WO2019140229A1 - Antibodies against tim3 and uses thereof - Google Patents
Antibodies against tim3 and uses thereof Download PDFInfo
- Publication number
- WO2019140229A1 WO2019140229A1 PCT/US2019/013246 US2019013246W WO2019140229A1 WO 2019140229 A1 WO2019140229 A1 WO 2019140229A1 US 2019013246 W US2019013246 W US 2019013246W WO 2019140229 A1 WO2019140229 A1 WO 2019140229A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- antibody
- light chain
- nos
- tim3
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6854—Immunoglobulins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
- A61K2039/507—Comprising a combination of two or more separate antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/74—Inducing cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/705—Assays involving receptors, cell surface antigens or cell surface determinants
- G01N2333/70503—Immunoglobulin superfamily, e.g. VCAMs, PECAM, LFA-3
Definitions
- T-cell immunoglobulin and mucin-domain containing-3 (TIM3), also known as hepatitis A vims cellular receptor 2 (HAVCR2), is a type-I transmembrane protein that functions as a key regulator of immune responses.
- TIM3 was initially identified on activated IFN-g producing T cells (e.g., type 1 helper CD4 + T cells and cytotoxic CD8 + T cells) and shown to induce T cell death or exhaustion after binding to galectin-9. More recent studies have indicated that TIM3 expression is also important in regulating the activities of many innate immune cells (e.g., macrophages, monocytes, dendritic cells, mast cells, and natural killer cells). See Han G et al., Front Immunol. 4: 449 (2013).
- innate immune cells e.g., macrophages, monocytes, dendritic cells, mast cells, and natural killer cells.
- TIM3 expression has been associated with many types of chronic diseases, including cancer.
- TIM3 + T cells have been detected in patients with advanced melanoma, non-small cell lung cancer, or follicular B-cell non-Hodgkin lymphoma. And the presence of TIM3 + regulatory T cells have been described as an effective indicator of lung cancer progression. See Anderson AC. Cancer Immunol Res. 2: 393-8 (2014).
- PS phosphatidylserine
- TIM3 Galectin-9, HMGB1, Semaphorin-4A, CEACAM-1, ILT-4 and phosphatidylserine (PtdSer or PS).
- PS is an important cell membrane component, and is normally localized to the inner leaflet of cell membranes. But as a cell undergoes apoptosis, PS is redistributed and exposed to the outer membrane. This redistribution is also observed in many tumor cell lines. See Riedl S et al. , Biochim Biophys Acta. 1808: 2638-2645 (2011). Binding of TIM3 to PS may be critical for phagocytosis and cross-presentation. See Nakayama M et al.. Blood. 113 : 3821-30 (2009).
- TIM3 the inhibitory receptor PD-1.
- many tumor-specific T cells express both PD-1 and TIM3, and these T cells have been shown to be more dysfunctional compared to T cells that express only PD-1 or TIM3. See Fourcade J et al. , J Exp Med. 207 : 2175-2186 (2010).
- agents that target TIM3, and methods of using such agents are highly desirable for designing new cancer immunotherapies and improving traditional cancer immunotherapies.
- isolated antibodies such as monoclonal antibodies, or antigen binding portion thereof, in particular human (e.g., monoclonal) antibodies, which bind specifically to human T-cell immunoglobulin and mucin-domain containing-3 (TIM3) ("anti-TIM3 antibody”) and comprise a heavy chain CDR1, CDR2, and CDR3 and a light chain CDR1, CDR2, and CDR3.
- the heavy chain CDR3 comprises SEQ ID NO: 414 or SEQ ID NO: 416.
- the heavy chain CDR1 comprises SEQ ID NO: 45.
- the heavy chain CDR2 comprises SEQ ID NO: 413 or SEQ ID NO: 415.
- the light chain CDR1 comprises SEQ ID NO: 64.
- the light chain CDR2 comprises SEQ ID NO: 66.
- the light chain CDR3 comprises SEQ ID NO: 69, SEQ ID NO: 68, or SEQ ID NO: 419.
- the anti-TIM3 antibody, or antigen binding portion thereof comprises a heavy chain CDR1, CDR2, and CDR3 and a light chain CDR1, CDR2, and CDR3, wherein:
- the heavy chain CDR1 comprises SEQ ID NO: 45;
- the heavy chain CDR2 comprises SEQ ID NO: 413 or SEQ ID NO: 415;
- the heavy chain CDR3 comprises SEQ ID NO: 414 or SEQ ID NO: 416;
- the light chain CDR1 comprises SEQ ID NO: 64;
- the light chain CDR2 comprises SEQ ID NO: 66;
- the light chain CDR3 comprises SEQ ID NO: 69, SEQ ID NO: 68, or SEQ ID NO: 419.
- the heavy chain CDR1, CDR2, and CDR3 comprise SEQ ID NOs: 45, 413, and 414, respectively, and the light chain CDR1, CDR2, and CDR3 comprise SEQ ID NOs: 64, 66, and 69, respectively;
- the heavy chain CDR1, CDR2, and CDR3 comprise SEQ ID NOs: 45, 415, and 416, respectively, and the light chain CDR1, CDR2, and CDR3 comprise SEQ ID NOs: 64, 66, and 68, respectively;
- the heavy chain CDR1, CDR2, and CDR3 comprise SEQ ID NOs: 45, 415, and 416, respectively, and the light chain CDR1, CDR2, and CDR3 comprise SEQ ID NOs: 64, 66, and 419, respectively.
- the heavy chain CDR1, CDR2, and CDR3 comprise SEQ ID NOs: 45, 413, and 414, respectively, and the light chain CDR1, CDR2, and CDR3 comprise SEQ ID NOs: 64, 66, and 69, respectively.
- the heavy chain CDR1, CDR2, and CDR3 comprise SEQ ID NOs: 45, 415, and 416, respectively, and the light chain CDR1, CDR2, and CDR3 comprise SEQ ID NOs: 64, 66, and 68, respectively.
- the heavy chain CDR1, CDR2, and CDR3 comprise SEQ ID NOs: 45, 415, and 416, respectively, and the light chain CDR1, CDR2, and CDR3 comprise SEQ ID NOs: 64, 66, and 419, respectively.
- the anti-TIM3 antibody, or antigen binding portion thereof comprises a heavy chain variable region (VH) and a light chain variable region (VL), wherein the VH comprises an amino acid sequence which is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to the amino acid sequence set forth as SEQ ID NO: 410.
- the anti-TIM3 antibody, or antigen binding portion thereof comprises a heavy chain variable region (VH) and a light chain variable region (VL), wherein the VL comprises an amino acid sequence which is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to the amino acid sequence set forth as SEQ ID NO: 411.
- the anti-TIM3 antibody, or antigen binding portion thereof comprises a heavy chain variable region (VH) and a light chain variable region (VL), wherein the VL comprises an amino acid sequence which is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to the amino acid sequence set forth as SEQ ID NO: 412.
- the anti-TIM3 antibody, or antigen binding portion thereof cross-competes for binding to TIM3 with a reference antibody comprising:
- VH heavy chain variable region
- VL light chain variable region
- VH heavy chain variable region
- VL light chain variable region
- VH heavy chain variable region
- VL light chain variable region
- VH heavy chain variable region
- VL light chain variable region
- the anti-TIM3 antibody, or antigen binding portion thereof comprises:
- VH heavy chain variable region
- VL light chain variable region
- VH heavy chain variable region
- VL light chain variable region
- VH heavy chain variable region
- VL light chain variable region
- the anti-TIM3 antibody, or antigen binding portion thereof binds to the same epitope as a reference antibody, as determined by HDX, comprising:
- VH heavy chain variable region
- VL light chain variable region
- VH heavy chain variable region
- VL light chain variable region
- VH heavy chain variable region
- VL light chain variable region
- VH heavy chain variable region
- VL light chain variable region
- the anti-TIM3 antibody, or antigen binding portion thereof comprises:
- VH heavy chain variable region
- VL light chain variable region
- a heavy chain CDR1, CDR2, and CDR3 of a heavy chain variable region (VH) comprising SEQ ID NO: 411 and a light chain CDR1, CDR2, and CDR3 of a light chain variable region (VL) comprising SEQ ID NO: 60;
- a heavy chain CDR1, CDR2, and CDR3 of a heavy chain variable region (VH) comprising SEQ ID NO: 411 and a light chain CDR1, CDR2, and CDR3 of a light chain variable region (VL) comprising SEQ ID NO: 418;
- VH heavy chain variable region
- VL light chain variable region
- the anti-TIM3 antibody, or antigen binding portion thereof comprises a VH and a VL, wherein the VH comprises SEQ ID NO: 410 and the VL comprises SEQ ID NO: 417.
- the VH comprises SEQ ID NO: 411 and the VL comprises SEQ ID NO: 60.
- the VH comprises SEQ ID NO: 411 and the VL comprises SEQ ID NO: 418.
- the VH comprises SEQ ID NO: 412 and the VL comprises SEQ ID NO: 60.
- the anti-TIM3 antibody disclosed herein comprises a heavy chain CDR1, CDR2, and CDR3 and a light chain CDR1, CDR2, and CDR3, wherein: (a) the heavy chain CDR1 comprises SEQ ID NO: 469; (b) the heavy chain CDR2 comprises SEQ ID NO: 470; and (c) the heavy chain CDR3 comprises SEQ ID NO: 471.
- the light chain CDR1 comprises SEQ ID NO: 472; (b) the light chain CDR2 comprises SEQ ID NO: 473; and (c) the light chain CDR3 comprises SEQ ID NO: 474.
- the anti-TIM3 antibody comprises a heavy chain variable region (VH) and a light chain variable region (VL), wherein: (a) the VH comprises SEQ ID NO: 449 or SEQ ID NO: 456; and (b) the VL comprises SEQ ID NO: 450.
- the anti-TIM3 antibody, or antigen binding portion thereof is selected from the group consisting of an IgGl, an IgG2, an IgG3, an IgG4, and a variant thereof.
- the anti-TIM3 antibody, or antigen binding portion thereof is an IgGl antibody.
- the anti- TIM3 antibody, or antigen binding portion thereof comprises an effectorless IgGl Fc.
- the anti-TIM3 antibody, or antigen binding portion thereof comprises (al) heavy and light chain sequences comprising SEQ ID NOs: 386 (or 387) and 408, respectively;
- the anti-TIM3 antibody, or antigen binding portion thereof has one or more of the following properties:
- T cell activation e.g., by blocking or reducing the inhibitory effect of TIM3
- TIM3 -expressing T cells e.g., Thl cells or TILs
- VH and VL comprising a VH and VL of any one of 14H7, 23B3, 13A3, TIM3.7, TIM3.10, TIM3.11, TIM3.12, TIM3.13, TIM3.14, TIM3.15, TIM3.16, TIM3.17, TIM3.18, TIM3.20, TIM3.21, TIM3.22, TIM3.23, TIM3.24, TIM3.25, 17C3, 9F6, TIM3.7, 3G4, and 17C8.
