses.
- tumor growth inhibition %TGI
- PS3B79 at 5 mg/kg with 42% TGI
- PS3B90 at 2.5 and 5 mg/kg with 53% and 33% respectively compared to NullxCD3 control
- TGI Tumor growth inhibition
- CD3B376 is able to induce T cell activation and cytotoxicity in vivo and result in tumor growth inhibition in a bispecific format with high affinity PSMA binding arms, PSMB360 and PSMB365. 4 Preparation and Functional Evaluation of ILlRAPxCD3 Bispecific
- IL1RAP monoclonal antibodies used in and suitable for use in the bispecific antibodies of the present disclosure are described in U.S. Patent Application Publication No. 20170121420A1, the disclosure of which is hereby incorporated by reference in its entirety.
- Fifteen monospecific IL1RAP antibodies (see Table 6 of US20170121420A1) were expressed as IgG4, having Fc substitutions S228P, F234A, and F235A.
- CD3 parental mAbs were expressed as IgG4 with S228P, F234A, F235A, F405F, and R409K (numbering according to EFT index).
- monospecific anti-CD3 antibody CD3B220 was also generated comprising the VH and VF regions having the VH of SEQ ID NO: 92 and the VF of SEQ ID NO: 93 and IgG4 constant region with S228P, F234A, F235A, F405F, and R409K substitutions.
- the monospecific antibodies were purified using standard methods using a Protein A column. After elution, the pools were neutralized to pH 7 and dialyzed into lxD-PBS, pH 7.2.
- Bispecific IFlRAPxCD3 antibodies were generated by combining a monospecific CD3 mAb (CD3B376: VH of SEQ ID NO: 652 and VL of SEQ ID NO: 661; or CD3B450: VH of SEQ ID NO: 657 and VL of SEQ ID NO: 678) and a monospecific IL1RAP mAb through controlled Fab-arm exchange (as described in WO2011/131746). Briefly, at about 1-20 mg/mL at a molar ratio of 1.08: 1 of anti-ILlRAP/anti-CD3 antibody in DPBS, pH 7-7.4 and 75 mM 2- mercaptoethanolamine (2-MEA) were mixed together and incubated at 25-37° C. for 2-6 hours, followed byW removal of 2-MEA via dialysis, diafiltration, tangential flow filtrationto remove the reductant and enable bispecific antibody formation.
- CD3B376 VH of SEQ ID NO: 652 and VL of S
- VH and VH sequences of the 15 IL1RAP mAbs are shown below in Table 35.
- Tumor cell line LAMA-84 was washed with DPBS before incubation with CFSE (resuspended in 150 mL DMSO and diluted 1 : 10,000) at 10* 10 6 cells/mL of CFSE for 8 minutes at room temperature. Staining was quenched with HI FBS and washed in media before resuspension in complete media at 2x10 5 cells/mL. Equal volumes of whole blood and CFSE- stained tumor cells were combined in each well of a 96-well plate. After the addition of antibody (resuspended in 10 mL of DPBS) in respective wells, all plates were incubated at 37°C with 5% CO2 for 48 hours.
- CFSE resuspended in 150 mL DMSO and diluted 1 : 10,000
- Undiluted CD25-PE was added directly to each well of whole blood and incubated for 30 minutes at room temperature, protected from light. Cells were then centrifuged at 1500 rpm for 5 minutes and lysed with 200 uL of multi-specie red lysis buffer, repeated 4 more times. Cells were washed in DPBS once and stained with Live/Dead Near-IR (diluted in DPBS) for 15 minutes (Table 36). Each well was washed and resuspended in FACS buffer before the cells were acquired on a BD FACS CANTO II.
- the cell acquisition on the FACS CANTO II was limited to lxl 0 4 tumor cells.
- Tumor cell death was assessed by gating on FSC and SSC to identify cell populations, then CFSE positive tumor events, and finally Live/Dead Near-IR to assess tumor cytotoxicity.
- T-cell activation was assessed by gating on FSC and SSC to identify cell populations, CFSE negative events, Near-IR negative events to assess live cells, then CD25 positive cells.
- the percentage of either dead tumor cells or CD25 positive cells were graphed using GraphPad Prism 6 and analyzed with a non-linear curve fit. Additional statistical analysis was evaluated in the program“R” to determine population ECso values using a nonlinear mixed-effects model.
- IC3B19 IAPB57xCD3B2l9
- IC3B34 IAPB57xCD3B376
- IC3B19 and IC3B34 induced similar T-cell mediated cytotoxicity of ILlRAP + LAMA-84 cell line ex vivo after 48 hours.
- cytotoxicity represented Fig. 53 were 2.097 and 2.762, respectively (Table 37).
- the ECso values for T-cell activation (CD25) by IC3B19 and IC3B34 represented by Fig. 54 were 4.237 and 7.825 nM, respectively (Table 38). All of the null arm control bispecific antibodies did not induce detectable levels of cytotoxicity or T-cell activation as shown in Fig. 53 and Fig. 54.
- the general level of cytotoxicity and T-cell activation were similar between both IC3B19 and IC3B34.
- a standard curve was prepared by reconstituting the provided calibrator in 1.0 mL of MSD Diluent 2. Fifty microliters of each sample or standard was added directly to pre-washed MSD plates. Subsequent incubations and washes were all carried out per manufacturer’s protocol. Assay plates were read on the MSD Sector Imager.
- IC3B19 and IC3B34 were modeled together using a non-linear regression model, with fixed effect parameters for minimum, maximum, logEC50, and slope for each compound, and a random effect term that takes into account paired donor effect. Point estimates and their confidence intervals were extracted and plotted for visual comparison from these separate models. Testing significant differences for each parameter was done by constructing a model that used a joint estimate for the parameter of interest, then comparing that model to the original model using a log-likelihood test.
- IC3B19 minimum, IC3B19 maximum, IC3B19 logEC50, IC3B19 slope, IC3B34 minimum, IC3B34 maximum, IC3B34 logEC50, and IC3B34 slope To check whether the minimums are the significantly different, a second model is constructed that has all the same parameter except that there is a single shared parameter for the minimum.
- the log likelihood (an overall measure of how well the model fits the data) of the first model is compared to the log likelihood of the second model. If they are not significantly different from each other, then we can conclude that the minimums are not significantly different from each other. Similarly, if the log likelihoods are significantly different from one another, then we would conclude that the minimums are significantly different.
- IC3B19 and IC3B34 mediated engagement of T cells and IL1RAP+ target cell line LAMA-84 (endogenous and exogenously added tumor cells) resulted in T cell cytokine release.
