WO2019165156A1 - Cd83-binding chimeric antigen receptors - Google Patents

Cd83-binding chimeric antigen receptors Download PDF

Info

Publication number
WO2019165156A1
WO2019165156A1 PCT/US2019/019065 US2019019065W WO2019165156A1 WO 2019165156 A1 WO2019165156 A1 WO 2019165156A1 US 2019019065 W US2019019065 W US 2019019065W WO 2019165156 A1 WO2019165156 A1 WO 2019165156A1
Authority
WO
WIPO (PCT)
Prior art keywords
dap12
dap10
myd88
icos
btnl3
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2019/019065
Other languages
English (en)
French (fr)
Inventor
Marco Davila
Brian Betts
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
H Lee Moffitt Cancer Center and Research Institute Inc
Original Assignee
H Lee Moffitt Cancer Center and Research Institute Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to JP2020543928A priority Critical patent/JP7358369B2/ja
Priority to SG11202007755YA priority patent/SG11202007755YA/en
Priority to CA3092220A priority patent/CA3092220C/en
Priority to CN201980027877.0A priority patent/CN112004832A/zh
Priority to EP19757555.8A priority patent/EP3755722A4/en
Priority to US16/969,056 priority patent/US12492254B2/en
Priority to BR112020017015-1A priority patent/BR112020017015A2/pt
Priority to AU2019226101A priority patent/AU2019226101A1/en
Priority to EA202092006A priority patent/EA202092006A1/ru
Priority to KR1020207027148A priority patent/KR20200130324A/ko
Application filed by H Lee Moffitt Cancer Center and Research Institute Inc filed Critical H Lee Moffitt Cancer Center and Research Institute Inc
Priority to MX2020008803A priority patent/MX2020008803A/es
Publication of WO2019165156A1 publication Critical patent/WO2019165156A1/en
Priority to US16/717,537 priority patent/US20200108098A1/en
Priority to PH12020500632A priority patent/PH12020500632A1/en
Priority to IL276836A priority patent/IL276836A/en
Anticipated expiration legal-status Critical
Priority to ZA2020/05837A priority patent/ZA202005837B/en
Priority to US18/478,247 priority patent/US20240197779A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/14Blood; Artificial blood
    • A61K35/17Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/001Preparations to induce tolerance to non-self, e.g. prior to transplantation
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/11T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/19Dendritic cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/20Cellular immunotherapy characterised by the effect or the function of the cells
    • A61K40/24Antigen-presenting cells [APC]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/31Chimeric antigen receptors [CAR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/421Immunoglobulin superfamily
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/7051T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0636T lymphocytes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/38Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the dose, timing or administration schedule
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/46Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
    • A61K2239/48Blood cells, e.g. leukemia or lymphoma
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/33Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00Genetically modified cells