- the anti-TIM3 antibody comprises: (i) VH CDR1, CDR2 and CDR3 comprising SEQ ID NOs: 45, 415 and 416, respectively, and VL CDR1, CDR2 and CDR3 comprising SEQ ID NOs: 64, 66 and 68, respectively; or (ii) VH comprising SEQ ID NO: 412 and VL comprising SEQ IDNO: 60; wherein the antibody binds to human TIM3-IgV with a KD of 5xl0 9 M or less; binds to cyno TIM3-IgV with a KD of 10 7 M or less; and/or binds to cyno TIM3-ECD with a KD of 5xlO 6 M or less.
- the anti-TIM3 antibody comprises: (i) VH CDR1, CDR2 and CDR3 comprising SEQ ID NOs: 45, 413 and 414, respectively, and VL CDR1, CDR2 and CDR3 comprising SEQ ID NOs: 64, 66 and 69, respectively; or (ii) VH comprising SEQ ID NO: 410 and VL comprising SEQ IDNO: 417; wherein the antibody binds to human TIM3-IgV with a KD of 5xl0 8 M or less; binds to cyno TIM3-IgV with a KD of 5xl0 9 M or less; and/or binds to cyno TIM3-ECD with a KD of 5xlO 9 M or less.
- the heavy chain of the anti-TIM3 antibody disclosed herein comprises a C- terminal lysine. In other embodiments, the heavy chain of the anti-TIM3 antibody does not comprise a C- terminal lysine.
- bispecific molecules comprising an anti-TIM3 antibody, or antigen binding portion thereof, of the present disclosure linked to a molecule having a second binding specificity.
- nucleic acids encoding the VH and/or VL of the anti-TIM3 antibody, or antigen binding portion thereof, expression vectors comprising the nucleic acids, and cells transformed with the expression vectors.
- immunoconjugates comprising the anti-TIM3 antibody, or antigen binding portion thereof, described herein, linked to an agent.
- compositions comprising anti-TIM3 antibodies, or antigen binding portions thereof, bispecific molecules, or immunoconjugates described herein, and a carrier.
- kits comprising the anti-TIM3 antibodies, or antigen binding portions thereof, bispecific molecules, or immunoconjugates described herein, and instructions for use.
- an anti-TIM3 antibodies, or antigen binding portions thereof comprising expressing an anti-TIM3 antibody, or antigen binding portion thereof, in a cell and isolating the antibody, or antigen binding portion thereof, from the cell.
- a method of stimulating an antigen-specific T cell response comprising contacting the T cell with an anti-TIM3 antibody, or antigen binding portion thereof, bispecific molecule, or immunoconjugate described herein such that an antigen-specific T cell response is stimulated (e.g., by inhibiting the negative effect of TIM3 on cells, e.g., T cells).
- a method of activating or co-stimulating a T cell comprising contacting a cell, e.g., an effector T cell, with an anti-TIM3 antibody, or antigen binding portion thereof, bispecific molecule, or immunoconjugate described herein, and CD3, wherein the effector T cell is activated or co-stimulated (e.g., by inhibiting the negative effect of TIM3 on cells, e.g., T cells).
- a method of increasing IFN-g production in and/or proliferation of a T cell comprising contacting the T cell with an effective amount of an anti-TIM3 antibody, or antigen binding portion thereof, bispecific molecule, or immunoconjugate described herein.
- a method of increasing IFN-g production in T cells in a subject comprising administering to the subject an effective amount of an anti-TIM3 antibody, or antigen binding portion thereof, bispecific molecule, or immunoconjugate described herein to increase IFN-g production from the T cells.
- a method of stimulating TIL activity in a subject comprising administering to the subject a therapeutically effective amount of an anti-TIM3 antibody, or antigen binding portion thereof, described herein, such that the TILs proliferate or secrete a cytokine, e.g., IFN-g.
- a cytokine e.g., IFN-g.
- a method for stimulating NK cells e.g., by increasing NK cell cytotoxic activity
- macrophages or other antigen presenting cell in a subject comprising administering to the subject an effective amount of an anti-TIM3 antibody, or antigen binding portion thereof, bispecific molecule, or immunoconjugate described herein.
- an anti-TIM3 antibody described herein can increase IL-12 secretion by antigen presenting cells contacted with the TIM3 antibody.
- a method of stimulating an immune response in a subject comprising administering to the subject an anti-TIM3 antibody, or antigen binding portion thereof, bispecific molecule, or immunoconjugate described herein, such that an immune response in the subject is stimulated.
- the subject has a tumor and an immune response against the tumor is stimulated.
- a method for inhibiting the growth of tumors or reducing the size of tumors in a subject comprising administering to the subject an anti-TIM3 antibody, or antigen binding portion thereof, bispecific molecule, or immunoconjugate described herein, such that growth of the tumor is inhibited in the subject.
- a method of treating cancer e.g. , by immunotherapy, comprising administering to a subject in need thereof a therapeutically effective amount of an anti-TIM3 antibody, or antigen binding portion thereof, bispecific molecule, or immunoconjugate described herein to treat the cancer.
- the cancer is selected from the group consisting of: bladder cancer, breast cancer, uterine/cervical cancer, ovarian cancer, prostate cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, pancreatic cancer, colorectal cancer, colon cancer, kidney cancer, head and neck cancer, lung cancer, stomach cancer, germ cell cancer, bone cancer, liver cancer, thyroid cancer, skin cancer, neoplasm of the central nervous system, lymphoma, leukemia, myeloma, sarcoma, virus-related cancer, and any combinations thereof.
- the cancer is a metastatic cancer, refractory cancer, or recurrent cancer.
- the cancer is a cold tumor.
- the methods described herein further comprise administering one or more additional therapeutics with an anti-TIM3 antibody, e.g., an anti-PD-1 antibody, an anti-LAG-3 antibody, an anti-CTLA-4 antibody, an anti-GITR antibody, and/or an anti-PD-Ll antibody.
- an anti-TIM3 antibody e.g., an anti-PD-1 antibody, an anti-LAG-3 antibody, an anti-CTLA-4 antibody, an anti-GITR antibody, and/or an anti-PD-Ll antibody.
- a method of detecting the presence of a TIM3 protein in a sample comprising contacting the sample with an anti-TIM3 antibody, or antigen binding portion thereof, under conditions that allow for formation of a complex between the antibody, or antigen binding portion thereof, and TIM3, and detecting the formation of a complex.
- Embodiment 1 An isolated antibody (e.g., a human antibody), or antigen binding portion thereof, which binds to human T-cell immunoglobulin and mucin-domain containing-3 (TIM3) and exhibits the following properties:
- Embodiment 2 The antibody, or antigen binding portion thereof, of Embodiment 1, wherein the antibody stimulates an anti-tumor immune response.
- Embodiment 3 The antibody, or antigen binding portion thereof, of Embodiment 1 or 2, wherein the antibody stimulates an antigen-specific T cell response.
- Embodiment 4 The antibody, or antigen binding portion thereof, of any one of the preceding Embodiments, wherein the antibody increases IFN-g production in TIM3-expressing T cells.
- Embodiment 5 The antibody, or antigen binding portion thereof, of any one of the preceding Embodiments, wherein the antibody increases T cell proliferation.
- Embodiment 6 The antibody, or antigen binding portion thereof, of any one of the preceding Embodiments, wherein the antibody does not bind to Fc receptors, or wherein the antibody lacks effector function.
- Embodiment 7 The antibody, or antigen binding portion thereof, of any one of the preceding Embodiments, wherein the antibody binds to soluble human TIM3 with a K D of 10 nM or less as measured by Biacore.
- Embodiment 8 The antibody, or antigen binding portion thereof, of any one of the preceding Embodiments, wherein the antibody binds to soluble cynomolgus TIM3 with a K D of 100 nM or less as measured by Biacore.
- Embodiment 9 The antibody, or antigen binding fragment thereof, of any one of the preceding Embodiments, wherein the antibody is an antagonist antibody that inhibits negative cell (e.g., T cell) signaling by TIM3.
- the antibody is an antagonist antibody that inhibits negative cell (e.g., T cell) signaling by TIM3.
- Embodiment 10 The antibody, or antigen binding portion thereof, of any one of the preceding Embodiments, wherein the antibody binds to membrane bound human TIM3 with an EC 50 of 0.1 or 1 pg/mL or less as measured by flow cytometry.
- Embodiment 11 The antibody, or antigen binding portion thereof, of any one of the preceding Embodiments, wherein the antibody binds to membrane bound human TIM3 with K D of 1 nM or less as measured by Scatchard analysis.
- Embodiment 12 The antibody, or antigen binding portion thereof, of any one of the preceding Embodiments, wherein the antibody binds to membrane bound cynomolgus TIM3 with an EC 5 o of 1 pg/mL or less as measured by flow cytometry, or wherein the antibody binds to membrane bound cyno TIM3 with K D of 1 nM or less as measured by Scatchard analysis.
- Embodiment 13 The antibody, or antigen binding portion thereof, of any one of the preceding Embodiments, wherein the antibody, or antigen binding portion thereof, comprises heavy chain CDR1, CDR2, and CDR3 and light chain CDR1, CDR2, and CDR3, wherein the heavy chain CDR3 comprises an amino acid sequence selected from the group consisting of: SEQ ID NO: 53, SEQ ID NO: 54, SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 126, SEQ ID NO: 127, SEQ ID NO: 128, or SEQ ID NO: 129.
- Embodiment 14 The antibody, or antigen binding portion thereof, of Embodiment 13, wherein the heavy chain CDR1 comprises XI, X2, X3, X4, Y, X5, and X6, and wherein XI is S or none, X2 is R or none,
- X3 is S, R, or D
- X4 is Y or H
- X5 is W or M
- X6 is G, N, S, or H.
- Embodiment 15 The antibody, or antigen binding portion thereof, of Embodiment 13 or 14, wherein the heavy chain CDR1 comprises XI, Y, Y, M, and X2, and wherein XI is S or D and X2 is H or S.
- Embodiment 16 The antibody, or antigen binding portion thereof, of Embodiment 13 or 14, wherein the heavy chain CDR1 comprises R, XI, Y, W, and X2, and wherein XI is H or Y and X2 is N or S.
- Embodiment 17 The antibody, or antigen binding portion thereof, of any one of Embodiments 13 to 16, wherein the heavy chain CDR2 comprises XI, I, X2, X3, X4, G, X5, X6, X7, X8, Y, X9, X10, XI 1, X12, X13, and X14, and wherein XI is S, Y, I, or F, X2 is Y, H, N, or S, X3 is Y, P, G, T, or S, X4 is S, T, R, or G, X5 is F, S, or D, X6 is S, T, or I, X7 is I or none, X8 is Y, N, or I, X9 is N, Q, S, or A, X10 is P, S, Q, or D, XI 1 is S or K, X12 is L, F, or V, X13 is K or Q, and
- Embodiment 18 The antibody, or antigen binding portion thereof, of any one of Embodiments 13 to 17, wherein the heavy chain CDR2 comprises Y, I, H, Y, XI, G, S, T, N, Y, N, X2, S, L, K, and S, and wherein XI is S or T and X2 is S or P.