- LAMA-84 endogenous and exogenously added tumor cells
- cytokines Of the 10 cytokines evaluated, most cytokines resulted in a measurable dose dependent release in response to both IC3B19 and IC3B34, except for IL-8 and IL-l2p70. As shown in Table 39, IL-10, IL-2, TNF-a, and INF-g resulted in the most potent EC50 (nM) release. In addition, the majority of cytokines and at both time points, the IC3B34 molecule resulted in a less potent EC50 (nM) that was statistically significant.
- IL-4 24 hours
- IL-6 24 and 48 hours
- IL-8 24 and 48 hours
- IL-l2p70 24 and 48 hours
- IL-13 24 hours
- INF-g 24 and 48 hours
- TNF-a 24 hours
- Table 39 IC3B19 and IC3B34 Four Parameter Logistic Regression Summary Table. Bold text denotes statistical significant difference in EC50 (nM) values between IC3B19 and IC3B34. Results of individual cytokine release experiments are shown in the Fig. Nos. indicated.
- T-cell mediated killing of IC3B19 and IC3B34 was measured using a second type of cell toxicity assay.
- the caspase cytotoxicity assay indirectly measures cell killing via cleavage of a fluorescent substrate by active caspase 3/7. Cleavage of the substrate results in a fluorescent DNA dye, with fluorescence restricted to the cell nucleus. Repeated fluorescence measurements are taken in each well throughout the course of the assay, using a motorized 10X objective, capable of precisely imaging well(s) at the same coordinates. Target cell populations are identified based on defined size restrictions.
- Target cells were cultured in RPMI l640/Glutamax (25 mM HEPES buffer) medium supplemented with 10% heat inactivated FBS, lmM sodium pyruvate, and 0.1 mM non-essential amino acids (Life Technologies).
- Target cells were plated at 20,000 cells/well in 50 ul of phenol-red free RPMI media containing supplements 16 hours prior to experiment initiation into tissue culture-treated, clear flat bottom plates (Costar). The cells were allowed to incubate at room temperature (RT) for 20 min to allow for even distribution of cells in the wells, and then the cells were allowed to incubate at 37°C and 5% C02 overnight. On the day of the experiment, T-cells were counted and diluted to 1.0*10 L 6 cells/ml in phenol red free RPMI media containing supplements and combined with Nuc-View TM488 Caspase-3/7 Substrate (Essen Biosciences) for a working concentration of 10 uM. 100 ul of the combined T-cells and the Caspase-3/7 substrate were added to each well for a final concentration of 5 uM of the Caspase-3/7 substrate.
- IC3B19 (IAPB57xCD3B2l9)
- IC3B34 (IAPB57xCD3B376)
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Cell Biology (AREA)
- Reproductive Health (AREA)
- Pregnancy & Childbirth (AREA)
- Gynecology & Obstetrics (AREA)
- Oncology (AREA)
- Hematology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biomedical Technology (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Epidemiology (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (30)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201980049271.7A CN112912397B (zh) | 2018-05-24 | 2019-05-21 | 抗cd3抗体及其用途 |
| SG11202011270QA SG11202011270QA (en) | 2018-05-24 | 2019-05-21 | Anti-cd3 antibodies and uses thereof |
| LTEPPCT/IB2019/054188T LT3802608T (lt) | 2018-05-24 | 2019-05-21 | Antikūnai prieš cd3 ir jų panaudojimas |
| CA3101271A CA3101271A1 (en) | 2018-05-24 | 2019-05-21 | Anti-cd3 antibodies and uses thereof |
| KR1020207037046A KR20210012007A (ko) | 2018-05-24 | 2019-05-21 | 항-cd3 항체 및 이의 용도 |
| FIEP19737219.6T FI3802608T3 (fi) | 2018-05-24 | 2019-05-21 | Cd3-vasta-aineita ja niiden käyttötapoja |
| UAA202008271A UA129050C2 (uk) | 2018-05-24 | 2019-05-21 | Антитіла до cd3 та їх застосування |
| BR112020023508-3A BR112020023508A2 (pt) | 2018-05-24 | 2019-05-21 | Anticorpos anti-cd3 e usos dos mesmos |
| DK19737219.6T DK3802608T3 (da) | 2018-05-24 | 2019-05-21 | Anti-cd3-antistoffer og anvendelser deraf |
| RS20250579A RS66901B1 (sr) | 2018-05-24 | 2019-05-21 | Anti-cd3 antitela i njihova upotreba |
| MA52773A MA52773B1 (fr) | 2018-05-24 | 2019-05-21 | Anticorps anti-cd3 et leurs utilisations |
| CR20200568A CR20200568A (es) | 2018-05-24 | 2019-05-21 | Antcuerpos anti-cd3 y usos de estos |
| PL19737219.6T PL3802608T3 (pl) | 2018-05-24 | 2019-05-21 | Przeciwciała anty-cd3 i ich zastosowania |
| JP2020565282A JP7530299B2 (ja) | 2018-05-24 | 2019-05-21 | 抗cd3抗体及びその使用 |
| EP19737219.6A EP3802608B1 (en) | 2018-05-24 | 2019-05-21 | Anti-cd3 antibodies and uses thereof |
| PE2020001886A PE20210132A1 (es) | 2018-05-24 | 2019-05-21 | Anticuerpos anti-cd3 y usos de estos |
| CN202510209510.8A CN120058941A (zh) | 2018-05-24 | 2019-05-21 | 抗cd3抗体及其用途 |
| EA202092847A EA202092847A1 (ru) | 2018-05-24 | 2019-05-21 | Антитела к cd3 и их применение |
| AU2019274656A AU2019274656B2 (en) | 2018-05-24 | 2019-05-21 | Anti-CD3 antibodies and uses thereof |
| JOP/2020/0302A JOP20200302A1 (ar) | 2018-05-24 | 2019-05-21 | الأجسام المضادة لـ cd3 واستخداماتها |
| EP25173398.6A EP4643951A3 (en) | 2018-05-24 | 2019-05-21 | Anti-cd3 antibodies and uses thereof |
| ES19737219T ES3032856T3 (en) | 2018-05-24 | 2019-05-21 | Anti-cd3 antibodies and uses thereof |
| SI201930938T SI3802608T1 (sl) | 2018-05-24 | 2019-05-21 | Protitelesa anti-cd3 in njihova uporaba |