Definitions

  • HCT Allogeneic hematopoietic cell transplantation
  • HCT is an effective therapy for hematological malignancies but it is limited by acute graft-versus-host disease (GVHD).
  • GVHD arises when donor T cells respond to genetically defined proteins on host cells, and is a key contributor to the high mortality associated with HCT.
  • DC Dendritic cells
  • Chimeric antigen receptor (CAR) polypeptides are disclosed that can be used with adoptive cell transfer to suppress alloreactive cells, such as donor T cells.
  • the disclosed CAR polypeptides contain in an ectodomain an anti-CD83 binding agent that can bind CD83-expressing cells.
  • an immune effector cell genetically modified to express the disclosed CAR polypeptide.
  • the anti-CD83 binding agent is in some embodiments an antibody fragment that specifically binds CD83.
  • the antigen binding domain can be a Fab or a single-chain variable fragment (scFv) of an antibody that specifically binds CD83.
  • the anti-CD83 binding agent is in some embodiments an aptamerthat specifically binds CD83.
  • the anti-CD83 binding agent can be a peptide aptamer selected from a random sequence pool based on its ability to bind CD83.
  • the anti-CD83 binding agent can also be a natural ligand of CD83, or a variant and/or fragment thereof capable of binding CD83.
  • the anti-CD83 scFv can comprise a variable heavy (V H ) domain having CDR1 , CDR2 and CDR3 sequences and a variable light (VL) domain having CDR1 , CDR2 and CDR3 sequences.
  • V H variable heavy
  • VL variable light
  • the CDR1 sequence of the V H domain comprises the amino acid sequence GFSITTGGYWWT (SEQ ID NO:1), SDGIS (SEQ ID NO:7), or SNAMI (SEQ ID NO:13);
  • CDR2 sequence of the V H domain comprises the amino acid sequence GYIFSSGNTNYNPSIKS (SEQ ID NO:2), IISSGGNTYYASWAKG (SEQ ID NO:8), or AMDSNSRTYYATWAKG (SEQ ID NO:14);
  • CDR3 sequence of the V H domain comprises the amino acid sequence CARAYGKLGFDY (SEQ ID NO:3), WGGTYSI (SEQ ID NO:9), or GDGGSSDYTEM (SEQ ID NO:15);
  • CDR1 sequence of the VL comprises the amino acid sequence TLSSQHSTYTIG (SEQ ID NO:4), QSSQSVYNNDFLS (SEQ ID NO:10).
  • CDR2 sequence of the V L domain comprises the amino acid sequence VNSDGSHSKGD (SEQ ID NO:5), YASTLAS (SEQ ID NO:11), or QASSLAS (SEQ ID NO:17); and CDR3 sequence of the V L domain comprises the amino acid sequence GSSDSSGYV (SEQ ID NO:6),
  • TGTYGNSAWYEDA SEQ ID NO:12
  • LGEYSISADNH SEQ ID NO:18
  • the CDR1 sequence of the V H domain comprises the amino acid sequence GFSITTGGYWWT (SEQ ID NO:1)
  • CDR2 sequence of the V H domain comprises the amino acid sequence
  • CDR3 sequence of the V H domain comprises the amino acid sequence CARAYGKLGFDY (SEQ ID NO:3)
  • CDR1 sequence of the VL comprises the amino acid sequence TLSSQHSTYTIG (SEQ ID NO:4)
  • CDR2 sequence of the VL domain comprises the amino acid sequence VNSDGSHSKGD (SEQ ID NO:S)
  • CDR3 sequence of the V L domain comprises the amino acid sequence GSSDSSGYV (SEQ ID NO:6).
  • the CDR1 sequence of the VH domain comprises the amino acid sequence SDGIS (SEQ ID NO:7)
  • CDR2 sequence of the V H domain comprises the amino acid sequence IISSGGNTYYASWAKG (SEQ ID NO:8)
  • CDR3 sequence of the VH domain comprises the amino acid sequence WGGTYSI (SEQ ID NO:9)
  • CDR1 sequence of the V L comprises the amino acid sequence QSSQS VYNNDFLS (SEQ ID NO:10)
  • CDR2 sequence of the V L domain comprises the amino acid sequence YASTLAS (SEQ ID NO:11)
  • CDR3 sequence of the VL domain comprises the amino acid sequence TGTYGNSAWYEDA (SEQ ID NO:12).
  • the CDR1 sequence of the V H domain comprises the amino acid sequence SNAMI (SEQ ID NO:13)
  • CDR2 sequence of the V H domain comprises the amino acid sequence AMDSNSRTYYATWAKG (SEQ ID NO:14)
  • CDR3 sequence of the V H domain comprises the amino acid sequence GDGGSSDYTEM (SEQ ID NO: 15)
  • CDR1 sequence of the V L comprises the amino acid sequence QSSQSVYGNNELS (SEQ ID NO:16)
  • CDR2 sequence of the V L domain comprises the amino acid sequence QASSLAS (SEQ ID NO: 17)
  • CDR3 sequence of the V L domain comprises the amino acid sequence LGEYSISADNH (SEQ ID NO: 18).
  • the anti-CD83 scFv V H domain comprises the amino acid sequence:
  • the anti-CD83 scFv V L domain comprises the amino acid sequence:
  • the anti-CD83 scFv V H domain comprises the amino acid sequence:
  • the anti-CD83 scFv V L domain comprises the amino acid sequence:
  • the anti-CD83 scFv V H domain comprises the amino acid sequence:
  • the anti-CD83 scFv VL domain comprises the amino acid sequence:
  • the anti-CD83 scFv V H domain comprises the amino acid sequence:
  • the anti-CD83 scFv VL domain comprises the amino acid sequence:
  • the anti-CD83 scFv V H domain comprises the amino acid sequence:
  • the anti-CD83 scFv VL domain comprises the amino acid sequence:
  • the anti-CD83 scFv V H domain comprises the amino acid sequence:
  • the anti-CD83 scFv VL domain comprises the amino acid sequence:
  • the anti-CD83 scFv V H domain comprises the amino acid sequence:
  • the anti-CD83 scFv VL domain comprises the amino acid sequence:
  • the anti-CD83 scFv V H domain comprises the amino acid sequence:
  • the anti-CD83 scFv VL domain comprises the amino acid sequence:
  • the anti-CD83 scFv V H domain comprises the amino acid sequence:
  • the anti-CD83 scFv V L domain comprises the amino acid sequence:
  • the anti-CD83 scFv V L domain comprises the amino acid sequence:
  • the anti-CD83 scFv VL domain comprises the amino acid sequence:
  • the anti-CD83 scFv VL domain comprises the amino acid sequence:
  • the anti-CD83 scFv VL domain comprises the amino acid sequence:
  • the anti-CD83 scFv VL domain comprises the amino acid sequence: LTQSPLSLPVTLGQPASISCKSSQSLVDSDGNTYLNWFQQRPGQSPRRLIYKVSNR DSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWPRTFGQGTKVEIKR
  • the anti-CD83 scFv V L domain comprises the amino acid sequence:
  • the anti-CD83 scFv V_, domain comprises the amino acid sequence:
  • the anti-CD83 scFv V L domain comprises the amino acid sequence:
  • the anti-CD83 scFv V_. domain comprises the amino acid sequence:
  • the anti-CD83 scFv V L domain comprises the amino acid sequence:
  • the anti-CD83 scFv V L domain comprises the amino acid sequence:
  • the anti-CD83 scFv V H domain has been humanized and comprises the amino acid sequence:
  • the anti-CD83 scFv V H domain has been humanized and comprises the amino acid sequence:
  • the anti-CD83 scFv V H domain has been humanized and comprises the amino acid sequence:
  • the anti-CD83 scFv V H domain has been humanized and comprises the amino acid sequence:
  • the anti-CD83 scFv V H domain has been humanized and comprises the amino acid sequence:
  • the anti-CD83 scFv V H domain has been humanized and comprises the amino acid sequence:
  • the anti-CD83 scFv V L domain has been humanized and comprises the amino acid sequence:
  • the anti-CD83 scFv V_, domain has been humanized and comprises the amino acid sequence:
  • the heavy and light chains are preferably separated by a linker.
  • Suitable linkers for scFv antibodies are known in the art.
  • the linker comprises the amino acid sequence GGGGSGGGGSGGGGS (SEQ ID NO:56).
  • the anti-CD83 scFv comprises an amino acid sequence:
  • the anti-CD83 scFv comprises an amino acid sequence:
  • the anti-CD83 scFv comprises an amino acid sequence:
  • the anti-CD83 scFv comprises an amino acid sequence:
  • the anti-CD83 scFv comprises an amino acid sequence:
  • the anti-CD83 scFv comprises an amino acid sequence:
  • the anti-CD83 scFv comprises an amino acid sequence:
  • the anti-CD83 scFv comprises an amino acid sequence:
  • the anti-CD83 scFv comprises an amino acid sequence:
  • the anti-CD83 scFv comprises an amino acid sequence:
  • the anti-CD83 scFv comprises an amino acid sequence:
  • the anti-CD83 scFv comprises an amino acid sequence:
  • the anti-CD83 scFv comprises an amino acid sequence:
  • the anti-CD83 scFv comprises an amino acid sequence:
  • the anti-CD83 scFv comprises an amino acid sequence:
  • the disclosed polypeptides can also contain a transmembrane domain and an endodomain capable of activating an immune effector cell.
  • the endodomain can contain a signaling domain and one or more co-stimulatory signaling regions.
  • the intracellular signaling domain is a CD3 zeta (CD3Q signaling domain.
  • the costimulatory signaling region comprises the cytoplasmic domain of CD28, 4-1 BB, or a combination thereof. In some cases, the costimulatory signaling region contains 1 , 2, 3, or 4 cytoplasmic domains of one or more intracellular signaling and/or costimulatory molecules. In some embodiments, the co-stimulatory signaling region contains one or more mutations in the cytoplasmic domains of CD28 and/or 4-1 BB that enhance signaling.
  • the CAR polypeptide contains an incomplete endodomain.
  • the CAR polypeptide can contain only an intracellular signaling domain or a co-stimulatory domain, but not both.
  • the immune effector cell is not activated unless it and a second CAR polypeptide (or endogenous T-cell receptor) that contains the missing domain both bind their respective antigens. Therefore, in some embodiments, the CAR polypeptide contains a CD3 zeta (CD3Q signaling domain but does not contain a costimulatory signaling region (CSR). In other embodiments, the CAR polypeptide contains the cytoplasmic domain of CD28, 4-1 BB, or a combination thereof, but does not contain a CD3 zeta (CD3Q signaling domain (SD).
  • CD3 zeta CD3Q signaling domain
  • the cell can be an immune effector cell selected from the group consisting of an alpha-beta T cells, a gamma-delta T cell, a Natural Killer (NK) cells, a Natural Killer T (NKT) cell, a B cell, an innate lymphoid cell (ILC), a cytokine induced killer (CIK) cell, a cytotoxic T lymphocyte (CTL), a lymphokine activated killer (LAK) cell, and a regulatory T cell.
  • an immune effector cell selected from the group consisting of an alpha-beta T cells, a gamma-delta T cell, a Natural Killer (NK) cells, a Natural Killer T (NKT) cell, a B cell, an innate lymphoid cell (ILC), a cytokine induced killer (CIK) cell, a cytotoxic T lymphocyte (CTL), a lymphokine activated killer (LAK) cell, and a regulatory T cell.
  • NK Natural Kill
  • the cell suppresses alloreactive donor cells, such as T cells, when the antigen binding domain of the CAR binds to CD83.
  • tissue transplantation comprises a bone marrow transplantations.
  • tissue transplantation comprises a solid organ transplant, including but not limited to, face transplant, abdominal wall transplant, limb transplant, upper extremity transplant, vascularized composite allograft, or whole tissue graft.
  • the subject has an autoimmune diseases, sepsis, rheumatological diseases, diabetes, and/or asthma.
  • FIG. 1 is a schema of a human CD83 CAR construct according to one embodiment disclosed herein.
  • An anti-CD83 single chain variable fragment is followed by a CD8 hinge and transmembrane domain, as well as a 41 BB co- stimulatory domain and 003 ⁇ activation domain.
  • the CAR is tagged with a fluorescent reporter at the 3' end.
  • the CAR Reporter gene is cloned into a SFG retroviral vector.
  • FIGs. 2A to 2E show characterization of the human CD83 CAR T cell.
  • FIG. 2A is a bar graph showing the amount (mean ⁇ SEM) of T cells expressing the eGFP reporter post production among mock transduced (eGFP negative) or the CD83 CAR (eGFP positive) T cells.
  • FIG. 2B is a bar graph demonstrating the relative amount (mean ⁇ SEM) of CD4 or CD8 expression among the mock transduced or the CD83 CAR T cells, Sidak's test.
  • FIG. 2C shows the amount of IFNy released by mock transduced or CD83 CAR T cells after stimulation with CD83+ DCs.
  • 2D shows cytotoxicity of CD83 CAR T cells or mock transduced T cells co-cultured with CD83+ DCs, measured on a real-time cell analysis system. The data are presented as the average normalized cell index over time for duplicate wells. Normalized cell index is calculated as cell index at a given time point divided by cell index at the normalized time point which is day 1 after addition of T cells. 1 representative experiment of 2 shown, Dunnett's test.
  • FIG. 3 shows human CD83 chimeric antigen receptor T cells reduce alloreactivity.
  • Human T cells were cultured with allogeneic, cytokine matured, monocyte-derived dendritic cells (moDC) at a DC:T cell ratio of 1 :30 (ie 100,000 T cells and 3333 moDCs).
  • CD83 CAR T autologous to the cultured T cells
  • T cell proliferation was measured by Ki-67 expression at day +5.
  • CAR T were gated out by their expression of GFP. Controls included T cells alone (ie no proliferation), mock transduced T cells, and CD19 CAR T cells.
  • FIGs. 4Ato 4D show CD83 is differentially expressed on human activated conventional CD4+ T cells (Tcon) compared to regulatory T cells (Tregs).
  • Human T cells were stimulated by allogeneic moDCs (DC:T cell ration 1 :30) or CD3/CD28 beads (Bead:T cell ratio 1 :30).
  • CD83 expression on activated Tcon CD4+, CD127+, CD25+
  • Treg CD4+, CD127-, CD25+, Foxp3+
  • FIGs. 4A and 4B are representative contour plots showing CD83 expression among Tcon (FIG. 4A) and Treg (FIG. 4B) at various time points post stimulation.
  • FIGs. 4C and 4D are bar graphs showing the amount of CD83+ Tconv or Treg (mean ⁇ SEM) after allogeneic DC (FIG. 4C) or CD3/CD28 bead (FIG. 4D) stimulation.
  • FIGs. 5A and 5B show human CD83 CAR T cells prevents xenogeneic GVHD.
  • NSG mice received 25x10 6 human PBMCs and were inoculated with low (1x10°) or high dose (10x10 s ) CD83 CAR or mock transduced T cells. The CARs were autologous to the PBMC donor. An additional control group of mice received PBMCs alone.
  • FIGs 6Ato 6D show CD83 CAR T cells significantly reduce GVHD target- organ damage by human T cells.
  • NSG mice were transplanted with 25x10 6 human PBMCs plus 1x10 8 CD83 CAR or mock transduced T cells.
  • Control groups consisted of mice that received no PBMCs (negative control) and mice that received PBMCs without modified T cells (secondary positive control).
  • Recipient mice were humanely euthanized at day +21 and tissue GVHD severity was evaluated by an expert, blinded pathologist.
  • Xenogeneic GVHD path scores (FIGs. 6A , 6C) and
  • FIG 7 shows human CD83 CAR T cells reduce the expansion of donor cell expansion in vivo.
  • NSG mice were transplanted with 25x10 6 human PBMCs plus 1x10 6 CD83 CAR or mock transduced T cells.
  • Control groups consisted of mice that received no PBMCs (negative control) and mice that received PBMCs without modified T cells (secondary positive control).
  • Recipient mice were humanely euthanized at day +21 and their spleens were removed for gross assessment and flow cytometry studies.