- Embodiment 19 The antibody, or antigen binding portion thereof, of any one of Embodiments 13 to 17, wherein the heavy chain CDR2 comprises F, I, S, XI, X2, G, S, X3, 1, Y, Y, A, D, S, V, K, and G, and wherein XI is G, T or S, X2 is G or S, and X3 is T or I.
- Embodiment 20 The antibody, or antigen binding portion thereof, of any one of Embodiments 13 to 17, wherein the heavy chain CDR2 comprises I, I, N, P, R, G, D, S, I, I, Y, A, Q, K, F, Q, and G.
- Embodiment 21 The antibody, or antigen binding portion thereof, of any one of Embodiments 13 to 20, wherein the light chain CDR1 comprises SEQ ID NO: 64 or SEQ ID NO: 65.
- Embodiment 22 The antibody, or antigen binding portion thereof, of any one of Embodiments 13 to 21, wherein the light chain CDR2 comprises SEQ ID NO: 66 or SEQ ID NO: 67.
- Embodiment 23 The antibody, or antigen binding portion thereof, of any one of Embodiments 13 to 22, wherein the light chain CDR3 comprises SEQ ID NO: 68, SEQ ID NO: 69, SEQ ID NO: 70, or SEQ ID NO: 71.
- Embodiment 24 The antibody, or antigen binding portion thereof, of any one of the preceding Embodiments, wherein the antibody, or antigen binding portion thereof, comprises heavy chain CDR1, CDR2, and CDR3 and light chain CDR1, CDR2, and CDR3, wherein
- the heavy chain CDR1 is selected from the group consisting of SEQ ID NO: 41, SEQ ID NO: 42; SEQ ID NO: 43; SEQ ID NO: 44; and SEQ ID NO: 45;
- the heavy chain CDR2 is selected from the group consisting of SEQ ID NO: 46, SEQ ID NO: 47; SEQ ID NO: 48; SEQ ID NO: 49; SEQ ID NO: 50; SEQ ID NO: 51; SEQ ID NO: 52; SEQ ID NO: 122; SEQ ID NO: 123; SEQ ID NO: 124 and SEQ ID NO: 125;
- the heavy chain CDR3 is selected from the group consisting of SEQ ID NO: 53, SEQ ID NO: 54; SEQ ID NO: 55; SEQ ID NO: 56; SEQ ID NO: 57; SEQ ID NO: 58; SEQ ID NO: 59; SEQ ID NO: 126; SEQ ID NO: 127; SEQ ID NO:128 and SEQ ID NO: 129;
- the light chain CDR1 comprises SEQ ID NO: 64 or SEQ ID NO: 65;
- the light chain CDR2 comprises SEQ ID NO: 66 or SEQ ID NO: 67;
- the light chain CDR3 comprises SEQ ID NO: 68, SEQ ID NO: 69, SEQ ID NO: 70, or SEQ ID NO: 71.
- Embodiment 25 An isolated antibody, or antigen binding portion thereof, which binds to human TIM3, comprising:
- the heavy chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 41, 46, 53, respectively, and the light chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 64, 66, 68, respectively;
- the heavy chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 41, 122, 53, respectively, and the light chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 64, 66, 68, respectively;
- the heavy chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 41, 123, 53, respectively, and the light chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 64, 66, 68, respectively;
- the heavy chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 41, 124, 53, respectively, and the light chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 64, 66, 68, respectively;
- the heavy chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 41, 46, 126, respectively, and the light chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 64, 66, 68, respectively;
- the heavy chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 41, 46, 127, respectively, and the light chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 64, 66, 68, respectively;
- the heavy chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 41, 46, 128, respectively, and the light chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 64, 66, 68, respectively;
- the heavy chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 41, 46, 129, respectively, and the light chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 64, 66, 68, respectively;
- the heavy chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 41, 122, 128, respectively, and the light chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 64, 66, 68, respectively;
- the heavy chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 41, 122, 126, respectively, and the light chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 64, 66, 68, respectively;
- the heavy chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 42, 47, 54, respectively, and the light chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 64, 66, 69, respectively;
- the heavy chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 42, 125, 54, respectively, and the light chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 64, 66, 69, respectively;
- heavy chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 45, 50, and 57, respectively, and/or light chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 64, 66, and 69, respectively;
- (gl) heavy chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 45, 50, and 57, respectively, and/or light chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 65, 67, and 70, respectively;
- the heavy chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 45, 50, 57, respectively, and the light chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 64, 66, 71, respectively;
- the heavy chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 45, 50, 57, respectively, and the light chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 64, 66, 69, respectively;
- heavy chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 45, 52, and 59, respectively, and/or light chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 64, 66, and 69, respectively.
- Embodiment 26 The antibody, or antigen binding portion thereof, of Embodiment 25, wherein the antibody comprises heavy chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 41, 46, and 53, respectively, and/or light chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 64, 66, and 68, respectively.
- Embodiment 27 The antibody, or antigen binding portion thereof, of Embodiment 25, wherein the antibody comprises heavy chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 42, 47, and 54, respectively, and/or light chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 64, 66, and 69, respectively.
- Embodiment 28 The antibody, or antigen binding portion thereof, of Embodiment 25, wherein the antibody comprises heavy chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 43, 48, and 55, respectively, and/or light chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 64, 66, and 69, respectively.
- Embodiment 29 The antibody, or antigen binding portion thereof, of Embodiment 25, wherein the antibody comprises heavy chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 44, 49, and 56, respectively, and/or light chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 64, 66, and 68, respectively.
- Embodiment 30 The antibody, or antigen binding portion thereof, of Embodiment 25, wherein the antibody comprises heavy chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 45, 50, and 57, respectively, and/or light chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 64, 66, and 69, respectively.
- Embodiment 31 The antibody, or antigen binding portion thereof, of Embodiment 25, wherein the antibody comprises heavy chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 45, 50, and 57, respectively, and/or light chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 64, 66, and 71, respectively.
- Embodiment 32 The antibody, or antigen binding portion thereof, of Embodiment 25, wherein the antibody comprises heavy chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 45, 50, and 57, respectively, and/or light chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 65, 67, and 70, respectively.
- Embodiment 33 The antibody, or antigen binding portion thereof, of Embodiment 25, wherein the antibody comprises heavy chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 45, 50, and 57, respectively, and/or light chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 65, 67, and 70, respectively.
- Embodiment 34 The antibody, or antigen binding portion thereof, of Embodiment 25, wherein the antibody comprises heavy chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 45, 52, and 59, respectively, and/or light chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 64, 66, and 69, respectively.
- Embodiment 35 An isolated antibody, or antigen binding portion thereof, which binds to human TIM3 and comprises heavy and light chain variable regions, wherein the heavy chain variable region comprises an amino acid sequence which is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to the amino acid sequence selected from the group consisting of SEQ ID NOs: 34, 35, 36, 37, 38, 39, 40, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, and 364.
- Embodiment 36 An isolated antibody, or antigen binding portion thereof, which binds to human TIM3 and comprises heavy and light chain variable regions, wherein the light chain variable region comprises an amino acid sequence which is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to the amino acid sequence selected from the group consisting of SEQ ID NOs: 60, 61, 62, and 63.
- Embodiment 37 An isolated antibody, or antigen binding portion thereof, which binds to human TIM3 and cross-competes for binding to human TIM3 with a reference antibody comprising a VH and a VL, wherein the VH and the VL are selected from the group consisting of:
- Embodiment 38 The antibody, or antigen binding portion thereof, ofEmbodiment 37, which binds to TIM3 at the same epitope as the reference antibody, as determined, e.g., by one or methods provided herein.
- Embodiment 39 The antibody, or antigen binding portion thereof, ofEmbodiment 37 or 38, which comprises a VH and a VL, selected from the group consisting of:
- Embodiment 40 The antibody, or antigen binding portion thereof, of Embodiment 37 or 38, which comprises a VH comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 34, SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117, SEQ ID NO: 118, SEQ ID NO: 119, and SEQ ID NO: 364 and a VL comprising the amino acid sequence set forth in SEQ ID NO: 60.
- Embodiment 41 The antibody, or antigen binding portion thereof, of Embodiment 37 or 38, which comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 35 or SEQ ID NO: 120 and a VL comprising the amino acid sequence set forth in SEQ ID NO: 61.
- Embodiment 42 The antibody, or antigen binding portion thereof, of Embodiment 37 or 38, which comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 36 and a VL comprising the amino acid sequence set forth in SEQ ID NO: 61.
- Embodiment 43 The antibody, or antigen binding portion thereof, of Embodiment 37 or 38, which comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 37 and a VL comprising the amino acid sequence set forth in SEQ ID NO: 60.
- Embodiment 44 The antibody, or antigen binding portion thereof, of Embodiment 37 or 38, which comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 38 or SEQ ID NO: 121 and a VL comprising the amino acid sequence set forth in SEQ ID NO: 61, SEQ ID NO: 63, or SEQ ID NO: 62.
- Embodiment 45 The antibody, or antigen binding portion thereof, of Embodiment 37 or 38, which comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 39 and a VL comprising the amino acid sequence set forth in SEQ ID NO: 60.
- Embodiment 46 The antibody, or antigen binding portion thereof, of Embodiment 37 or 38, which comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 40 and a VL comprising the amino acid sequence set forth in SEQ ID NO: 61.
- Embodiment 47 The antibody, or antigen binding portion thereof, of any one of the preceding Embodiments, wherein the antibody is selected from the group consisting of an IgGl, an IgG2, an IgG3, an IgG4 or a variant thereof.
- Embodiment 48 The antibody, or antigen binding portion thereof, of Embodiment 47, wherein the antibody is an IgGl antibody.
- Embodiment 49 The antibody, or antigen binding portion thereof, of Embodiment 47, wherein the antibody comprises an effectorless IgGl Fc.
- Embodiment 50 The antibody, or antigen binding portion thereof, of Embodiment 49, wherein the antibody, or antigen binding portion thereof, comprises an effectorless IgGl Fc that comprises the following mutations: L234A, L235E, G237A, and optionally A330S and P331S.
- Embodiment 51 The antibody, or antigen binding portion thereof, of any of the preceding Embodiments, comprising a heavy chain constant region comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 263-266.
- Embodiment 52 The antibody, or antigen binding portion thereof, of any one of Embodiments 1- 51, wherein the antibody, or antigen binding portion thereof, is a human or humanized antibody.
- Embodiment 53 The antibody of any one of Embodiments 1-52, wherein the antibody comprises:
- Embodiment 54 The antibody, or antigen binding portion thereof, of any of Embodiments 1-53, wherein the antibody, or antigen binding portion thereof, has one or more of the following properties:
- soluble human TIM3 e.g., with a KD of 10 nM or less (e.g., 0.01 nM to 10 nM), e.g, as measured by Biacore;
- inducing or enhancing T cell activation e.g., by blocking or reducing the inhibitory effect of TIM3
- IFN-g production in TIM3-expressing T cells e.g, Thl cells or TILs
- enhanced proliferation of TIM3 -expressing T cells e.g., Thl cells or TILs
- 49VPVCWGKGACPVFE62 (SEQ ID NO: 367), 111RIQIPGIMNDEKFNLKL127 (SEQ ID NO: 368) and
- 119NDEKFNLKL127 (SEQ ID NO: 373), as determined by HDX-MS, as described in the Examples; and/or (c) competing with or cross-blocking with the binding to human TIM3 of 13 A3 or TIM3.18.IgG1.3.