| MX2020012587A MX420253B (es) | 2018-05-24 | 2019-05-21 | Anticuerpos anti-cd3 y usos de estos. |
| HRP20250621TT HRP20250621T1 (hr) | 2018-05-24 | 2019-05-21 | Protutijela usmjerena na cd3 i njihove primjene |
| SM20250221T SMT202500221T1 (it) | 2018-05-24 | 2019-05-21 | Anticorpi anti-cd3 e usi di essi |
| PH12020551920A PH12020551920A1 (en) | 2018-05-24 | 2020-11-09 | Anti-cd3 antibodies and uses thereof |
| IL278846A IL278846A (en) | 2018-05-24 | 2020-11-19 | Anti-CD3 antibodies and uses thereof |
| CONC2020/0014506A CO2020014506A2 (es) | 2018-05-24 | 2020-11-23 | Anticuerpos anti-cd3 y usos de estos |
| JP2024087232A JP2024116190A (ja) | 2018-05-24 | 2024-05-29 | 抗cd3抗体及びその使用 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201862676081P | 2018-05-24 | 2018-05-24 | |
| US62/676,081 | 2018-05-24 |
Publications (3)
| Publication Number | Publication Date |
|---|---|
| WO2019224717A2 true WO2019224717A2 (en) | 2019-11-28 |
| WO2019224717A3 WO2019224717A3 (en) | 2020-03-05 |
| WO2019224717A9 WO2019224717A9 (en) | 2021-02-04 |
Family
ID=67211773
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/IB2019/054188 Ceased WO2019224717A2 (en) | 2018-05-24 | 2019-05-21 | Anti-cd3 antibodies and uses thereof |
Country Status (38)
Cited By (20)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2021019389A1 (en) * | 2019-07-26 | 2021-02-04 | Janssen Biotech, Inc. | Proteins comprising kallikrein related peptidase 2 antigen binding domains and their uses |
| WO2021240388A1 (en) * | 2020-05-27 | 2021-12-02 | Janssen Biotech, Inc. | Proteins comprising cd3 antigen binding domains and uses thereof |
| WO2022060901A1 (en) | 2020-09-16 | 2022-03-24 | Amgen Inc. | Methods for administering therapeutic doses of bispecific t-cell engaging molecules for the treatment of cancer |
| CN115175702A (zh) * | 2019-12-18 | 2022-10-11 | 詹森生物科技公司 | 用于体内生物靶向的材料和方法 |
| WO2023026246A1 (en) * | 2021-08-27 | 2023-03-02 | International Business Machines Corporation | Antigen-binding proteins targeting coronavirus (cov) variants |
| US20230310599A1 (en) * | 2020-09-02 | 2023-10-05 | Genmab A/S | Antibody therapy |
| JP2023543826A (ja) * | 2020-09-29 | 2023-10-18 | イノベント バイオロジクス(シンガポール)プライベート リミティド | 抗cd3抗体およびその使用 |
| EP4294528A2 (en) * | 2021-02-16 | 2023-12-27 | JANSSEN Pharmaceutica NV | Trispecific antibody targeting bcma, gprc5d, and cd3 |
| US11866499B2 (en) | 2018-05-24 | 2024-01-09 | Janssen Biotech, Inc. | Monospecific and multispecific anti-TMEFF2 antibodies and their uses |
| WO2024077044A1 (en) | 2022-10-05 | 2024-04-11 | Amgen Inc. | Combination therapies comprising t-cell redirecting therapies and agonistic anti-il-2r antibodies or fragments thereof |
| WO2024089551A1 (en) | 2022-10-25 | 2024-05-02 | Janssen Biotech, Inc. | Msln and cd3 binding agents and methods of use thereof |
| US12043669B2 (en) | 2021-05-21 | 2024-07-23 | Leo Pharma A/S | IL-1 receptor accessory protein-inhibiting antibodies and antigen-binding fragments thereof |
| US12247071B2 (en) | 2016-12-21 | 2025-03-11 | Amgen Inc. | Anti-TNF alpha antibody formulations |
| WO2025134049A1 (en) | 2023-12-21 | 2025-06-26 | Janssen Biotech, Inc | Trispecific antibody targeting bcma, gprc5d and cd3 for the treatment of al amyloidosis |
| WO2025134050A1 (en) | 2023-12-21 | 2025-06-26 | Janssen Biotech, Inc | Trispecific antibody targeting bcma, gprc5d and cd3 for the treatment of multiple myeloma |
| WO2025217101A2 (en) | 2024-04-09 | 2025-10-16 | Amgen Inc. | Agonistic anti-il-2rbg heavy‑chain antibodies |
| WO2026006495A1 (en) | 2024-06-25 | 2026-01-02 | Alloy Therapeutics, Inc. | Anti-wt1/hla-a2 antibody and uses thereof |
| WO2026006492A2 (en) | 2024-06-25 | 2026-01-02 | Ypsilon Therapeutics, Inc. | Anti-prame/hla-a2 antibodies and uses thereof |
| WO2026078647A1 (en) | 2024-10-11 | 2026-04-16 | Janssen Biotech, Inc. | Combination of trispecific antibody targeting bcma, gprc5d and cd3, and pomalidomide for the treatment of multiple myeloma |
| WO2026078659A1 (en) | 2024-10-11 | 2026-04-16 | Janssen Biotech, Inc. | Combination of trispecific antibody targeting bcma, gprc5d and cd3, and an anti-cd38 antibody for the treatment of multiple myeloma |
Families Citing this family (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| IL319047A (en) | 2015-08-28 | 2025-04-01 | Amunix Operating Inc | Chimeric polypeptide composition and methods for its preparation and use |
| CA3066918A1 (en) | 2017-06-12 | 2018-12-20 | Bluefin Biomedicine, Inc. | Anti-il1rap antibodies and antibody drug conjugates |
| JOP20190116A1 (ar) * | 2018-05-24 | 2019-11-24 | Janssen Biotech Inc | الأجسام المضادة لتكتل التمايز 33 (cd33)، والأجسام المضادة ثنائية النوعية لتكتل التمايز 33 (cd33)/تكتل التمايز 3 (cd3) واستخداماتها |
| PE20211916A1 (es) | 2018-05-24 | 2021-09-28 | Janssen Biotech Inc | Agentes aglutinantes del psma y usos de estos |
| TWI838389B (zh) | 2018-07-19 | 2024-04-11 | 美商再生元醫藥公司 | 雙特異性抗-BCMAx抗-CD3抗體及其用途 |
| MD3823665T2 (ro) | 2018-07-19 | 2024-05-31 | Regeneron Pharma | Receptori antigenci chimerici cu specificitate BCMA și utilizările acestora |
| US11591395B2 (en) | 2019-04-19 | 2023-02-28 | Janssen Biotech, Inc. | Methods of treating prostate cancer with an anti-PSMA/CD3 antibody |