  • a representative image shows mice that received PBMCs and CD83 CAR T cells exhibit reduced spleen size, supporting suppression of donor T cell expansion in vivo. 1 representative experiment of 2, up to 6 mice per experimental arm.
  • FIGs. 8 A to 8E show human CD83 CAR T cell significantly reduces circulating mature, CD83+ DCs in vivo. NSG mice received 25x10 6 human PBMCs plus 1x10 6 CD83 CAR or mock transduced T cells.
  • FIG. 8A contains representative contour plots showing the frequency of human CD83+, CD1c+ DCs in the mouse spleens at day +21.
  • FIG. 8B ⁇ is a bar graph showing the absolute number (mean ⁇ SEM) of human CD83+, CD1c+ DCs in the mouse spleens at day +21 , Dunnett's test.
  • FIG. 8C contains representative contour plots showing the percentage of MHC class II+, CD1c+ DCs in the recipient spleens at day +21.
  • FIG. 8D is a bar graph depicting the absolute number (mean ⁇ SEM) of these cells, Dunnett's test.
  • FIGs. 9 A to 9I show human CD83 CAR T cells significantly reduce pathogenic Th1 cells, and increase the Treg:Tconv ratio.
  • NSG mice received 25x10 8 human PBMCs plus 1x10 8 CD83 CAR or mock transduced T cells as described. On day +21 , the mice were humanely euthanized and the amount of donor, human T cells were enumerated and characterized.
  • FIG. 9A contains representative contour plots showing the frequency of human CD4+ T cells in the recipient spleens.
  • FIGs. ⁇ and 9C are bar graphs showing the absolute numbers (mean ⁇ SEM) of CD4+ (FIG. 9B) and CD8+ (FIG.
  • FIG. 9C T cells in the mouse spleens at day +21 , Dunnett's test.
  • FIG. 9D contains contour plots depict the percentage of CD4+, CD127-, CD25+, Foxp3+ Tregs in the mouse spleens at day +21.
  • FIGs. 9E and 9F are bar graphs showing the amount (mean ⁇ SEM) of Tregs (FIG. 9E) and the Treg:CD4+, CD25+ alloreactive Tconv (FIG. 9F) at day +21 in the recipient mice, Dunnett's test.
  • FIG. 9E is bar graphs showing the amount (mean ⁇ SEM) of Tregs (FIG. 9E) and the Treg:CD4+, CD25+ alloreactive Tconv (FIG. 9F) at day +21 in the recipient mice, Dunnett's test.
  • FIGs. 9G contains contour plots depicting the frequency of CD4+, IFNv+ Th1 cells and CD4+, IL-4+ Th2 cells in the mouse spleens at day +21.
  • FIG. 10 Human CD83 CAR T cells permit CTL-mediated anti-tumor immunity.
  • NSG mice received 25x10" human PBMCs plus 1x10 6 CD83 CAR or mock transduced T cells as described.
  • An inoculum of irradiated K562 cells (10 7 ) was given on days 0 and +7.
  • FIGs. 11 A and 11 B show CD83 expression among human CD8+ T cells after stimulation of allogeneic dendritic cells (FIG. 11 A) or CD3/CD28 beads (FIG. 11 B).
  • CAR chimeric antigen receptors
  • immune effector cells such as T cells or Natural Killer (NK) cells
  • NK Natural Killer
  • CAR T cells expressing these CARs can suppress alloreactive donor cells, such as T cells.
  • CD83-specific chimeric antigen receptors CAR
  • CARs generally incorporate an antigen recognition domain from the single- chain variable fragments (scFv) of a monoclonal antibody (mAb) with transmembrane signaling motifs involved in lymphocyte activation (Sadelain M, et al. Nat Rev Cancer 2003 3:35-45).
  • scFv single- chain variable fragments
  • mAb monoclonal antibody
  • CD83-specific chimeric antigen receptor CAR that can be that can be expressed in immune effector cells to suppress alloreactive donor cells.
  • the disclosed CAR is generally made up of three domains: an ectodomain, a transmembrane domain, and an endodomain.
  • the ectodomain comprises the CD83- binding region and is responsible for antigen recognition. It also optionally contains a signal peptide (SP) so that the CAR can be glycosylated and anchored in the cell membrane of the immune effector cell.
  • SP signal peptide
  • the transmembrane domain (TD) is as its name suggests, connects the ectodomain to the endodomain and resides within the cell membrane when expressed by a cell.
  • the endodomain is the business end of the CAR that transmits an activation signal to the immune effector cell after antigen recognition.
  • the endodomain can contain an intracellular signaling domain (ISD) and optionally a co-stimulatory signaling region (CSR).
  • ISD intracellular signaling domain
  • CSR co-stimulatory signaling region
  • a “signaling domain (SD) * generally contains immunoreceptortyrosine-based activation motifs (ITAMs) that activate a signaling cascade when the ITAM is phosphorylated.
  • ITAMs immunoreceptortyrosine-based activation motifs
  • CSR co-stimulatory signaling region
  • the endodomain contains an SD or a CSR, but not both.
  • an immune effector cell containing the disclosed CAR is only activated if another CAR (or a T-cell receptor) containing the missing domain also binds its respective antigen.
  • the disclosed CAR is defined by the formula:
  • SP represents an optional signal peptide
  • CD83 represents a CD83-binding region
  • HG represents an optional hinge domain
  • TM represents a transmembrane domain
  • CSR represents one or more co-stimulatory signaling regions
  • SD represents a signaling domain
  • the CAR can be a TRUCK, Universal CAR, Self-driving CAR,
  • CAR T cells engineered to be resistant to immunosuppression may be genetically modified to no longer express various immune checkpoint molecules (for example, cytotoxic T lymphocyte-associated antigen 4 (CTLA4) or programmed cell death protein 1 (PD1)), with an immune checkpoint switch receptor, or may be administered with a monoclonal antibody that blocks immune checkpoint signaling.
  • immune checkpoint molecules for example, cytotoxic T lymphocyte-associated antigen 4 (CTLA4) or programmed cell death protein 1 (PD1)
  • CTL4 cytotoxic T lymphocyte-associated antigen 4
  • PD1 programmed cell death protein 1
  • a self-destruct CAR may be designed using RNA delivered by electroporation to encode the CAR.
  • inducible apoptosis of the T cell may be achieved based on ganciclovir binding to thymidine kinase in gene-modified lymphocytes or the more recently described system of activation of human caspase 9 by a small- molecule dimerizer.
  • a conditional CAR T cell is by default unresponsive, or switched 'off, until the addition of a small molecule to complete the circuit, enabling full transduction of both signal 1 and signal 2, thereby activating the CAR T cell.
  • T cells may be engineered to express an adaptor-specific receptor with affinity for subsequently administered secondary antibodies directed at target antigen.
  • TanCAR T cell expresses a single CAR consisting of two linked single-chain variable fragments (scFvs) that have different affinities fused to intracellular co-stimulatory domain(s) and a CD3 ⁇ 4 domain. TanCAR T cell activation is achieved only when target cells co-express both targets.
  • scFvs linked single-chain variable fragments
  • a dual CAR T cell expresses two separate CARs with different ligand binding targets; one CAR includes only the CD3 ⁇ 4 domain and the other CAR includes only the co-stimulatory domain(s). Dual CAR T cell activation requires co-expression of both targets.
  • a safety CAR consists of an extracellular scFv fused to an intracellular inhibitory domain.
  • sCAR T cells co-expressing a standard CAR become activated only when encountering target cells that possess the standard CAR target but lack the sCAR target.