- Embodiment 55 A bispecific molecule comprising the antibody of any one of the preceding Embodiments linked to a molecule having a second binding specificity.
- Embodiment 56 A nucleic acid encoding the heavy and/or light chain variable region of the antibody, or antigen binding portion thereof, of any one of Embodiments 1-54.
- Embodiment 57 An expression vector comprising the nucleic acid molecule of Embodiment 56.
- Embodiment 58 A cell transformed with an expression vector of Embodiment 57.
- Embodiment 59 An immunoconjugate comprising the antibody according to any one of
- Embodiments 1-54 linked to an agent.
- Embodiment 60 A composition comprising the antibody, or antigen binding portion thereof, bispecific molecule or immunoconjugate, of any one of Embodiments 1-55 and 59, and a carrier.
- Embodiment 61 A kit comprising the antibody, or antigen binding portion thereof, or bispecific molecule, or immunoconjugate of any one of Embodiments 1-55 and 59 and instructions for use.
- Embodiment 62 A method of preparing an anti-TIM3 antibody, or antigen binding portion thereof, comprising expressing the antibody, or antigen binding portion thereof, in the cell of Embodiment 58 and isolating the antibody, or antigen binding portion thereof, from the cell.
- Embodiment 63 A method of stimulating an antigen- specific T cell response comprising contacting the T cell with the antibody, or antigen binding portion thereof, bispecific molecule or
- Embodiment 64 A method of activating or co-stimulating an effector T cell, comprising contacting an effector T cell with an anti-TIM3 antibody, or antigen binding portion thereof, bispecific molecule or immunoconjugate, of any one of Embodiments 1-55 and 59 and CD3, wherein the effector T cell is activated or co-stimulated.
- Embodiment 65 A method of increasing IFN-g production in a T cell comprising contacting the T cell with an effective amount of the antibody, or antigen binding portion thereof, bispecific molecule or immunoconjugate, of any one of Embodiments 1-55 and 59.
- Embodiment 66 A method of increasing T cell proliferation comprising contacting the cell with an effective amount of the antibody, or antigen binding portion thereof, bispecific molecule or immunoconjugate, of any one of Embodiments 1-55 and 59.
- Embodiment 67 A method of increasing IFN-g production in T cells in a subject comprising administering an effective amount of the antibody, or antigen binding portion thereof, bispecific molecule or immunoconjugate, of any one of Embodiments 1-55 and 59, to increase IFN-g production from the T cells.
- Embodiment 68 A method of stimulating TIL activity in a subject, comprising administering to a subject a therapeutically effective amount of an anti-TIM3 antibody of any one of Embodiments 1-54.
- Embodiment 69 A method of stimulating an immune response in a subject comprising administering the antibody, or antigen binding portion thereof, bispecific molecule or immunoconjugate, of any one of Embodiments 1-55 and 59 to the subject such that an immune response in the subject is stimulated.
- Embodiment 70 The method of Embodiment 69, wherein the subject has a tumor and an immune response against the tumor is stimulated.
- Embodiment 71 A method for inhibiting the growth of tumors or reducing the size of tumors in a subject comprising administering to the subject the antibody, or antigen binding portion thereof, bispecific molecule or immunoconjugate, of any one of Embodiments 1-55 and 59, such that growth of the tumor is inhibited in the subject.
- Embodiment 72 A method of treating cancer comprising administering to a subject in need thereof a therapeutically effective amount of the antibody, or antigen binding portion thereof, bispecific molecule or immunoconjugate, of any one of Embodiments 1-55 and 59, to treat the cancer.
- Embodiment 73 The method of Embodiment 72, wherein the cancer is selected from the group consisting of: bladder cancer, breast cancer, uterine/cervical cancer, ovarian cancer, prostate cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, pancreatic cancer, colorectal cancer, colon cancer, kidney cancer, head and neck cancer, lung cancer, stomach cancer, germ cell cancer, bone cancer, liver cancer, thyroid cancer, skin cancer, neoplasm of the central nervous system, lymphoma, leukemia, myeloma, sarcoma, and virus-related cancer.
- the cancer is selected from the group consisting of: bladder cancer, breast cancer, uterine/cervical cancer, ovarian cancer, prostate cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, pancreatic cancer, colorectal cancer, colon cancer, kidney cancer, head and neck cancer, lung cancer, stomach cancer, germ cell cancer, bone cancer, liver cancer, thyroid cancer, skin cancer, neoplasm of
- Embodiment 74 The method of Embodiment 72 or 73, wherein the cancer is a metastatic cancer, refractory cancer, or recurrent cancer.
- Embodiment 75 The method of any one of Embodiments 67-74, further comprising administering one or more additional therapeutics.
- Embodiment 76 The method of Embodiment 75, wherein the additional therapy is an anti-PD-1 antibody, an anti-LAG-3 antibody, an anti-CTLA-4 antibody, an anti-GITR antibody, or an anti-PD-Ll antibody.
- Embodiment 77 A method of detecting the presence of T-cell immunoglobulin and mucin-domain containing-3 (TIM3) in a sample comprising contacting the sample with the antibody, or antigen binding portion thereof, of any one of Embodiments 1-54, under conditions that allow for formation of a complex between the antibody, or antigen binding portion thereof, and TIM3, and detecting the formation of a complex.
- TIM3 T-cell immunoglobulin and mucin-domain containing-3
- FIG. 1 A shows the nucleotide sequence (SEQ ID NO: 167) and the amino acid sequence (SEQ ID NO: 34) of the mature heavy chain variable (VH) region of the anti-TI 3 monoclonal antibody 13 A3.
- the CDR1 (SEQ ID NO: 41), CDR2 (SEQ ID NO: 46) and CDR3 (SEQ ID NO: 53) are delineated, and the V, D and J germline derivations are indicated.
- FIG. IB shows the nucleotide sequence (SEQ ID NO: 193) and the amino acid sequence (SEQ ID NO: 60) of the mature light chain variable (VL) region of the anti-TIM3 monoclonal antibody 13A3.
- the CDR1 (SEQ ID NO: 64), CDR2 (SEQ ID NO: 66) and CDR3 (SEQ ID NO: 68) are delineated, and the V and J germline derivations are indicated.
- FIG. 1C shows the nucleotide sequence (SEQ ID NO: 167) and the amino acid sequence (SEQ ID NO: 34) of the heavy chain VH region of the anti-TIM3 monoclonal antibody 13 A3 with a signal sequence (SEQ ID NOs: 274 and 269, respectively), and the nucleotide sequence (SEQ ID NO: 193) and the amino acid sequence (SEQ ID NO: 60) of the light chain VL region of the anti-TIM3 monoclonal antibody 13A3 with a signal sequence (SEQ ID NOs: 273 and 268, respectively).
- FIG. 2A shows the nucleotide sequence (SEQ ID NO: 168) and the amino acid sequence (SEQ ID NO: 35) of the mature heavy chain variable (VH) region of the anti-TIM3 monoclonal antibody 8B9.
- the CDR1 (SEQ ID NO: 42), CDR2 (SEQ ID NO: 47) and CDR3 (SEQ ID NO: 54) are delineated, and the V, D and J germline derivations are indicated.
- FIG. 2B shows the nucleotide sequence (SEQ ID NO: 194) and the amino acid sequence (SEQ ID NO: 61) of the mature light chain variable (VL) region of the anti-TIM3 monoclonal antibody 8B9.
- the CDR1 (SEQ ID NO: 64), CDR2 (SEQ ID NO: 66) and CDR3 (SEQ ID NO: 69) are delineated, and the V and J germline derivations are indicated.
- FIG. 2C shows the nucleotide sequence (SEQ ID NO: 168) and the amino acid sequence (SEQ ID NO: 35) of the heavy chain VH region of the anti-TIM3 monoclonal antibody 8B9 with a signal sequence (SEQ ID NOs: 274 and 269, respectively), and the nucleotide sequence (SEQ ID NO: 194) and the amino acid sequence (SEQ ID NO: 61) of the light chain VL region of the anti-TIM3 monoclonal antibody 8B9 with a signal sequence (SEQ ID NOs: .273 and 268, respectively).
- FIG. 3 A shows the nucleotide sequence (SEQ ID NO: 169) and the amino acid sequence (SEQ ID NO: 36) of the mature heavy chain variable (VH) region of the anti-TIM3 monoclonal antibody 8C4.
- the CDR1 (SEQ ID NO: 43), CDR2 (SEQ ID NO: 48) and CDR3 (SEQ ID NO: 55) are delineated, and the V, D and J germline derivations are indicated.
- FIG. 3B shows the nucleotide sequence (SEQ ID NO: 194) and the amino acid sequence (SEQ ID NO: 61) of the mature light chain variable (VL) region of the anti-TIM3 monoclonal antibody 8C4.
- the CDR1 (SEQ ID NO: 64), CDR2 (SEQ ID NO: 66) and CDR3 (SEQ ID NO: 69) are delineated, and the V and J germline derivations are indicated.
- FIG. 3C shows the nucleotide sequence (SEQ ID NO: 169) and the amino acid sequence (SEQ ID NO: 36) of the heavy chain VH region of the anti-TIM3 monoclonal antibody 8C4 with a signal sequence (SEQ ID NOs: 274 and 269, respectively), and the nucleotide sequence (SEQ ID NO: 194) and the amino acid sequence (SEQ ID NO: 61) of the light chain VL region of the anti-TIM3 monoclonal antibody 8C4 with a signal sequence (SEQ ID NOs: 273 and 268, respectively).
- FIG. 4A shows the nucleotide sequence (SEQ ID NO: 170) and the amino acid sequence (SEQ ID NO: 37) of the mature heavy chain variable (VH) region of the anti-TIM.3 monoclonal antibody 17C3.
- the CDR1 (SEQ ID NO: 44), CDR2 (SEQ ID NO: 49) and CDR3 (SEQ ID NO: 56) are delineated, and the V, D and J germline derivations are indicated.
- FIG. 4B shows the nucleotide sequence (SEQ ID NO: 193) and the amino acid sequence (SEQ ID NO: 60) of the mature light chain variable (VL) region of the anti-TIM3 monoclonal antibody 17C3.
- the CDR1 (SEQ ID NO: 64), CDR2 (SEQ ID NO: 66) and CDR3 (SEQ ID NO: 68) are delineated, and the V and J germline derivations are indicated.
- FIG. 4C shows the nucleotide sequence (SEQ ID NO: 170) and the amino acid sequence (SEQ ID NO: 37) of the heavy chain VH region of the anti-TIM3 monoclonal antibody 17C3 with a signal sequence (SEQ ID NOs: 272 and 267, respectively), and the nucleotide sequence (SEQ ID NO: 193) and the amino acid sequence (SEQ ID NO: 60) of the light chain VL region of the anti-TIM3 monoclonal antibody 17C3 with a signal sequence (SEQ ID NOs: 273 and 268, respectively).