| AU2021225870A1 (en) * | 2020-02-27 | 2022-10-20 | Janssen Biotech, Inc. | Materials and methods for modulating an immune response |
| US20210284731A1 (en) * | 2020-03-13 | 2021-09-16 | Janssen Biotech, Inc. | Methods and materials for modulating an immune response |
| KR20230041819A (ko) | 2020-07-29 | 2023-03-24 | 얀센 바이오테크 인코포레이티드 | Hla-g 항원-결합 도메인을 포함하는 단백질 및 이의 용도 |
| CA3199319A1 (en) | 2020-10-22 | 2022-04-28 | Janssen Biotech, Inc. | Proteins comprising delta-like ligand 3 (dll3) antigen binding domains and their uses |
| AU2022333321A1 (en) * | 2021-08-27 | 2024-04-11 | Janssen Biotech, Inc. | Anti-psma antibodies and uses thereof |
| JP2025510266A (ja) * | 2022-03-25 | 2025-04-14 | 嘉和生物▲薬▼▲業▼有限公司 | Cd3を標的とする抗体及びその使用 |
| AR130550A1 (es) * | 2022-09-21 | 2024-12-18 | Sanofi Biotechnology | Anticuerpo anti-il-1r3 humanizado y métodos de uso |
| WO2024126833A1 (en) * | 2022-12-16 | 2024-06-20 | Ichnos Sciences SA | Cd47-il1rap bispecific antibodies |
| WO2025230233A1 (ko) * | 2024-05-03 | 2025-11-06 | 국민대학교산학협력단 | 인간 cd3에 특이적인 항체 및 이의 용도 |
Citations (39)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1988001649A1 (en) | 1986-09-02 | 1988-03-10 | Genex Corporation | Single polypeptide chain binding molecules |
| WO1990004036A1 (en) | 1988-10-12 | 1990-04-19 | Medical Research Council | Production of antibodies from transgenic animals |
| WO1990007861A1 (en) | 1988-12-28 | 1990-07-26 | Protein Design Labs, Inc. | CHIMERIC IMMUNOGLOBULINS SPECIFIC FOR p55 TAC PROTEIN OF THE IL-2 RECEPTOR |
| WO1992001047A1 (en) | 1990-07-10 | 1992-01-23 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| WO1992022653A1 (en) | 1991-06-14 | 1992-12-23 | Genentech, Inc. | Method for making humanized antibodies |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| WO1994013804A1 (en) | 1992-12-04 | 1994-06-23 | Medical Research Council | Multivalent and multispecific binding proteins, their manufacture and use |
| US5427908A (en) | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
| WO1998044001A1 (en) | 1997-03-27 | 1998-10-08 | Commonwealth Scientific And Industrial Research Organisation | High avidity polyvalent and polyspecific reagents |
| US5885793A (en) | 1991-12-02 | 1999-03-23 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| WO1999045962A1 (en) | 1998-03-13 | 1999-09-16 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US6150584A (en) | 1990-01-12 | 2000-11-21 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US6172197B1 (en) | 1991-07-10 | 2001-01-09 | Medical Research Council | Methods for producing members of specific binding pairs |
| WO2002043478A2 (en) | 2000-11-30 | 2002-06-06 | Medarex, Inc. | Transgenic transchromosomal rodents for making human antibodies |
| WO2002066630A1 (en) | 2001-02-16 | 2002-08-29 | Regeneron Pharmaceuticals, Inc. | Methods of modifying eukaryotic cells |
| US6521427B1 (en) | 1997-09-16 | 2003-02-18 | Egea Biosciences, Inc. | Method for the complete chemical synthesis and assembly of genes and genomes |
| US6670127B2 (en) | 1997-09-16 | 2003-12-30 | Egea Biosciences, Inc. | Method for assembly of a polynucleotide encoding a target polypeptide |
| US6818749B1 (en) | 1998-10-31 | 2004-11-16 | The United States Of America As Represented By The Department Of Health And Human Services | Variants of humanized anti carcinoma monoclonal antibody cc49 |
| WO2006028936A2 (en) | 2004-09-02 | 2006-03-16 | Genentech, Inc. | Heteromultimeric molecules |
| US20070287170A1 (en) | 2006-03-24 | 2007-12-13 | Merck Patent Gmbh | Engineered heterodimeric protein domains |
| WO2009018386A1 (en) | 2007-07-31 | 2009-02-05 | Medimmune, Llc | Multispecific epitope binding proteins and uses thereof |
| WO2009080251A1 (en) | 2007-12-21 | 2009-07-02 | F. Hoffmann-La Roche Ag | Bivalent, bispecific antibodies |
| WO2009080252A1 (en) | 2007-12-21 | 2009-07-02 | F. Hoffmann-La Roche Ag | Bivalent, bispecific antibodies |
| WO2009080254A1 (en) | 2007-12-21 | 2009-07-02 | F. Hoffmann-La Roche Ag | Bivalent, bispecific antibodies |
| WO2009085462A1 (en) | 2007-12-19 | 2009-07-09 | Centocor, Inc. | Design and generation of human de novo pix phage display libraries via fusion to pix or pvii, vectors, antibodies and methods |
| US20090182127A1 (en) | 2006-06-22 | 2009-07-16 | Novo Nordisk A/S | Production of Bispecific Antibodies |
| US20100015133A1 (en) | 2005-03-31 | 2010-01-21 | Chugai Seiyaku Kabushiki Kaisha | Methods for Producing Polypeptides by Regulating Polypeptide Association |
| US20100028637A1 (en) | 2005-06-22 | 2010-02-04 | Sunjuet Deutschland Gmbh | Multi-Layer Film Comprising a Barrier Layer and an Antistatic Layer |
| US7709226B2 (en) | 2001-07-12 | 2010-05-04 | Arrowsmith Technology Licensing Llc | Method of humanizing antibodies by matching canonical structure types CDRs |
| US20100261620A1 (en) | 2008-10-14 | 2010-10-14 | Juan Carlos Almagro | Methods of Humanizing and Affinity-Maturing Antibodies |
| US20110123532A1 (en) | 2009-04-27 | 2011-05-26 | Oncomed Pharmaceuticals, Inc. | Method for Making Heteromultimeric Molecules |
| WO2011131746A2 (en) | 2010-04-20 | 2011-10-27 | Genmab A/S | Heterodimeric antibody fc-containing proteins and methods for production thereof |