  • the antigen recognition domain of the disclosed CAR is usually an scFv.
  • An antigen recognition domain from native T- cell receptor (TCR) alpha and beta single chains have been described, as have simple ectodomains (e.g. CD4 ectodomain to recognize HIV infected cells) and more exotic recognition components such as a linked cytokine (which leads to recognition of cells bearing the cytokine receptor). In fact almost anything that binds a given target with high affinity can be used as an antigen recognition region.
  • the endodomain is the business end of the CAR that after antigen recognition transmits a signal to the immune effector cell, activating at least one of the normal effector functions of the immune effector cell.
  • Effector function of a T cell may be cytolytic activity or helper activity including the secretion of cytokines. Therefore, the endodomain may comprise the "intracellular signaling domain" of a T cell receptor (TCR) and optional co-receptors. While usually the entire intracellular signaling domain can be employed, in many cases it is not necessary to use the entire chain. To the extent that a truncated portion of the intracellular signaling domain is used, such truncated portion may be used in place of the intact chain as long as it transduces the effector function signal.
  • TCR T cell receptor
  • Cytoplasmic signaling sequences that regulate primary activation of the TCR complex that act in a stimulatory manner may contain signaling motifs which are known as immunoreceptortyrosine-based activation motifs (ITAMs).
  • ITAMs immunoreceptortyrosine-based activation motifs
  • Examples of ITAM containing cytoplasmic signaling sequences include those derived from CD8, CDZi, CD30, CD3Y, CD3E, CD32 (Fc gamma Rlla), DAP10, DAP12, CD79a, CD79b, FcyRlY, FcvRlllY, FceRIf (FCERIB), and FceRly (FCERIG).
  • the intracellular signaling domain is derived from CD3 zeta (CD3Q (TCR zeta, GenBank accno. BAG36664.1).
  • CD3Q TCR zeta, GenBank accno. BAG36664.1
  • T-cell surface glycoprotein CD3 zeta CD3Q chain, also known as T-cell receptor T3 zeta chain or CD247 (Cluster of Differentiation 247), is a protein that in humans is encoded by the CD247 gene.
  • First-generation CARs typically had the intracellular domain from the 003 ⁇ chain, which is the primary transmitter of signals from endogenous TCRs.
  • Second- generation CARs add intracellular signaling domains from various costimulatory protein receptors (e.g., CD28, 41 BB, ICOS) to the endodomain of the CAR to provide additional signals to the T cell.
  • costimulatory protein receptors e.g., CD28, 41 BB, ICOS
  • third-generation CARs combine multiple signaling domains to further augment potency.
  • T cells grafted with these CARs have demonstrated improved expansion, activation, persistence, and tumor-eradicating efficiency independent of costimulatory receptor/ligand interaction (Imai C, et al. Leukemia 2004 18:676-84; Maher J, et al. Nat Biotechnol 2002 20:70-5).
  • the endodomain of the CAR can be designed to comprise the CD3 ⁇ 4 signaling domain by itself or combined with any other desired cytoplasmic domain(s) useful in the context of the CAR of the invention.
  • the cytoplasmic domain of the CAR can comprise a ⁇ chain portion and a costimulatory signaling region.
  • the costimulatory signaling region refers to a portion of the CAR comprising the intracellular domain of a costimulatory molecule.
  • a costimulatory molecule is a cell surface molecule other than an antigen receptor or their ligands that is required for an efficient response of lymphocytes to an antigen.
  • Examples of such molecules include CD27, CD28, 4-1 BB (CD137), OX40, CD30, CD40, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, and a ligand that specifically binds with CD123, CD8, CD4, b2c, CD80, CD86, DAP10, DAP12, MyD88, BTNL3, and NKG2D.
  • CD28 CD28
  • 4-1 BB CD137
  • OX40 CD30
  • CD40 CD40
  • ICOS lymphocyte function-associated antigen-1
  • LFA-1 lymphocyte function-associated antigen-1
  • CD2 CD7
  • LIGHT lymphocyte function-associated antigen-1
  • NKG2C NKG2C
  • B7-H3 lymphocyte function-associated antigen-1
  • the CAR comprises a hinge sequence.
  • a hinge sequence is a short sequence of amino acids that facilitates antibody flexibility (see, e.g., Woof et al., Nat. Rev. Immunol., 4(2): 89-99 (2004)).
  • the hinge sequence may be positioned between the antigen recognition moiety (e.g., anti-CD83 scFv) and the transmembrane domain.
  • the hinge sequence can be any suitable sequence derived or obtained from any suitable molecule. In some embodiments, for example, the hinge sequence is derived from a CD8a molecule or a CD28 molecule.
  • the transmembrane domain may be derived either from a natural or from a synthetic source. Where the source is natural, the domain may be derived from any membrane-bound or transmembrane protein. For example, the transmembrane region may be derived from (i.e.
  • CD1 comprises at least the transmembrane region(s) of) the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8 (e.g., CD8 alpha, CD8 beta), CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, or CD154, KIRDS2, OX40, CD2, CD27, LFA-1 (CD11 a, CD18) , ICOS (CD278) , 4-1 BB (CD137) , GITR, CD40, BAFFR, HVEM (LIGHTR) , SLAMF7, NKp80 (KLRF1) , CD160, CD19, IL2R beta, IL2R gamma, IL7R a, ITGA1 , VLA1 , CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD
  • CD29 CD29, ITGB2, CD18, LFA-1 , ITGB7, TNFR2, DNAM1 (CD226) , SLAMF4 (CD244, 2B4) , CD84, CD96 (Tactile) , CEACAM1.
  • CRTAM Ly9 (CD229) , CD160 (BY55) , PSGL1 , CD 100 (SEMA4D) , SLAMF6 (NTE3-A, Ly108) , SLAM (SLAMF1 , CD150, IPO-3) , BLAME (SLAMF8) , SELPLG (CD162) , LTBR, and PAG/Cbp.
  • the transmembrane domain may be synthetic, in which case it will comprise predominantly hydrophobic residues such as leucine and valine. In some cases, a triplet of phenylalanine, tryptophan and valine will be found at each end of a synthetic transmembrane domain.
  • a short oligo- or polypeptide linker such as between 2 and 10 amino acids in length, may form the linkage between the transmembrane domain and the endoplasmic domain of the CAR.
  • the CAR has more than one transmembrane domain, which can be a repeat of the same transmembrane domain, or can be different transmembrane domains.
  • the CAR is a multi-chain CAR, as described in WO2015/039523, which is incorporated by reference for this teaching.
  • a multi-chain CAR can comprise separate extracellular ligand binding and signaling domains in different transmembrane polypeptides.
  • the signaling domains can be designed to assemble in juxtamembrane position, which forms flexible architecture closer to natural receptors, that confers optimal signal transduction.
  • the multichain CAR can comprise a part of an FCERI alpha chain and a part of an FCERI beta chain such that the FCERI chains spontaneously dimerize together to form a CAR.
  • Tables 1 , 2, and 3 below provide some example combinations of CD83- binding region, co-stimulatory signaling regions, and intracellular signaling domain that can occur in the disclosed CARs.
  • CD83 b2c FCYRI-Y CD83 DAP10 CD79a
  • CD83 CD286 FCYRIII-Y CD83 BTNL3 CD79b CD83 CD286 FCER ⁇ CD83 NKG2D CD8 CD83 CD286 FCERIY CD83 NKG2D 0 ⁇ 3 ⁇
  • CD83 CD28 CD137/41 BB CD32
  • CD83 CD28 OX40 CD32
  • CD83 CD28 NKG2D CD32
  • CD83 CD8 OX40 CD32
  • CD83 CD8 BTNL3 CD3Y