- FIG. 5A shows the nucleotide sequence (SEQ ID NO: 171) and the amino acid sequence (SEQ ID NO: 38) of the mature heavy chain variable (VH) region of the anti-TIM3 monoclonal antibody 9F6.
- the CDR1 (SEQ ID NO: 45), CDR2 (SEQ ID NO: 50) and CDR3 (SEQ ID NO: 57) are delineated, and the V, D and J germline derivations are indicated.
- FIG. 5B shows the nucleotide sequence (SEQ ID NO: 195) and the amino acid sequence (SEQ ID NO: 62) of the mature light chain variable (VL) region of VK1 of the anti-TIM3 monoclonal antibody 9F6.
- the CDR1 (SEQ ID NO: 65), CDR2 (SEQ ID NO: 67) and CDR3 (SEQ ID NO: 70) are delineated, and the V and J germline derivations are indicated.
- FIG. 5C shows the nucleotide sequence (SEQ ID NO: 196) and the amino acid sequence (SEQ ID NO: 63) of the mature light chain variable (VL) region of VK2 of the anti-TIM3 monoclonal antibody 9F6.
- the CDR1 (SEQ ID NO: 64), CDR2 (SEQ ID NO: 66) and CDR3 (SEQ ID NO: 71) are delineated, and the V and J germline derivations are indicated.
- FIG. 5D shows the nucleotide sequence (SEQ ID NO: 194) and the amino acid sequence (SEQ ID NO: 61) of the mature light chain variable (VL) region of VK3 of the anti-TIM3 monoclonal antibody 9F6.
- the CDR1 (SEQ ID NO: 64), CDR2 (SEQ ID NO: 66) and CDR3 (SEQ ID NO: 69) are delineated, and the V and J germline derivations are indicated.
- FIG. 5E shows the nucleotide sequence (SEQ ID NO: 171) and the amino acid sequence (SEQ ID NO: 38) of the heavy chain VH region of the anti-TIM3 monoclonal antibody 9F6 with a signal sequence (SEQ ID NOs: 275 and 270, respectively), and the nucleotide sequences (SEQ ID NO: 195, 196, and 194, respectively) and the amino acid sequences (SEQ ID NO: 62, 63, and 61, respectively) of the light chain VL region of VK1, VK2 and VK3 of the anti-TIM3 monoclonal antibody 9F6 with a signal sequence (SEQ ID NOs: 276 and 271, respectively).
- FIG. 6A shows the nucleotide sequence (SEQ ID NO: 172) and the amino acid sequence (SEQ ID NO: 39) of the mature heavy chain variable (VH) region of the anti-TI M3 monoclonal antibody 3G4.
- the CDR1 (SEQ ID NO: 45), CDR2 (SEQ ID NO: 51) and CDR3 (SEQ ID NO: 58) are delineated, and the V, D and J germline derivations are indicated.
- FIG. 6B shows the nucleotide sequence (SEQ ID NO: 193) and the amino acid sequence (SEQ ID NO: 60) of the mature light chain variable (VL) region of the anti-TIM3 monoclonal antibody 3G4.
- the CDR1 (SEQ ID NO: 64), CDR2 (SEQ ID NO: 66) and CDR3 (SEQ ID NO: 68) are delineated, and the V and J germline derivations are indicated.
- FIG. 6C shows the nucleotide sequence (SEQ ID NO: 172) and the amino acid sequence (SEQ ID NO: 39) of the heavy chain VH region of the anti-TIM3 monoclonal antibody 3G4 with a signal sequence (SEQ ID NOs: 275 and 270, respectively), and the nucleotide sequence (SEQ ID NO: 193) and the amino acid sequence (SEQ ID NO: 60) of the light chain VL region of the anti-TIM3 monoclonal antibody 3G4 with a signal sequence (SEQ ID NOs: 273 and 268, respectively).
- FIG. 7A shows the nucleotide sequence (SEQ ID NO: 173) and the amino acid sequence (SEQ ID NO: 40) of the mature heavy chain variable (VH) region of the aiUi-TIM3 monoclonal antibody 17C8
- the CDR1 (SEQ ID NO: 45), CDR2 (SEQ ID NO: 52) and CDR3 (SEQ ID NO: 59) are delineated, and the V, D and J germline derivations are indicated.
- FIG. 7B shows the nucleotide sequence (SEQ ID NO: 194) and the amino acid sequence (SEQ ID NO: 61) of the mature light chain variable (VL) region of the anti-TIM3 monoclonal antibody 17C8.
- the CDR1 (SEQ ID NO: 64), CDR2 (SEQ ID NO: 66) and CDR3 (SEQ ID NO: 69) are delineated, and the V and J germline derivations are indicated.
- FIG. 7C shows the nucleotide sequence (SEQ ID NO: 173) and the amino acid sequence (SEQ ID NO: 40) of the heavy chain VH region of the anti-TIM3 monoclonal antibody 17C8 with a signal sequence (SEQ ID NOs: 275 and 270, respectively), and the nucleotide sequence (SEQ ID NO: 194) and the amino acid sequence (SEQ ID NO: 61) of the light chain VL region of the anti-TIM3 monoclonal antibody 17C8 with a signal sequence (SEQ ID NOs: 273 and 268, respectively).
- FIG. 8A shows the nucleotide sequence (SEQ ID NO: 420) and the amino acid sequence (SEQ ID NO: 410) of the mature heavy chain variable (VH) region of the anti-TIM3 monoclonal antibody 14H7.
- the CDR1 (SEQ ID NO: 45), CDR2 (SEQ ID NO: 413), and CDR3 (SEQ ID NO: 414) are delineated, and the V, D and J germline derivations are indicated.
- FIG. 8B shows the nucleotide sequence (SEQ ID NO: 427) and the amino acid sequence (SEQ ID NO: 417) of the mature light chain variable (VL) region of the anti-TIM3 monoclonal antibody 14H7.
- the CDR1 (SEQ ID NO: 64), CDR2 (SEQ ID NO: 66), and CDR3 (SEQ ID NO: 69) are delineated, and the V and J germline derivations are indicated.
- FIG. 8C shows the nucleotide sequence (SEQ ID NO: 420) and the amino acid sequence (SEQ ID NO: 410) of the heavy chain VH region of the anti-TIM3 monoclonal antibody 14H7 with a signal sequence (SEQ ID NOs: 362 and 361, respectively), and the nucleotide sequence (SEQ ID NO: 427) and the amino acid sequence (SEQ ID NO: 417) of the light chain VL region of the anti-TIM3 monoclonal antibody 14H7 with a signal sequence (SEQ ID NOs: 363 and 361, respectively).
- FIG. 9A shows the nucleotide sequence (SEQ ID NO: 421) and the amino acid sequence (SEQ ID NO: 411) of the mature heavy chain variable (VH) region of the anti-TIM3 monoclonal antibody 23B3.
- the CDR1 (SEQ ID NO: 45), CDR2 (SEQ ID NO: 415), and CDR3 (SEQ ID NO: 416) are delineated, and the V, D and J germline derivations are indicated.
- FIG. 9B shows the nucleotide sequence (SEQ ID NO: 193) and the amino acid sequence (SEQ ID NO: 60) of the mature light chain variable (VL) region of VK1 of the anti-TIM3 monoclonal antibody 23B3.
- the CDR1 (SEQ ID NO: 64), CDR2 (SEQ ID NO: 66), and CDR3 (SEQ ID NO:68) are delineated, and the V and J germline derivations are indicated.
- FIG. 9C shows the nucleotide sequence (SEQ ID NO: 428) and the amino acid sequence (SEQ ID NO: 418) of the mature light chain variable (VL) region of VK2 of the anti-TIM3 monoclonal antibody 23B3.
- the CDR1 (SEQ ID NO: 64), CDR2 (SEQ ID NO: 66), and CDR3 (SEQ ID NO: 419) are delineated, and the V and J germline derivations are indicated.
- FIG. 9D shows the nucleotide sequence (SEQ ID NO: 421) and the amino acid sequence (SEQ ID NO: 411) of the heavy chain VH region of the anti-TIM3 monoclonal antibody 23B3 with a signal sequence (SEQ ID NOs: 362 and 361, respectively), and the nucleotide sequences (SEQ ID NOs: 193 and 428, respectively) and the amino acid sequences (SEQ ID NO: 60 and 418, respectively) of the light chain VL region of VK1 and VK2 of the anti-TIM3 monoclonal antibody 23B3 with a signal sequence (SEQ ID NOs: 363 and 361, respectively).
- FIG. 10A shows a sequence alignment of the heavy chain variable (VH) region of monoclonal antibodies 13A3, 8B9, 8C4, 17C3, 9F6, 3G4, 17C8, 23B3, and 14H7.
- the complementarity determining regions (CDRs) are boxed.
- FIG. 10B lists the SEQ ID NOs for the VH regions, each of the CDRs, and mutants thereof, of the antibodies.
- FIG. 11 A shows a sequence alignment of the light chain variable (VL) region of monoclonal antibodies 13A3, 8B9, 8C4, 17C3, 9F6 VK1, 9F6 VK2, 9F6 VK3, 3G4, 17C8, 23B3 VK1, 23B3 VK2, and 14H7.
- the complementarity determining regions (CDRs) are boxed.
- FIG. 1 IB lists the SEQ ID NOs for the VL regions and each of the CDRs of the antibodies.
- FIG. 12 shows a sequence alignment of the mature full length heavy chain (HC) of monoclonal antibody TIM3.5 (13A3) and exemplary variants thereof: TIM3.13 (D101E), TIM3.14 (P102V), TIM3.15 (P102Y), TIM3.16 (P102L), TIM3.17 (N60Q/P102Y), TIM3.18 (N60Q/D101E), TIM3.10 (N60Q), TIM3.11 (N60S), and TIM3.12 (N60A).
- the VH region of each of the heavy chains is underlined.
- FIG. 13 shows a sequence alignment of the mature full length HC of monoclonal antibody 9F6 and an exemplary variant TIM3.7 (A108T) thereof.
- the VH region of each heavy chain is underlined.
- FIG. 14 shows a sequence alignment of the mature full length HC of monoclonal 8B9 and an exemplary variant TIM3.8 (S61P) thereof.
- the VH region of each heavy chain is underlined.
- FIG. 15 shows a sequence alignment of the mature full length HC of monoclonal antibody 23B3 and an exemplary variant TIM3.25 (G6E/D79Y). The VH region of each heavy chain is underlined.
- FIG. 16 lists the SEQ ID NOs of the full length heavy and light chains, variable regions and CDRs of hybridoma derived antibodies (13A3, 8B9, 8C4, 17C3, 9F6, 3G4 ,17C8, 14H7, and 23B3) and recombinant (TIM3.2-TIM3.18, TIM3.24, and TIM3.25) anti-human TIM3 antibodies.
- the isotype of the heavy and light chains is also indicated.
- “H.n.” refers to hybridoma name.