| US20120149876A1 (en) | 2010-11-05 | 2012-06-14 | Zymeworks Inc. | Stable Heterodimeric Antibody Design with Mutations in the Fc Domain |
| US8242247B2 (en) | 2007-12-21 | 2012-08-14 | Hoffmann-La Roche Inc. | Bivalent, bispecific antibodies |
| US20130195849A1 (en) | 2011-11-04 | 2013-08-01 | Zymeworks Inc. | Stable Heterodimeric Antibody Design with Mutations in the Fc Domain |
| US8748356B2 (en) | 2007-10-19 | 2014-06-10 | Janssen Biotech, Inc. | Methods for use in human-adapting monoclonal antibodies |
| WO2014093908A2 (en) | 2012-12-14 | 2014-06-19 | Omt, Inc. | Polynucleotides encoding rodent antibodies with human idiotypes and animals comprising same |
| US20170121420A1 (en) | 2015-11-02 | 2017-05-04 | Janssen Pharmaceutica Nv | Anti-il1rap antibodies, bispecific antigen binding molecules that bind il1rap and cd3, and uses thereof |
Family Cites Families (13)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5530101A (en) * | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| KR102060389B1 (ko) | 2011-05-21 | 2019-12-31 | 마크로제닉스, 인크. | 사람 및 비-사람 cd3에 결합할 수 있는 cd3-결합 분자 |
| JOP20200236A1 (ar) * | 2012-09-21 | 2017-06-16 | Regeneron Pharma | الأجسام المضادة لمضاد cd3 وجزيئات ربط الأنتيجين ثنائية التحديد التي تربط cd3 وcd20 واستخداماتها |
| ME03675B (me) * | 2013-07-05 | 2020-10-20 | Genmab As | Humanizovana ili himerna anтi-cd3 antiтela |
| IL263466B2 (en) * | 2013-12-17 | 2023-10-01 | Genentech Inc | Anti-CD3 antibodies and methods of using them |
| CN106459201A (zh) * | 2014-05-28 | 2017-02-22 | 豪夫迈·罗氏有限公司 | 结合人和食蟹猴CD3ε的抗体 |
| EP2982693A1 (en) * | 2014-08-07 | 2016-02-10 | Affimed Therapeutics AG | CD3 binding domain |
| CN120988137A (zh) * | 2015-01-23 | 2025-11-21 | 赛诺菲 | 抗cd3抗体、抗cd123抗体和与cd3和/或cd123特异性结合的双特异性抗体 |
| PE20241349A1 (es) | 2016-09-14 | 2024-07-03 | Teneobio Inc | Anticuerpos de union a cd3 |
| UA130542C2 (uk) * | 2018-05-16 | 2026-03-18 | Янссен Байотек, Інк. | Антитіло до cd38 та терапевтичний засіб, який перенаправляє т-клітини, для лікування множинної мієломи у суб'єкта |
| PE20211916A1 (es) | 2018-05-24 | 2021-09-28 | Janssen Biotech Inc | Agentes aglutinantes del psma y usos de estos |
| JOP20190116A1 (ar) | 2018-05-24 | 2019-11-24 | Janssen Biotech Inc | الأجسام المضادة لتكتل التمايز 33 (cd33)، والأجسام المضادة ثنائية النوعية لتكتل التمايز 33 (cd33)/تكتل التمايز 3 (cd3) واستخداماتها |
| MA52772A (fr) * | 2018-05-24 | 2021-04-14 | Janssen Biotech Inc | Anticorps anti-tmeff2 monospécifiques et multispécifiques et leurs utilisations |
-
2019
- 2019-05-21 CA CA3101271A patent/CA3101271A1/en active Pending
- 2019-05-21 CR CR20200568A patent/CR20200568A/es unknown
- 2019-05-21 PT PT197372196T patent/PT3802608T/pt unknown
- 2019-05-21 CN CN201980049271.7A patent/CN112912397B/zh active Active
- 2019-05-21 SM SM20250221T patent/SMT202500221T1/it unknown
- 2019-05-21 KR KR1020207037046A patent/KR20210012007A/ko active Pending
- 2019-05-21 JO JOP/2020/0302A patent/JOP20200302A1/ar unknown
- 2019-05-21 PL PL19737219.6T patent/PL3802608T3/pl unknown
- 2019-05-21 EA EA202092847A patent/EA202092847A1/ru unknown
- 2019-05-21 EP EP19737219.6A patent/EP3802608B1/en active Active
- 2019-05-21 DK DK19737219.6T patent/DK3802608T3/da active
- 2019-05-21 SI SI201930938T patent/SI3802608T1/sl unknown
- 2019-05-21 UA UAA202008271A patent/UA129050C2/uk unknown
- 2019-05-21 PE PE2020001886A patent/PE20210132A1/es unknown
- 2019-05-21 HU HUE19737219A patent/HUE072251T2/hu unknown
- 2019-05-21 EP EP25173398.6A patent/EP4643951A3/en active Pending
- 2019-05-21 FI FIEP19737219.6T patent/FI3802608T3/fi active
- 2019-05-21 US US16/418,082 patent/US11603405B2/en active Active
- 2019-05-21 SG SG11202011270QA patent/SG11202011270QA/en unknown
- 2019-05-21 JP JP2020565282A patent/JP7530299B2/ja active Active
- 2019-05-21 WO PCT/IB2019/054188 patent/WO2019224717A2/en not_active Ceased
- 2019-05-21 RS RS20250579A patent/RS66901B1/sr unknown
- 2019-05-21 MA MA52773A patent/MA52773B1/fr unknown
- 2019-05-21 MX MX2020012587A patent/MX420253B/es unknown
- 2019-05-21 ES ES19737219T patent/ES3032856T3/es active Active
- 2019-05-21 CN CN202510209510.8A patent/CN120058941A/zh active Pending
- 2019-05-21 LT LTEPPCT/IB2019/054188T patent/LT3802608T/lt unknown
- 2019-05-21 BR BR112020023508-3A patent/BR112020023508A2/pt unknown
- 2019-05-21 HR HRP20250621TT patent/HRP20250621T1/hr unknown
- 2019-05-21 AU AU2019274656A patent/AU2019274656B2/en active Active
- 2019-05-24 AR ARP190101400A patent/AR115422A1/es unknown
- 2019-05-24 UY UY0001038245A patent/UY38245A/es unknown
- 2019-05-24 TW TW108118086A patent/TW202012443A/zh unknown
-
2020
- 2020-11-09 PH PH12020551920A patent/PH12020551920A1/en unknown
- 2020-11-19 IL IL278846A patent/IL278846A/en unknown
- 2020-11-23 CL CL2020003033A patent/CL2020003033A1/es unknown
- 2020-11-23 CO CONC2020/0014506A patent/CO2020014506A2/es unknown
- 2020-11-23 NI NI202000089A patent/NI202000089A/es unknown
- 2020-11-23 EC ECSENADI202075215A patent/ECSP20075215A/es unknown
- 2020-11-24 SA SA520420631A patent/SA520420631B1/ar unknown
-
2023
- 2023-03-08 US US18/180,225 patent/US20230322924A1/en active Granted
-
2024
- 2024-05-29 JP JP2024087232A patent/JP2024116190A/ja active Pending