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Engineering & Computer Science (AREA)
  • Epidemiology (AREA)
  • Genetics & Genomics (AREA)
  • Medicinal Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Zoology (AREA)
  • Biomedical Technology (AREA)
  • Biochemistry (AREA)
  • Cell Biology (AREA)
  • Biotechnology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Wood Science & Technology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Microbiology (AREA)
  • Hematology (AREA)
  • Transplantation (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Toxicology (AREA)
  • General Engineering & Computer Science (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Mycology (AREA)
  • Virology (AREA)
  • Developmental Biology & Embryology (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
PCT/US2019/019065 2018-02-23 2019-02-22 Cd83-binding chimeric antigen receptors Ceased WO2019165156A1 (en)

Priority Applications (16)

Application Number Priority Date Filing Date Title
SG11202007755YA SG11202007755YA (en) 2018-02-23 2019-02-22 Cd83-binding chimeric antigen receptors
CA3092220A CA3092220C (en) 2018-02-23 2019-02-22 Cd83-binding chimeric antigen receptors
CN201980027877.0A CN112004832A (zh) 2018-02-23 2019-02-22 结合cd83的嵌合抗原受体
EP19757555.8A EP3755722A4 (en) 2018-02-23 2019-02-22 CD83 BINDING CHIMERA ANTIGEN RECEPTORS
US16/969,056 US12492254B2 (en) 2018-02-23 2019-02-22 CD83-binding chimeric antigen receptors
BR112020017015-1A BR112020017015A2 (pt) 2018-02-23 2019-02-22 Polipeptídeo de receptor de antígeno quimérico, sequência de ácidos nucleicos isolada, vetor, célula, e método para suprimir células de doador alorreativas em um sujeito querecebe células de doador de transplante
AU2019226101A AU2019226101A1 (en) 2018-02-23 2019-02-22 CD83-binding chimeric antigen receptors
KR1020207027148A KR20200130324A (ko) 2018-02-23 2019-02-22 Cd83-결합 키메라 항원 수용체
EA202092006A EA202092006A1 (ru) 2018-05-30 2019-02-22 Cd83-связывающие химерные антигенные рецепторы
JP2020543928A JP7358369B2 (ja) 2018-02-23 2019-02-22 Cd83結合キメラ抗原受容体
MX2020008803A MX2020008803A (es) 2018-02-23 2019-02-22 Receptores de antígenos quiméricos que se unen a cd83.
US16/717,537 US20200108098A1 (en) 2018-02-23 2019-12-17 Anti-cd83 chimeric antigen receptor expressing t regulatory cells
PH12020500632A PH12020500632A1 (en) 2018-02-23 2020-08-19 Cd83-binding chimerix antigen receptors
IL276836A IL276836A (en) 2018-02-23 2020-08-20 Cd83-binding chimeric antigen receptors
ZA2020/05837A ZA202005837B (en) 2018-02-23 2020-09-21 Cd83-binding chimeric antigen receptors
US18/478,247 US20240197779A1 (en) 2018-02-23 2023-09-29 Anti-cd83 chimeric antigen receptor expressing t regulatory cells

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201862634435P 2018-02-23 2018-02-23
US62/634,435 2018-02-23
US201862677783P 2018-05-30 2018-05-30
US62/677,783 2018-05-30

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US16/717,537 Continuation-In-Part US20200108098A1 (en) 2018-02-23 2019-12-17 Anti-cd83 chimeric antigen receptor expressing t regulatory cells

Publications (1)

Publication Number Publication Date
WO2019165156A1 true WO2019165156A1 (en) 2019-08-29

Family

ID=67686942

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2019/019065 Ceased WO2019165156A1 (en) 2018-02-23 2019-02-22 Cd83-binding chimeric antigen receptors

Country Status (14)

Country Link
US (1) US12492254B2 (cg-RX-API-DMAC7.html)
EP (1) EP3755722A4 (cg-RX-API-DMAC7.html)
JP (1) JP7358369B2 (cg-RX-API-DMAC7.html)
KR (1) KR20200130324A (cg-RX-API-DMAC7.html)
CN (1) CN112004832A (cg-RX-API-DMAC7.html)
AU (1) AU2019226101A1 (cg-RX-API-DMAC7.html)
BR (1) BR112020017015A2 (cg-RX-API-DMAC7.html)
IL (1) IL276836A (cg-RX-API-DMAC7.html)
MA (1) MA51917A (cg-RX-API-DMAC7.html)
MX (1) MX2020008803A (cg-RX-API-DMAC7.html)
PH (1) PH12020500632A1 (cg-RX-API-DMAC7.html)
SG (1) SG11202007755YA (cg-RX-API-DMAC7.html)
WO (1) WO2019165156A1 (cg-RX-API-DMAC7.html)
ZA (1) ZA202005837B (cg-RX-API-DMAC7.html)