- Heavy and light chains that are referred to in FIG. 16 can be derived from its elements, e.g., variable and constant regions that are disclosed herein.
- FIGs. 17A and 17B show the binding curves and EC 50 values of several anti-TIM3 antibodies to human TIM3 transfected CHO cells (FIG. 17A) and activated human T cells (FIG. 17B).
- FIG. 17A the following anti-TIM3 antibodies are shown: 13A3, 17C3, 17C8, 3G4, 8B9, and 9F6.
- FIG. 17B the following anti-TIM3 antibodies are shown: 13A3, 17C3, 17C8, 3G4, 8B9, 8C4, and 9F6.
- isotype control antibodies human IgGl (hGl), IgG2 (hG2), and IgG4 (hG4) were used as negative controls.
- FIG. 18 shows a comparison of the binding curves and EC 50 values of anti-TIM3 antibodies 14H7 and 23B3 to anti-TIM3 antibody 13 A3 binding to human TIM3 positive cells.
- the isotype control antibodies IgGl, IgGl.l (hGl. l), IgG2, and IgG4 were used as negative controls.
- FIGs. 19A, 19B, and 19C show the binding analysis of anti-TIM3 antibodies to a cyno TIM3- transfected CHO cell line (FIG. 19A) and activated cyno T cells (FIGs. 19B and 19C).
- FIG. 19A binding curves and EC 50 values for anti-TIM3 antibodies 13 A3, 17C3, 17C8, 3G4, 8B9, and 9F6 are provided.
- FIG. 19B binding curve and EC 50 value for anti-TIM3 antibody 13 A3 are provided.
- 100 ug of the relevant antibodies were tested for binding to activated cynomolgus CD8+ T cells. The binding data is shown as mean fluorescence index (MFI).
- MFI mean fluorescence index
- FIGs. 19A-19C the relevant isotype control antibodies (hlgGl, hIgG2, and hIgG4) or no antibody treatment (No Ab) were used as negative controls.
- FIG. 20 shows a flow cytometry histogram of the binding of anti-TIM3 antibodies 14H7 (left panel) and 23B3 (right panel) to CHO cells transfected with either human TIM3 ("1") or cyno TIM3 ("2"). CHO cells transfected with the isotype control antibody were used as a negative control ("3").
- FIG. 21 shows anti-TIM3 activity (at various antibody concentrations as shown in the boxed legend) in promoting IFN-g production from tumor infiltrating leukocytes (TILs) in renal cell carcinoma (RCC).
- TILs tumor infiltrating leukocytes
- RCC renal cell carcinoma
- FIGs. 22A and 22B show anti-TIM3 activity (at various antibody concentrations as shown in the boxed legend) in promoting IFN-g production from lung cancer TILs (FIG. 22A, IFN-g ELISA; FIG. 22B, intracellular IFN-g staining).
- FIG. 22A the individual bar for each antibody shown (13A3 and 3G4) represents different concentrations of antibody, as indicated.
- the upper panel shows CD4 + T cells and the lower panel shows CD8 + T cells.
- the level of TIM3 was measured with 8B9 (x-axis).
- a non-TIM3 specific antibody KLH-2F5-g4p
- the x-axis shows TIM3 expression and the y-axis shows IFN-g expression.
- FIG. 23 shows the efficacy of anti-TIM3 antibodies (i.e ., antibodies 13A3 and 3G4) in promoting IFN-g secretion from TILs isolated from various tissues (;. e. , renal, pancreatic, lung, and thyroid) of patients and cultured in vitro with either anti-TIM3 antibody 13 A3 or 3G4. IFN-g secretion was measured in the presence of CHO-OKT3 cells. Data is shown as fold-increase over the level of IFN-g produced by TILs in the absence of anti-TIM3 antibodies.
- anti-TIM3 antibodies i.e ., antibodies 13A3 and 3G4
- FIGs. 24A and 24B show the cross-blocking data of the anti-TIM3 antibodies on activated human T cells.
- FIG. 24A the binding of anti-TIM3 antibodies 17C3 (dark gray), 8B9 (black), and 13 A3 (light gray) to activated human T cells pre-incubated with one of the following anti-TIM3 antibodies: 3G4, 8B9, 9F6, 17C3, 17C8, and 8C4.
- FIG. 24B the activated human T cells were preincubated with either the 14H7 or the 23B3 antibody and then, the binding of the 13A3 antibody was measured.
- the geometric mean fluorescence intensity of the binding of the anti-TlM3 antibodies to the activated human T cells is provided.
- FIG. 25 shows the amino acid residues that are necessary for binding of anti-TIM3 monoclonal antibodies 13 A3, 3G4, 17C3 and 8B9 to human TIM3.
- the signal sequence and the transmembrane domains are underlined.
- FIGs. 26A and 26B show that certain nti-TIM3 antibodies block the interaction between human TIM3 and PS-liposome.
- FIG. 26A shows a schematic diagram of the phosphatidylserine (PS)-hTIM3 "intandem" blocking assay.
- FIG. 26B shows blocking of binding of hTIM3-Fc to PS-liposome by certain anti- TIM3 antibodies, as measured via the PS-hTIM3 "in-tandem" blocking assay shown in FIG. 26A.
- the top row shows data for anti-TIM3 antibodies 3G4, 13A3, 17C3, and 17C8.
- the bottom row shows data for anti-TIM3 antibodies 8B9, 8C4, and 9F6. Both the PS response time and whether the hTIM3-Fc bound to PS-liposome are provided in the table to the right of each graph.
- FIG. 27 shows a summary of the functional activity of various anti-TIM3 antibodies (e.g., TIM3.5 (13A3), TIM3.4 (3G4), TIM3.2 (17C3), TIM3.9 (17C8), 9F6, TIM3.8 (8B9 with S61P substitution in the VH) and TIM3.6 (8C4)).
- TIM3.5 13A3
- TIM3.4 3G4
- TIM3.2 17C3
- TIM3.9 17C8
- 9F6, TIM3.8 8B9 with S61P substitution in the VH
- TIM3.6 8C4
- FIG. 28 provides a listing of all SEQ ID Numbers with a description of the sequences represented by the SEQ ID Numbers.
- FIGs. 29 A and 29B show the anti-tumor activity of the combined administration of anti-PDl and anti-TIM3 antibodies in the CT26 colorectal tumor mouse model.
- 29B shows the average tumor volume as a function of time (days post tumor implantation) in mice treated with (i) RMT3-23 anti-TIM3 antibody alone, (ii) AbM anti-TIM3 antibody alone, (iii) RMP1-14 anti- PDl antibody alone, (iv) combination of RMT3-23 anti-TIM3 and RMPl-14 anti-PDl antibodies, (v) combination of Ab M anti-TIM3 and RMP1-14 anti-PDl antibodies, and (vi) isotype control antibody.
- FIG. 30 shows the list of common peptides of hTIM3 that were used to map the epitopes of the anti-TIM3 antibodies (13A3 and 3G4) using hydrogen/deuterium exchange mass spectrometry (HDX-MS).
- Each bar indicates a peptic peptide.
- the circled residues i.e N99, T145, and N172) indicate the glycosylation sites.
- FIG. 31 shows the human TIM3 binding regions of the anti-TIM3 antibodies (13 A3 and 3G4) identified using HDX-MX.
- the upper panel shows the binding region of the 13 A3 anti-TIM3 antibody.
- the bottom panel shows the binding region of the 3G4 anti-TIM3 antibody.
- FIGs. 32A and 32B show the results of a Scatchard analysis of the binding of TIM3.18.IgG1.3 to CHO cells ectopically expressing human or cyno TIM3.
- FIG. 32 A shows a 125 I-TIM3 Ab standard curve.
- FIG. 32B shows the amount of TIM3.18.IgG1.3 antibody bound to CHO cells expressing human (left panel) and cyno (right panel) TIM3. Below each of the graphs is provided the estimated affinity value and the number of TIM3 molecules expressed on the surface of the CHO cells. These values were calculated as described in Example 4. [0175] FIG.
- FIGs. 34A and 34B show TIM3.18.IgG1.3 and TIM3.18.IgG1.3 Fab enhanced proliferation of Thl T cells in the polarized Thl/irradiated CHO-OKT3 co-culture assay.
- FIG. 34A shows Thl cell proliferation observed with various concentrations of TIM3.18.IgG1.3, 13 A3 (" 13A3-g4"), with no antibody, or isotype control antibodies (hlgGl .1 or WgG4). Each of the bars for an antibody represent a different concentration.
- FIG. 34B shows Thl cell proliferation observed with various concentrations of TIM3.18.IgG1.3 Fab, with no antibody ("no ab"), or isotype control antibody IgG1.3 ("G1.3"). Each of the bar for the TIM3.18 antibody represents a different concentration.
- FIG. 35 shows TIM3.24 and TIM3.25 mediated enhanced proliferation of Thl T cells in the polarized Thl/irradiated CHO-OKT3 co-culture assay.
- TIM3.18 antibody was included for comparison purposes.
- CHO cells that were not treated with any antibody (“No Ab”) or treated with an isotype control IgG1.3 antibody (“IgG1.3”) were used as negative controls.
- the dotted horizontal line indicates proliferation over the negative control.
- FIG. 36 shows that anti-TIM3 antibody TIM3.18.IgG1.3 (black circle) enhanced proliferation of Thl T cells in the polarized Thl/irradiated CHO-OKT3-PD-L1 co-culture assay in combination with nivolumab.
- FIG. 37 shows that anti-TIM3 antibody TIM3.18.IgG1.3 enhanced interferon-g secretion of renal cell carcinoma tumor infiltrating lymphocytes (TILs) after stimulation with irradiated CHO-OKT3 cells.
- TILs renal cell carcinoma tumor infiltrating lymphocytes
- the TILs stimulated with CHOs in the presence of an isotype control antibody (WgG4 or hlgGl. If) or no antibodies at all were used as negative controls.
- WgG4 or hlgGl. If an isotype control antibody
- Each of the bars for the TIM3.18 antibody represents a different concentration of the antibody.
- FIG. 38 shows that anti-TIM3 antibody TIM3.18.IgG1.3 enhanced interferon-g secretion of breast cancer TILs stimulated with irradiated CHO-OKT3 cells. Assays with no antibody or an isotype control antibody were used as controls. The dotted horizontal line indicates interferon-g secretion above the negative controls.
- FIG. 39 shows a histogram of the CD163, CD206, and TIM3 expression on the M0 macrophages that were used in an AlloMLR (mixed lymphocyte reaction) assay, the results of which are shown in FIG. 40.
- Each of the histograms shows the fluorescence intensity of (1) CD163, CD206, or TIM3, (2) isotype control antibody (i.e., negative control), and (3) background fluorescence ("unstained") ⁇ i.e., negative control).
- FIG. 40 shows the proliferation of cells in an AlloMLR assay conducted in the presence of the anti-TIM3 antibody TIM3.18.IgGl.3, an isotype control, or in the absence of antibody.
- FIG. 41 is a ribbon diagram of the structure of a TIM3 :TIM3.18 Fab complex, as determined by crystallography.