Patent Citations (48)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| WO1988001649A1 (en) | 1986-09-02 | 1988-03-10 | Genex Corporation | Single polypeptide chain binding molecules |
| US5571698A (en) | 1988-09-02 | 1996-11-05 | Protein Engineering Corporation | Directed evolution of novel binding proteins |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5403484A (en) | 1988-09-02 | 1995-04-04 | Protein Engineering Corporation | Viruses expressing chimeric binding proteins |
| WO1990004036A1 (en) | 1988-10-12 | 1990-04-19 | Medical Research Council | Production of antibodies from transgenic animals |
| WO1990007861A1 (en) | 1988-12-28 | 1990-07-26 | Protein Design Labs, Inc. | CHIMERIC IMMUNOGLOBULINS SPECIFIC FOR p55 TAC PROTEIN OF THE IL-2 RECEPTOR |
| US6150584A (en) | 1990-01-12 | 2000-11-21 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US5580717A (en) | 1990-05-01 | 1996-12-03 | Affymax Technologies N.V. | Recombinant library screening methods |
| US5427908A (en) | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
| US5969108A (en) | 1990-07-10 | 1999-10-19 | Medical Research Council | Methods for producing members of specific binding pairs |
| WO1992001047A1 (en) | 1990-07-10 | 1992-01-23 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| WO1992022653A1 (en) | 1991-06-14 | 1992-12-23 | Genentech, Inc. | Method for making humanized antibodies |
| US6172197B1 (en) | 1991-07-10 | 2001-01-09 | Medical Research Council | Methods for producing members of specific binding pairs |
| US6521404B1 (en) | 1991-12-02 | 2003-02-18 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US5885793A (en) | 1991-12-02 | 1999-03-23 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US6593081B1 (en) | 1991-12-02 | 2003-07-15 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US6582915B1 (en) | 1991-12-02 | 2003-06-24 | Medical Research Council | Production of anti-self bodies from antibody segment repertories and displayed on phage |
| US6555313B1 (en) | 1991-12-02 | 2003-04-29 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US6544731B1 (en) | 1991-12-02 | 2003-04-08 | Medical Research Council | Production of anti-self antibodies from antibody segment repertories and displayed on phage |
| WO1994013804A1 (en) | 1992-12-04 | 1994-06-23 | Medical Research Council | Multivalent and multispecific binding proteins, their manufacture and use |
| WO1998044001A1 (en) | 1997-03-27 | 1998-10-08 | Commonwealth Scientific And Industrial Research Organisation | High avidity polyvalent and polyspecific reagents |
| US6670127B2 (en) | 1997-09-16 | 2003-12-30 | Egea Biosciences, Inc. | Method for assembly of a polynucleotide encoding a target polypeptide |
| US6521427B1 (en) | 1997-09-16 | 2003-02-18 | Egea Biosciences, Inc. | Method for the complete chemical synthesis and assembly of genes and genomes |
| WO1999045962A1 (en) | 1998-03-13 | 1999-09-16 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US6818749B1 (en) | 1998-10-31 | 2004-11-16 | The United States Of America As Represented By The Department Of Health And Human Services | Variants of humanized anti carcinoma monoclonal antibody cc49 |
| WO2002043478A2 (en) | 2000-11-30 | 2002-06-06 | Medarex, Inc. | Transgenic transchromosomal rodents for making human antibodies |
| WO2002066630A1 (en) | 2001-02-16 | 2002-08-29 | Regeneron Pharmaceuticals, Inc. | Methods of modifying eukaryotic cells |
| US7709226B2 (en) | 2001-07-12 | 2010-05-04 | Arrowsmith Technology Licensing Llc | Method of humanizing antibodies by matching canonical structure types CDRs |
| WO2006028936A2 (en) | 2004-09-02 | 2006-03-16 | Genentech, Inc. | Heteromultimeric molecules |
| US20100015133A1 (en) | 2005-03-31 | 2010-01-21 | Chugai Seiyaku Kabushiki Kaisha | Methods for Producing Polypeptides by Regulating Polypeptide Association |
| US20100028637A1 (en) | 2005-06-22 | 2010-02-04 | Sunjuet Deutschland Gmbh | Multi-Layer Film Comprising a Barrier Layer and an Antistatic Layer |
| US20070287170A1 (en) | 2006-03-24 | 2007-12-13 | Merck Patent Gmbh | Engineered heterodimeric protein domains |
| US20090182127A1 (en) | 2006-06-22 | 2009-07-16 | Novo Nordisk A/S | Production of Bispecific Antibodies |
| WO2009018386A1 (en) | 2007-07-31 | 2009-02-05 | Medimmune, Llc | Multispecific epitope binding proteins and uses thereof |
| US8748356B2 (en) | 2007-10-19 | 2014-06-10 | Janssen Biotech, Inc. | Methods for use in human-adapting monoclonal antibodies |
| WO2009085462A1 (en) | 2007-12-19 | 2009-07-09 | Centocor, Inc. | Design and generation of human de novo pix phage display libraries via fusion to pix or pvii, vectors, antibodies and methods |
| WO2009080254A1 (en) | 2007-12-21 | 2009-07-02 | F. Hoffmann-La Roche Ag | Bivalent, bispecific antibodies |
| WO2009080252A1 (en) | 2007-12-21 | 2009-07-02 | F. Hoffmann-La Roche Ag | Bivalent, bispecific antibodies |
| US8242247B2 (en) | 2007-12-21 | 2012-08-14 | Hoffmann-La Roche Inc. | Bivalent, bispecific antibodies |
| WO2009080251A1 (en) | 2007-12-21 | 2009-07-02 | F. Hoffmann-La Roche Ag | Bivalent, bispecific antibodies |
| US20100261620A1 (en) | 2008-10-14 | 2010-10-14 | Juan Carlos Almagro | Methods of Humanizing and Affinity-Maturing Antibodies |
| US20110123532A1 (en) | 2009-04-27 | 2011-05-26 | Oncomed Pharmaceuticals, Inc. | Method for Making Heteromultimeric Molecules |