Cited By (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2021034689A1 (en) * 2019-08-16 2021-02-25 H. Lee Moffitt Cancer Center And Research Institute Inc. Anti-cd83 chimeric antigen receptor expressing t regulatory cells
US20210095036A1 (en) * 2019-09-30 2021-04-01 The Trustees Of The University Of Pennsylvania Humanized Anti-GDNF family alpha-receptor 4 (GRF-alpha-4) Antibodies and Chimeric Antigen Receptors (CARs)
WO2021150970A1 (en) * 2020-01-22 2021-07-29 H. Lee Moffitt Cancer Center And Research Institute, Inc. Bi-specific chimeric antigen receptor t cells targeting cd83 and interleukin 6 receptor
WO2021127212A3 (en) * 2019-12-18 2021-07-29 H. Lee Moffitt Cancer Center And Research Institute Inc. Systems and methods for producing efficacious regulatory t cells
WO2021168421A1 (en) * 2020-02-20 2021-08-26 H. Lee Moffitt Cancer Center And Research Institute, Inc. Method of enhancing immunotherapy using er stress pathway inhibitors
WO2022036224A1 (en) * 2020-08-14 2022-02-17 H. Lee Moffitt Cancer Center And Research Institute Inc. Chimeric antigen receptor t cells for treating autoimmunity
EP4013515A4 (en) * 2019-08-16 2023-09-27 H. Lee Moffitt Cancer Center & Research Institute, Inc. Chimeric antigen receptors for treating myeloid malignancies
US20240173411A1 (en) * 2021-02-25 2024-05-30 H. Lee Moffitt Cancer Center And Research Institute, Inc. Methods for treating cd83-expressing cancer
US12492254B2 (en) 2018-02-23 2025-12-09 H. Lee Moffitt Cancer Center and Research Intitute. Inc. CD83-binding chimeric antigen receptors

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN119331093B (zh) * 2024-11-04 2025-07-11 武汉伊莱瑞特生物科技股份有限公司 一种抗CD30的兔源Fab抗体及其制备方法和应用

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20140286950A1 (en) * 2011-07-01 2014-09-25 Genentech, Inc. Use of anti-cd83 agonist antibodies for treating autoimmune diseases
US20150376277A1 (en) * 2013-02-01 2015-12-31 The Regents Of The University Of California Anti-cd83 antibodies and use thereof
WO2016210293A1 (en) * 2015-06-25 2016-12-29 Icell Gene Therapeutics Llc CHIMERIC ANTIGEN RECEPTORS (CARs), COMPOSITIONS AND METHODS OF USE THEREOF
WO2017149515A1 (en) * 2016-03-04 2017-09-08 Novartis Ag Cells expressing multiple chimeric antigen receptor (car) molecules and uses therefore
US20170258835A1 (en) * 2014-10-31 2017-09-14 The Trustees Of The University Of Pennsylvania Methods and compositions for modified t cells

Family Cites Families (27)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20040185040A1 (en) 2001-11-21 2004-09-23 Celltech R & D Limited Modulating immune responses
EP1572976B1 (en) 2002-11-21 2010-09-15 Celltech R & D, Inc. Modulating immune responses
GB0624500D0 (en) 2006-12-07 2007-01-17 Istituto Superiore Di Sanito A novel passive vaccine for candida infections
US9228172B2 (en) 2008-06-19 2016-01-05 The Trustees Of The University Of Pennsylvania Inducible regulatory T-cell generation for hematopoietic transplants
CA2823782C (en) 2011-01-10 2019-05-07 Samuel Strober Enhancement of allogeneic hematopoietic stem cell transplantation
JP2013150592A (ja) 2011-07-01 2013-08-08 Genentech Inc 自己免疫疾患を治療するための抗cd83アゴニスト抗体の使用
US9422549B2 (en) 2013-02-26 2016-08-23 Axiomx, Inc. Methods for the production of libraries for directed evolution
AU2014318247B2 (en) 2013-09-13 2018-05-24 Michael Abrams Novel peptides and analogs for use in the treatment of oral mucositis
EP3209695A4 (en) 2014-10-23 2018-05-30 DendroCyte BioTech Pty Ltd Cd83 binding proteins and uses thereof
CA2874083C (en) 2014-12-05 2024-01-02 Universite Laval Tdp-43-binding polypeptides useful for the treatment of neurodegenerative diseases
WO2016126608A1 (en) * 2015-02-02 2016-08-11 Novartis Ag Car-expressing cells against multiple tumor antigens and uses thereof
JP6961490B2 (ja) 2015-04-08 2021-11-05 ノバルティス アーゲー Cd20療法、cd22療法、およびcd19キメラ抗原受容体(car)発現細胞との併用療法
AU2016274989A1 (en) 2015-06-12 2017-11-02 Immunomedics, Inc. Disease therapy with chimeric antigen receptor (car) constructs and t cells (car-t) or nk cells (car-nk) expressing car constructs
JP2019535262A (ja) 2016-11-11 2019-12-12 オートラス リミテッド キメラ抗原受容体
KR20200066613A (ko) 2017-09-13 2020-06-10 키라 바이오테크 피티와이 리미티드 치료 방법
KR20260026092A (ko) 2017-09-19 2026-02-25 메사추세츠 인스티튜트 오브 테크놀로지 키메라 항원 수용체 t 세포 요법을 위한 조성물 및 그의 용도
CN111787938A (zh) 2017-11-15 2020-10-16 诺华股份有限公司 靶向bcma的嵌合抗原受体、靶向cd19的嵌合抗原受体及组合疗法
WO2019136335A1 (en) 2018-01-05 2019-07-11 Gencyte Therapeutics, Inc. Precision molecular adaptor system for car-t immunotherapy
EP3749334B1 (en) 2018-02-08 2024-12-11 The Board of Trustees of the Leland Stanford Junior University Allogenic hematopoietic stem cell transplantation
WO2019165156A1 (en) 2018-02-23 2019-08-29 H. Lee Moffitt Cancer Center And Research Institute Inc. Cd83-binding chimeric antigen receptors
US20200108098A1 (en) 2018-02-23 2020-04-09 H. Lee Moffitt Cancer Center And Research Institute, Inc. Anti-cd83 chimeric antigen receptor expressing t regulatory cells
US20200268797A1 (en) 2018-11-30 2020-08-27 Janssen Biotech, Inc. Gamma delta t cells and uses thereof
AU2020333659A1 (en) 2019-08-16 2022-02-24 H. Lee Moffitt Cancer Center And Research Institute Inc. Anti-CD83 chimeric antigen receptor expressing t regulatory cells
US20230051885A1 (en) 2019-12-18 2023-02-16 H. Lee Moffitt Cancer Center And Research Institute Inc. Systems and Methods for Producing Efficacious Regulatory T Cells
US20230390391A1 (en) 2020-01-22 2023-12-07 Regents Of The University Of Minnesota Bi-specific chimeric antigen receptor t cells targeting cd83 and interleukin 6 receptor
WO2023122643A1 (en) 2021-12-22 2023-06-29 Regents Of The University Of Minnesota Cd83 and allo- and autoimmune conditions
JP2024102735A (ja) 2023-01-19 2024-07-31 セイコーエプソン株式会社 頭部装着型表示装置及び光学ユニット