- the Fab fragment is shown in light gray and TIM3 is shown in dark gray.
- FIG. 42 shows the structure of TIM3 :TIM3.18 Fab complex, as determined by crystallography.
- FIG. 43 is a diagram of the assay that was used to measure potential internalization by anti-TIM3 antibodies.
- the left panel provides a schematic overview of the assay.
- the right panel describes the calculation of the internalization values.
- FIG. 44 shows that anti-TIM3 antibodies 13 A3 (bottom left panel) and certain variants (D101E - top left panel; N60Q - top right panel) thereof do not trigger receptor (i.e., TIM3) mediated internalization.
- FIGs 45A and 45 B show a ribbon diagram depicting the epitopes of anti-TIM3 antibodies 13 A3 (FIG. 45A) and 3G4 (FIG. 45B).
- the amino acid sequences of the epitopes for each of the antibodies are provided below the ribbon diagram.
- the different patterns identify the specific regions of the anti-TIM3 antibodies that correspond to the specific epitopes.
- a or “an” entity refers to one or more of that entity; for example, “a nucleotide sequence,” is understood to represent one or more nucleotide sequences.
- the terms “a” (or “an”), “one or more,” and “at least one” can be used interchangeably herein.
- T-cell immunoglobulin and mucin-domain containing-3 or "TIM3" as used herein refers to a receptor that is a member of the T cell immunoglobulin and mucin domain (TIM) family of proteins.
- TIM3-L Primary ligand for TIM3 include phosphatidylserine (TIM3-L).
- TIM3 is also referred to as hepatitis A vims cellular receptor 2 (HAVCR2), T-cell immunoglobulin mucin receptor 3, TIM-3, TIMD3, TIMD-3, Kidney Injury Molecule-3, KIM-3, and CD366.
- HAVCR2 hepatitis A vims cellular receptor 2
- T-cell immunoglobulin mucin receptor 3 T-cell immunoglobulin mucin receptor 3
- TIM-3 T-cell immunoglobulin mucin receptor 3
- TIMD3, TIMD-3 Kidney Injury Molecule-3
- KIM-3 Kidney Injury Molecule-3
- CD366 CD366.
- the term "TIM3" includes any variants or isoforms of TIM3 which are naturally expressed by cells. Accordingly, antibodies described herein can cross-react with TIM3 from species other than human (
- Isoform 1 (Accession No. NP_116171; SEQ ID No. NP_116171; SEQ ID No. NP_116171; SEQ ID No. NP_116171; SEQ ID No. NP_116171; SEQ ID No. NP_116171; SEQ ID No. NP_116171; SEQ ID No. NP_116171; SEQ ID No. NP_116171; SEQ ID NO: TIM3
- Isoform 2 (Accession No. AAH20843; SEQ ID NO: 287) consists of 142 amino acids, and is soluble. It lacks amino acid residues 143- 301, which encode the transmembrane domain, the cytoplasmic domain, and part of the extracellular domain of TIM3.
- the amino acid residues 132-142 also differ from the canonical sequence described above.
- Human TIM3 isoform 1 (Accession No. NP_116171; SEQ ID NO: 286; encoded by the nucleotide sequence having Accession No. NM 032782.4; SEQ ID NO: 288; FIG. 25):
- the signal sequence of isoforms 1 and 2 corresponds to amino acids 1-21 (underlined).
- the mature isoforms 1 and 2 consist of amino acids 22 to 301 or 142, respectively.
- the extracellular domain of mature human TIM3 consists of amino acids 22-202 of SEQ ID NO: 286 and has the amino acid sequence: SEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNWLRTDERDVNYWTSRYWLNGDFRKGDVSLT IENVTLADSGIYCCRIQI PGIMNDEKFNLKLVIKPAKVTPAPTRQRDFTAAFPRMLTTRGHGPAETQTLGSLPDI NLTQI STLANELRDSRLANDLRDSGATIRIG (SEQ ID NO: 290) .
- Cynomolgus TIM3 protein consists of the following amino acid sequence (including a signal sequence):
- antibody refers, in some embodiments, to a protein comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds.
- Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant region (abbreviated herein as CH).
- VH heavy chain variable region
- CH heavy chain constant region
- the heavy chain constant region is comprised of a hinge and three domains, CHI, CH2 and CH3.
- each light chain is comprised of a light chain variable region (abbreviated herein as VL) and a light chain constant region.
- the light chain constant region is comprised of one domain (abbreviated herein as CL).
- the VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR).
- CDR complementarity determining regions
- FR framework regions
- Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy -terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4.
- the variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
- the constant regions of the antibodies can mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq) of the classical complement system.
- a heavy chain may have the C-terminal lysine or not.
- the amino acids in the variable regions are numbered using the Rabat numbering system and those in the constant
- IgG antibody e.g., a human IgGl, IgG2, IgG3 and IgG4 antibody, as used herein has, in some embodiments, the structure of a naturally -occurring IgG antibody, i.e., it has the same number of heavy and light chains and disulfide bonds as a naturally-occurring IgG antibody of the same subclass.
- an anti-TIM3 IgGl, IgG2, IgG3 or IgG4 antibody consists of two heavy chains (HCs) and two light chains (LCs), wherein the two HCs and LCs are linked by the same number and location of disulfide bridges that occur in naturally -occurring IgGl, IgG2, IgG3 and IgG4 antibodies, respectively (unless the antibody has been mutated to modify the disulfide bridges).
- Antibodies typically bind specifically to their cognate antigen with high affinity, reflected by a dissociation constant (K D ) of 10 5 to 10 11 M or less. Any K D greater than about 10 4 M is generally considered to indicate nonspecific binding.
- K D dissociation constant
- an antibody that "binds specifically" to an antigen refers to an antibody that binds to the antigen and substantially identical antigens with high affinity, which means having a K D of 10 7 M or less, 10 8 M or less, 5 x 10 9 M or less, or between 10 8 M and 10 10 M or less, but does not bind with high affinity to unrelated antigens.
- an antigen is "substantially identical" to a given antigen if it exhibits a high degree of sequence identity to the given antigen, for example, if it exhibits at least 80%, at least 90%, at least 95%, at least 97%, or at least 99% sequence identity to the sequence of the given antigen.
- an antibody that binds specifically to human TIM3 can, in some embodiments, also have crossreactivity with TIM3 antigens from certain primate species (e.g., cynomolgus TIM3), but cannot cross-react with TIM3 antigens from other species or with an antigen other than TIM3.
- An immunoglobulin can be from any of the commonly known isotypes, including but not limited to IgA, secretory IgA, IgG and IgM.
- the IgG isofype is divided in subclasses in certain species: IgGl, IgG2, IgG3 and IgG4 in humans, and IgGl, IgG2a, IgG2b and IgG3 in mice.
- the anti-TIM3 antibodies described herein are of the IgGl subtype.
- Immunoglobulins, e.g., IgGl exist in several allotypes, which differ from each other in at most a few amino acids.
- Antibody includes, by way of example, both naturally -occurring and non-naturally -occurring antibodies; monoclonal and polyclonal antibodies; chimeric and humanized antibodies; human and nonhuman antibodies and wholly synthetic antibodies.
- antigen binding portion of an antibody refers to one or more fragments of an antibody that retain the ability to specifically bind to an antigen (e.g., human TIM3). It has been shown that the antigen-binding function of an antibody can be performed by fragments of a full-length antibody.
- binding fragments encompassed within the term "antigen binding portion" of an antibody include (i) a Fab fragment (fragment from papain cleavage) or a similar monovalent fragment consisting of the V L , V H , LC and CHI domains; (ii) a F(ab')2 fragment (fragment from pepsin cleavage) or a similar bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the V H and CHI domains; (iv) a Fv fragment consisting of the V L and V H domains of a single arm of an antibody, (v) a dAb fragment (Ward et al, (1989) Nature 341 :544- 546), which consists of a V H domain; (vi) an isolated complementarity determining region (CDR) and (vii) a combination of two
- the two domains of the Fv fragment, V L and V H are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the V L and V H regions pair to form monovalent molecules (known as single chain Fv (scFv); see, e.g., Bird et al. (1988) Science 242:423-426; and Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883).
- single chain Fv single chain Fv
- Such single chain antibodies are also intended to be encompassed within the term "antigen binding portion" of an antibody.
- Antigen binding portions can be produced by recombinant DNA techniques, or by enzymatic or chemical cleavage of intact immunoglobulins .
- a "bispecific” or “bifunctional antibody” is an artificial hybrid antibody having two different heavy /light chain pairs and two different binding sites.
- Bispecific antibodies can be produced by a variety of methods including fusion of hybridomas or linking of Fab' fragments. See, e.g., Songsivilai & Lachmann, Clin. Exp. Immunol. 79:315-321 (1990); Kostelny et al. , J. Immunol. 148, 1547-1553 (1992).
- the term "monoclonal antibody,” as used herein, refers to an antibody from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprised in the population are substantially similar and bind the same epitope(s) (e.g., the antibodies display a single binding specificity and affinity), except for possible variants that may arise during production of the monoclonal antibody, such variants generally being present in minor amounts.
- the modifier "monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
- human monoclonal antibody refers to an antibody from a population of substantially homogeneous antibodies that display(s) a single binding specificity and which has variable and optional constant regions derived from human germline immunoglobulin sequences.
- human monoclonal antibodies are produced by a hybridoma which includes a B cell obtained from a transgenic non-human animal, e.g., a transgenic mouse, having a genome comprising a human heavy chain transgene and a light chain transgene fused to an immortalized cell.
- recombinant human antibody includes all human antibodies that are prepared, expressed, created or isolated by recombinant means, such as (a) antibodies isolated from an animal (e.g., a mouse) that is transgenic or transchromosomal for human immunoglobulin genes or a hybridoma prepared therefrom, (b) antibodies isolated from a host cell transformed to express the antibody, e.g., from a transfectoma, (c) antibodies isolated from a recombinant, combinatorial human antibody library, and (d) antibodies prepared, expressed, created or isolated by any other means that involve splicing of human immunoglobulin gene sequences to other DNA sequences.
- variable and constant regions that utilize particular human germline immunoglobulin sequences are encoded by the germline genes, but include subsequent rearrangements and mutations which occur, for example, during antibody maturation.
- the variable region contains the antigen binding domain, which is encoded by various genes that rearrange to form an antibody specific for a foreign antigen.
- the variable region can be further modified by multiple single amino acid changes (referred to as somatic mutation or hypermutation) to increase the affinity of the antibody to the foreign antigen.
- the constant region will change in further response to an antigen (i.e., isotype switch).
- the rearranged and somatically mutated nucleic acid molecules that encode the light chain and heavy chain immunoglobulin polypeptides in response to an antigen cannot have sequence identity with the original nucleic acid molecules, but instead will be substantially identical or similar (i.e., have at least 80% identity).
- a “human” antibody refers to an antibody having variable regions in which both the framework and CDR regions are derived from human germline immunoglobulin sequences. Furthermore, if the antibody contains a constant region, the constant region also is derived from human germline immunoglobulin sequences.
- the anti-TIM3 antibodies described herein can include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo).