| WO2011131746A2 (en) | 2010-04-20 | 2011-10-27 | Genmab A/S | Heterodimeric antibody fc-containing proteins and methods for production thereof |
| US20120149876A1 (en) | 2010-11-05 | 2012-06-14 | Zymeworks Inc. | Stable Heterodimeric Antibody Design with Mutations in the Fc Domain |
| US20130195849A1 (en) | 2011-11-04 | 2013-08-01 | Zymeworks Inc. | Stable Heterodimeric Antibody Design with Mutations in the Fc Domain |
| WO2014093908A2 (en) | 2012-12-14 | 2014-06-19 | Omt, Inc. | Polynucleotides encoding rodent antibodies with human idiotypes and animals comprising same |
| US20170121420A1 (en) | 2015-11-02 | 2017-05-04 | Janssen Pharmaceutica Nv | Anti-il1rap antibodies, bispecific antigen binding molecules that bind il1rap and cd3, and uses thereof |
Non-Patent Citations (44)
| Title |
|---|
| "GenBank", Database accession no. AAB84059 |
| "Remington: The Science and Practice of Pharmacy", 2006, LIPINCOTT WILLIAMS AND WILKINS, article "Pharmaceutical Manufacturing", pages: 691 - 1092 |
| "Uniprot", Database accession no. P20138 |
| "UniProt", Database accession no. Q9UIK5 |
| "UniProtKB/Swiss-Prot", Database accession no. Q9NPH3-1 |
| ADAN ET AL., CRITICAL REVIEWS IN BIOTECHNOLOGY, 2016, pages 1549 - 7801 |
| BRUGGEMANN ET AL., EUR J IMMUNOL, vol. 21, 1991, pages 1323 - 1326 |
| BRUGGEMANNTAUSSIG, CURR OPIN BIOTECHNOL, vol. 8, 1997, pages 455 - 458 |
| CHAMESBATY, CURR OPIN DRUG DISC DEV, vol. 12, 2009, pages 276 |
| CHOTHIA ET AL., J MOL BIOL, vol. 196, 1987, pages 901 - 17 |
| CLINE, PHARMAC. THER., vol. 29, 1985, pages 69 - 92 |
| FISHWILD ET AL., NAT BIOTECHNOL, vol. 14, 1996, pages 845 - 851 |
| GADI ET AL., GENE THER., vol. 7, 2000, pages 1738 - 1743 |
| GODING: "Monoclonal Antibodies: Principles and Practice", 1986, ACADEMIC PRESS, pages: 59 - 103 |
| GREEN ET AL., NATURE GENET., vol. 7, 1994, pages 13 - 21 |
| GREEN, J IMMUNOL METHODS, vol. 231, 1999, pages 11 - 23 |
| GREENJAKOBOVITS, EXP. MED., vol. 188, 1998, pages 483 - 95 |
| HONEGGERPLUCKTHUN, J MOL BIOL, vol. 309, 2001, pages 657 - 70 |
| HOOGENBOOMWINTER, J MOL BIOL, vol. 222, 1991, pages 581 |
| HUANG ET AL., PROC NATL ACAD SCI USA, vol. 94, no. 24, 1997, pages 12829 - 12832 |
| HUANG ET AL., PROC. NATL. ACAD. SCI. USA., vol. 94, no. 24, 1997, pages 12829 - 12832 |
| KNAPPIK ET AL., J MOL BIOL, vol. 296, 2000, pages 57 - 86 |
| KOHLERMILSTEIN, NATURE, vol. 256, 1975, pages 495 |
| KREBS ET AL., J IMMUNOL METH, vol. 254, 2001, pages 67 - 84 |
| LABRIJN ET AL., NAT PROTOC, vol. 9, no. 10, 2014, pages 2450 - 63 |
| LABRIJN ET AL., PNAS, vol. 110, no. 13, 2013, pages 5145 - 5150 |
| LATHEY, J. ET AL., IMMUNOLOGY, vol. 57, no. 1, 1986, pages 29 - 35 |
| LEFRANC ET AL., DEV COMP IMMUNOL, vol. 27, 2003, pages 55 - 77 |
| LONBERG ET AL., NATURE, vol. 368, 1994, pages 856 - 9 |
| LONBERGHUSZAR, INT REV IMMUNOL, vol. 13, 1995, pages 65 - 93 |
| MARTINTHORNTON, J BMOL BIOL, vol. 263, 1996, pages 800 - 15 |
| MENDEZ ET AL., NAT GENET, vol. 15, 1997, pages 146 - 156 |
| NUNEZ-PRADO ET AL., DRUG DISCOVERY TODAY, vol. 20, no. 5, 2015, pages 588 - 594 |
| OKAYAMABERG, MOL. CELL. BIOL., vol. 3, 1983, pages 280 |
| OSBORN ET AL., J IMMUNOL, vol. 190, no. 4, 2013, pages 1481 - 1490 |
| PADLAN, MOL IMMUNOL, vol. 28, 1991, pages 489 - 499 |
| PASCAL ET AL., J. AM. SOC. MASS SPECTROM., vol. 23, no. 9, 2012, pages 1512 - 1521 |
| SHEETS ET AL., PITAS (USA, vol. 95, 1998, pages 6157 - 6162 |
| SHI, L. ET AL., J MOL BIOL, vol. 397, no. 2, 2010, pages 385 - 396 |
| THALMANN ET AL., CANCER RESEARCH, vol. 54, 1994, pages 2577 - 81 |
| VAUGHAN ET AL., NATURE BIOTECHNOLOGY, vol. 14, 1996, pages 309 - 314 |
| WRANIK ET AL., J BIOL CHEM, vol. 287, no. 52, 2012, pages 42221 - 9 |
| WU ET AL., J EXP MED, vol. 132, 1970, pages 211 - 50 |
| YANG ET AL., CANCER RES, vol. 59, 1999, pages 1236 - 1243 |
Cited By (28)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12247071B2 (en) | 2016-12-21 | 2025-03-11 | Amgen Inc. | Anti-TNF alpha antibody formulations |
| US11866499B2 (en) | 2018-05-24 | 2024-01-09 | Janssen Biotech, Inc. | Monospecific and multispecific anti-TMEFF2 antibodies and their uses |
| WO2021019389A1 (en) * | 2019-07-26 | 2021-02-04 | Janssen Biotech, Inc. | Proteins comprising kallikrein related peptidase 2 antigen binding domains and their uses |
| CN114375302A (zh) * | 2019-07-26 | 2022-04-19 | 詹森生物科技公司 | 包含激肽释放酶相关肽酶2抗原结合结构域的蛋白质及其用途 |
| CN114375302B (zh) * | 2019-07-26 | 2024-12-24 | 詹森生物科技公司 | 包含激肽释放酶相关肽酶2抗原结合结构域的蛋白质及其用途 |
| US12077585B2 (en) | 2019-07-26 | 2024-09-03 | Janssen Biotech, Inc. | Proteins comprising kallikrein related peptidase 2 antigen binding domains and their uses |
| CN115175702A (zh) * | 2019-12-18 | 2022-10-11 | 詹森生物科技公司 | 用于体内生物靶向的材料和方法 |
| US12460001B2 (en) | 2020-05-27 | 2025-11-04 | Janssen Biotech, Inc. | Proteins comprising CD3 antigen binding domains and uses thereof |
| WO2021240388A1 (en) * | 2020-05-27 | 2021-12-02 | Janssen Biotech, Inc. | Proteins comprising cd3 antigen binding domains and uses thereof |
| US20230310599A1 (en) * | 2020-09-02 | 2023-10-05 | Genmab A/S | Antibody therapy |
| WO2022060901A1 (en) | 2020-09-16 | 2022-03-24 | Amgen Inc. | Methods for administering therapeutic doses of bispecific t-cell engaging molecules for the treatment of cancer |