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20140286950A1 (en) * 2011-07-01 2014-09-25 Genentech, Inc. Use of anti-cd83 agonist antibodies for treating autoimmune diseases
US20150376277A1 (en) * 2013-02-01 2015-12-31 The Regents Of The University Of California Anti-cd83 antibodies and use thereof
US20170258835A1 (en) * 2014-10-31 2017-09-14 The Trustees Of The University Of Pennsylvania Methods and compositions for modified t cells
WO2016210293A1 (en) * 2015-06-25 2016-12-29 Icell Gene Therapeutics Llc CHIMERIC ANTIGEN RECEPTORS (CARs), COMPOSITIONS AND METHODS OF USE THEREOF
WO2017149515A1 (en) * 2016-03-04 2017-09-08 Novartis Ag Cells expressing multiple chimeric antigen receptor (car) molecules and uses therefore

Cited By (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12492254B2 (en) 2018-02-23 2025-12-09 H. Lee Moffitt Cancer Center and Research Intitute. Inc. CD83-binding chimeric antigen receptors
WO2021034689A1 (en) * 2019-08-16 2021-02-25 H. Lee Moffitt Cancer Center And Research Institute Inc. Anti-cd83 chimeric antigen receptor expressing t regulatory cells
EP4013515A4 (en) * 2019-08-16 2023-09-27 H. Lee Moffitt Cancer Center & Research Institute, Inc. Chimeric antigen receptors for treating myeloid malignancies
US20210095036A1 (en) * 2019-09-30 2021-04-01 The Trustees Of The University Of Pennsylvania Humanized Anti-GDNF family alpha-receptor 4 (GRF-alpha-4) Antibodies and Chimeric Antigen Receptors (CARs)
US11802159B2 (en) * 2019-09-30 2023-10-31 The Trustees Of The University Of Pennsylvania Humanized anti-GDNF family alpha-receptor 4 (GRF-alpha-4) antibodies and chimeric antigen receptors (CARs)
US12281167B2 (en) 2019-09-30 2025-04-22 The Trustees Of The University Of Pennsylvania Humanized anti-GDNF family alpha-receptor 4 (GRF-alpha-4) antibodies and chimeric antigen receptors (CARs)
WO2021127212A3 (en) * 2019-12-18 2021-07-29 H. Lee Moffitt Cancer Center And Research Institute Inc. Systems and methods for producing efficacious regulatory t cells
WO2021150970A1 (en) * 2020-01-22 2021-07-29 H. Lee Moffitt Cancer Center And Research Institute, Inc. Bi-specific chimeric antigen receptor t cells targeting cd83 and interleukin 6 receptor
WO2021168421A1 (en) * 2020-02-20 2021-08-26 H. Lee Moffitt Cancer Center And Research Institute, Inc. Method of enhancing immunotherapy using er stress pathway inhibitors
WO2022036224A1 (en) * 2020-08-14 2022-02-17 H. Lee Moffitt Cancer Center And Research Institute Inc. Chimeric antigen receptor t cells for treating autoimmunity
US20240173411A1 (en) * 2021-02-25 2024-05-30 H. Lee Moffitt Cancer Center And Research Institute, Inc. Methods for treating cd83-expressing cancer

Also Published As

Publication number Publication date
EP3755722A4 (en) 2021-11-24
JP7358369B2 (ja) 2023-10-10
PH12020500632A1 (en) 2021-05-10
US20210032336A1 (en) 2021-02-04
MX2020008803A (es) 2021-01-15
CA3092220A1 (en) 2019-08-29
SG11202007755YA (en) 2020-09-29
JP2021513857A (ja) 2021-06-03
IL276836A (en) 2020-10-29
AU2019226101A1 (en) 2020-09-17
CN112004832A (zh) 2020-11-27
EP3755722A1 (en) 2020-12-30
KR20200130324A (ko) 2020-11-18
MA51917A (fr) 2021-06-02
ZA202005837B (en) 2023-02-22
BR112020017015A2 (pt) 2020-12-15
US12492254B2 (en) 2025-12-09

Similar Documents

Publication Publication Date Title
US12492254B2 (en) CD83-binding chimeric antigen receptors
US20240197779A1 (en) Anti-cd83 chimeric antigen receptor expressing t regulatory cells
US20230203168A1 (en) Dual EGFR-MUC1 Chimeric Antigen Receptor T Cells
JP2025083396A (ja) 骨髄性悪性腫瘍を処置するためのキメラ抗原受容体
US20230390391A1 (en) Bi-specific chimeric antigen receptor t cells targeting cd83 and interleukin 6 receptor
WO2022036224A1 (en) Chimeric antigen receptor t cells for treating autoimmunity
US20220289862A1 (en) Anti-cd83 chimeric antigen receptor expressing t regulatory cells
US20240252636A1 (en) Dual egfr-muci chimeric cantigen receptor t cells
US20240173411A1 (en) Methods for treating cd83-expressing cancer
CA3092220C (en) Cd83-binding chimeric antigen receptors
US20240269284A1 (en) Methods of using anti-cd83 chimeric antigen receptor expressing t cells
US20250241952A1 (en) Cd83 dual car t cells
US20230010255A1 (en) Car t cells that target aspergillus-associated antigens
WO2026011052A1 (en) Car-t cell therapy for triple negative breast cancer

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 19757555

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2020543928

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 3092220

Country of ref document: CA

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2019226101

Country of ref document: AU

Date of ref document: 20190222

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: NC2020/0011527

Country of ref document: CO

ENP Entry into the national phase

Ref document number: 20207027148

Country of ref document: KR

Kind code of ref document: A

WWP Wipo information: published in national office

Ref document number: NC2020/0011527

Country of ref document: CO

ENP Entry into the national phase

Ref document number: 2019757555

Country of ref document: EP

Effective date: 20200923

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112020017015

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112020017015

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20200820

WWW Wipo information: withdrawn in national office

Ref document number: 276836

Country of ref document: IL

WWG Wipo information: grant in national office

Ref document number: 16969056

Country of ref document: US