| EP4223777A4 (en) * | 2020-09-29 | 2025-01-08 | Fortvita Biologics (Singapore) Pte. Ltd. | ANTI-CD3 ANTIBODY AND ITS USES |
| JP2023543826A (ja) * | 2020-09-29 | 2023-10-18 | イノベント バイオロジクス(シンガポール)プライベート リミティド | 抗cd3抗体およびその使用 |
| AU2021353368B2 (en) * | 2020-09-29 | 2026-03-05 | Fortvita Biologics (Usa), Inc. | Anti-cd3 antibody and uses thereof |
| JP2024507180A (ja) * | 2021-02-16 | 2024-02-16 | ヤンセン ファーマシューティカ エヌ.ベー. | Bcma、gprc5d、及びcd3を標的とする三重特異的抗体 |
| EP4294528A2 (en) * | 2021-02-16 | 2023-12-27 | JANSSEN Pharmaceutica NV | Trispecific antibody targeting bcma, gprc5d, and cd3 |
| US12043669B2 (en) | 2021-05-21 | 2024-07-23 | Leo Pharma A/S | IL-1 receptor accessory protein-inhibiting antibodies and antigen-binding fragments thereof |
| WO2023026246A1 (en) * | 2021-08-27 | 2023-03-02 | International Business Machines Corporation | Antigen-binding proteins targeting coronavirus (cov) variants |
| US12600764B2 (en) | 2021-08-27 | 2026-04-14 | International Business Machines Corporation | Antigen-binding proteins targeting coronavirus (COV) variants |
| WO2024077044A1 (en) | 2022-10-05 | 2024-04-11 | Amgen Inc. | Combination therapies comprising t-cell redirecting therapies and agonistic anti-il-2r antibodies or fragments thereof |
| WO2024089551A1 (en) | 2022-10-25 | 2024-05-02 | Janssen Biotech, Inc. | Msln and cd3 binding agents and methods of use thereof |
| WO2025134049A1 (en) | 2023-12-21 | 2025-06-26 | Janssen Biotech, Inc | Trispecific antibody targeting bcma, gprc5d and cd3 for the treatment of al amyloidosis |
| WO2025134050A1 (en) | 2023-12-21 | 2025-06-26 | Janssen Biotech, Inc | Trispecific antibody targeting bcma, gprc5d and cd3 for the treatment of multiple myeloma |
| WO2025217101A2 (en) | 2024-04-09 | 2025-10-16 | Amgen Inc. | Agonistic anti-il-2rbg heavy‑chain antibodies |
| WO2026006495A1 (en) | 2024-06-25 | 2026-01-02 | Alloy Therapeutics, Inc. | Anti-wt1/hla-a2 antibody and uses thereof |
| WO2026006492A2 (en) | 2024-06-25 | 2026-01-02 | Ypsilon Therapeutics, Inc. | Anti-prame/hla-a2 antibodies and uses thereof |
| WO2026078647A1 (en) | 2024-10-11 | 2026-04-16 | Janssen Biotech, Inc. | Combination of trispecific antibody targeting bcma, gprc5d and cd3, and pomalidomide for the treatment of multiple myeloma |
| WO2026078659A1 (en) | 2024-10-11 | 2026-04-16 | Janssen Biotech, Inc. | Combination of trispecific antibody targeting bcma, gprc5d and cd3, and an anti-cd38 antibody for the treatment of multiple myeloma |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20230322924A1 (en) | Anti-cd3 antibodies and uses thereof | |
| AU2015341884B2 (en) | CD3/CD38 T cell retargeting hetero-dimeric immunoglobulins and methods of their production | |
| JP7292200B2 (ja) | 抗gprc5d抗体、gprc5dとcd3を結合する二重特異性抗原結合分子、及びその使用 | |
| JP2023051968A (ja) | 多重特異的NKp46結合タンパク質 | |
| JP2024161509A (ja) | 多価抗体 | |
| US20240059789A1 (en) | Psma binding proteins and uses thereof | |
| TWI865451B (zh) | 單特異性及多特異性抗tmeff2抗體及其用途 | |
| TW202216767A (zh) | 與CD3及FolR1結合之抗體 | |
| TW202521579A (zh) | 經穩定化之cd3抗原結合劑及其使用方法 | |
| HK40126767A (zh) | 抗cd3抗体及其用途 | |
| HK40052977A (en) | Anti-cd3 antibodies and uses thereof | |
| EA045935B1 (ru) | Антитела к cd3 и их применение | |
| CN121986117A (en) | Stable CD3 antibody binding agents and methods of use thereof | |
| TW202539744A (zh) | 抗ceacam5抗體藥物軛合物 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 19737219 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 2020565282 Country of ref document: JP Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 3101271 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: NC2020/0014506 Country of ref document: CO |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2019274656 Country of ref document: AU Date of ref document: 20190521 Kind code of ref document: A |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112020023508 Country of ref document: BR |
|
| WWP | Wipo information: published in national office |
Ref document number: NC2020/0014506 Country of ref document: CO |
|
| WWE | Wipo information: entry into national phase |
Ref document number: DZP2020000673 Country of ref document: DZ |
|
| ENP | Entry into the national phase |
Ref document number: 20207037046 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2019737219 Country of ref document: EP Effective date: 20210111 |
|
| ENP | Entry into the national phase |
Ref document number: 112020023508 Country of ref document: BR Kind code of ref document: A2 Effective date: 20201118 |
|
| WWG | Wipo information: grant in national office |
Ref document number: 520420631 Country of ref document: SA |
|
| WWG | Wipo information: grant in national office |
Ref document number: NC2020/0014506 Country of ref document: CO |
|
| WWG | Wipo information: grant in national office |
Ref document number: MX/A/2020/012587 Country of ref document: MX |
|
| WWG | Wipo information: grant in national office |
Ref document number: 201980049271.7 Country of ref document: CN |
|
| WWG | Wipo information: grant in national office |
Ref document number: 2019737219 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: P-2025/0579 Country of ref document: RS |