- the term "human antibody”, as used herein is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
- the terms "human” antibodies and “fully human” antibodies are used synonymously.
- a “humanized” antibody refers to an antibody in which some, most or all of the amino acids outside the CDR domains of a non-human antibody are replaced with corresponding amino acids derived from human immunoglobulins. In some embodiments of a humanized form of an antibody, some, most or all of the amino acids outside the CDR domains have been replaced with amino acids from human immunoglobulins, whereas some, most or all amino acids within one or more CDR regions are unchanged. Small additions, deletions, insertions, substitutions or modifications of amino acids are permissible as long as they do not abrogate the ability of the antibody to bind to a particular antigen. A "humanized” antibody retains an antigenic specificity similar to that of the original antibody.
- a "chimeric antibody” refers to an antibody in which the variable regions are derived from one species and the constant regions are derived from another species, such as an antibody in which the variable regions are derived from a mouse antibody and the constant regions are derived from a human antibody.
- isotype refers to the antibody class (e.g., IgGl, IgG2, IgG3, IgG4, IgM, IgAl, IgA2, IgD, and IgE antibody) that is encoded by the heavy chain constant region genes.
- antibody class e.g., IgGl, IgG2, IgG3, IgG4, IgM, IgAl, IgA2, IgD, and IgE antibody
- Allotype refers to naturally -occurring variants within a specific isotype group, which variants differ in a few amino acids (see, e.g., Jefferis et al. (2009) mAbs 1: 1). Anti-TIM3 antibodies described herein canbe of any allotype. As used herein, antibodies referred to as "IgGlf,” “IgGl.
- IgG1.3f isotype are IgGl, effectorless IgGl.1, and effectorless IgG1.3 antibodies, respectively, of the allotype "f," i.e., having 214R, 356E and 358M according to the EU index as in Kabat, as shown, e.g., in SEQ ID NO: 3.
- an "isolated antibody,” as used herein, is intended to refer to an antibody which is substantially free of other proteins and cellular material.
- an antibody that "inhibits binding of TIM3 -L to TIM3" is intended to refer to an antibody that inhibits the binding of TIM3 to its ligand, e.g., phosphatidylserine, e.g., in binding assays using CHO cells transfected with human TIM3 or TIM3 expressing activated T cells, with an EC 50 of about 1 ug/mL or less, such as about 0.9 pg/mL or less, about 0.85 pg/mL or less, about 0.8 pg/mL or less, about 0.75 pg/mL or less, about 0.7 pg/mL or less, about 0.65 pg/mL or less, about 0.6 pg/mL or less, about 0.55 pg/mL or less, about 0.5 pg/mL or less, about 0.45 pg/mL or less, about 0.4 pg/mL or less, about 0.
- effector function refers to the interaction of an antibody Fc region with an Fc receptor or ligand, or a biochemical event that results therefrom.
- exemplary “effector functions” include Clq binding, complement dependent cytotoxicity (CDC), Fc receptor binding, FcyR-mediated effector functions such as ADCC and antibody dependent cell-mediated phagocytosis (ADCP), and downregulation of a cell surface receptor (e.g., the B cell receptor; BCR).
- CDC complement dependent cytotoxicity
- FcyR-mediated effector functions such as ADCC and antibody dependent cell-mediated phagocytosis (ADCP)
- ADCP antibody dependent cell-mediated phagocytosis
- BCR B cell receptor
- Such effector functions generally require the Fc region to be combined with a binding domain (e.g., an antibody variable domain).
- Fc receptor or “FcR” is a receptor that binds to the Fc region of an immunoglobulin.
- FcRs that bind to an IgG antibody comprise receptors of the FcyR family, including allelic variants and alternatively spliced forms of these receptors.
- the FcyR family consists of three activating (FcyRI, FcyRIII, and FcyRIV in mice; FcyRIA, FcyRIIA, and FcyRIIIA in humans) and one inhibitory (FcyRIIB) receptor.
- FcyRIIB inhibitory receptor
- NK cells selectively express one activating Fc receptor (FcyRIII in mice and FcyRIIIA in humans) but not the inhibitory FcyRIIB in mice and humans.
- Human IgGl binds to most human Fc receptors and is considered equivalent to murine IgG2a with respect to the types of activating Fc receptors that it binds to.
- an "Fc region” fragment crystallizable region or “Fc domain” or “Fc” refers to the C-terminal region of the heavy chain of an antibody that mediates the binding of the immunoglobulin to host tissues or factors, including binding to Fc receptors located on various cells of the immune system (e.g., effector cells) or to the first component (Clq) of the classical complement system.
- an Fc region comprises the constant region of an antibody excluding the first constant region immunoglobulin domain (e.g., CHI or CL).
- IgG IgG
- the Fc region comprises two identical protein fragments, derived from the second (CH2) and third (CH3) constant domains of the antibody's two heavy chains; IgM and IgE Fc regions comprise three heavy chain constant domains (CH domains 2-4) in each polypeptide chain.
- the Fc region comprises immunoglobulin domains CH2 and CH3 and the hinge between CHI and CH2 domains.
- the human IgG heavy chain Fc region is defined to stretch from an amino acid residue D221 for IgGl, V222 for IgG2, L221 for IgG3 and P224 for IgG4 to the carboxy-terminus of the heavy chain, wherein the numbering is according to the EU index as in Kabat.
- the CH2 domain of a human IgG Fc region extends from amino acid 237 to amino acid 340, and the CH3 domain is positioned on C-terminal side of a CH2 domain in an Fc region, i.e., it extends from amino acid 341 to amino acid 447 or 446 (if the C-terminal lysine residue is absent) or 445 (if the C-terminal glycine and lysine residues are absent) of an IgG.
- the Fc region can be a native sequence Fc, including any allotypic variant, or a variant Fc (e.g., a non-namrally -occurring Fc).
- Fc can also refer to this region in isolation or in the context of an Fc-comprising protein polypeptide such as a "binding protein comprising an Fc region,” also referred to as an “Fc fusion protein” (e.g., an antibody or immunoadhesion).
- a binding protein comprising an Fc region also referred to as an “Fc fusion protein” (e.g., an antibody or immunoadhesion).
- a "native sequence Fc region” or “native sequence Fc” comprises an amino acid sequence that is identical to the amino acid sequence of an Fc region found in nature.
- Native sequence human Fc regions include a native sequence human IgGl Fc region; native sequence human IgG2 Fc region; native sequence human IgG3 Fc region; and native sequence human IgG4 Fc region as well as naturally -occurring variants thereof.
- Native sequence Fc include the various allotypes of Fes (see, e.g., Jefferis et al. (2009) mAbs 1: 1).
- epitopes refers to a site on an antigen (e.g., TIM3) to which an immunoglobulin or antibody specifically binds, e.g., as defined by the specific method used to identify it.
- Epitopes can be formed both from contiguous amino acids (usually a linear epitope) or noncontiguous amino acids juxtaposed by tertiary folding of a protein (usually a conformational epitope). Epitopes formed from contiguous amino acids are typically, but not always, retained on exposure to denaturing solvents, whereas epitopes formed by tertiary folding are typically lost on treatment with denaturing solvents.
- An epitope typically includes at least 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15 amino acids in a unique spatial conformation.
- epitope mapping Methods for determining what epitopes are bound by a given antibody (i.e., epitope mapping) are well known in the art and include, for example, immunoblotting and immunoprecipitation assays, wherein overlapping or contiguous peptides from (e.g., from TIM3) are tested for reactivity with a given antibody (e.g., anti-TIM3 antibody).
- Methods of determining spatial conformation of epitopes include techniques in the art and those described herein, for example, x-ray crystallography, antigen mutational analysis, 2-dimensional nuclear magnetic resonance and HDX-MS (see, e.g., Epitope Mapping Protocols in Methods in Molecular Biology, Vol. 66, G. E. Morris, Ed. (1996)).
- epitopope mapping refers to the process of identification of the molecular determinants for antibody -antigen recognition.
- the term "binds to the same epitope" with reference to two or more antibodies means that the antibodies bind to the same segment of amino acid residues, as determined by a given method.
- Techniques for determining whether antibodies bind to the "same epitope on TIM3" with the antibodies described herein include, for example, epitope mapping methods, such as, x-ray analyses of crystals of antigen: antibody complexes which provides atomic resolution of the epitope and hydrogen/deuterium exchange mass spectrometry (HDX-MS).
- Other methods monitor the binding of the antibody to antigen fragments or mutated variations of the antigen where loss of binding due to a modification of an amino acid residue within the antigen sequence is often considered an indication of an epitope component.
- Antibodies that "compete with another antibody for binding to a target” refer to antibodies that inhibit (partially or completely) the binding of the other antibody to the target. Whether two antibodies compete with each other for binding to a target, i. eix whether and to what extent one antibody inhibits the binding of the other antibody to a target, can be determined using known competition experiments, e.g., BIACORE ® surface plasmon resonance (SPR) analysis. In some embodiments, an antibody competes with, and inhibits binding of another antibody to a target by at least 50%, 60%, 70%, 80%, 90% or 100%. The level of inhibition or competition can be different depending on which antibody is the "blocking antibody” (i.e., the cold antibody that is incubated first with the target).
- blocking antibody i.e., the cold antibody that is incubated first with the target.
- Competition assays can be conducted as described, for example, in Ed Harlow and David Lane, Cold Spring Haib Protoc; 2006; doi: 10.1101/pdb.prot4277 or in Chapter 11 of "Using Antibodies” by Ed Harlow and David Lane, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, USA 1999.
- Two antibodies "cross-compete” if antibodies block each other both ways by at least 50%, i.e., regardless of whether one or the other antibody is contacted first with the antigen in the competition experiment.
- radioimmunoassay RIA
- solid phase direct or indirect enzyme immunoassay EIA
- sandwich competition assay see Stahli et al, Methods in Enzymology 9:242 (1983)
- solid phase direct biotin-avidin EIA see Kirkland et al., J. Immunol. 137:3614 (1986)
- solid phase direct labeled assay solid phase direct labeled sandwich assay
- solid phase direct label RIA using 1-125 label see Morel et aI., MoI. Immunol. 25(1):7 (1988)
- solid phase direct biotin-avidin EIA Cheung et al.. Virology 176:546 (1990)
- direct labeled RIA see Morel et aI., MoI. Immunol. 25(1):7 (1988)
- solid phase direct biotin-avidin EIA Cheung et al.. Virology 176:546 (1990)
- the terms “specific binding,” “selective binding,” “selectively binds,” and “specifically binds,” refer to antibody binding to an epitope on a predetermined antigen.
- the antibody binds with an equilibrium dissociation constant (K D ) of approximately less than 10 7 M, such as approximately less than 10 8 M, 10 9 M or 10 10 M or even lower when determined by, e.g., surface plasmon resonance (SPR) technology in a BIACORE ® 2000 instrument using the predetermined antigen, e.g, recombinant human TIM3, as the analyte and the antibody as the ligand, or Scatchard analysis of binding of the antibody to antigen positive cells, and (ii) binds to the predetermined antigen with an affinity that is at least twofold greater than its affinity for binding to a non-specific antigen (e.g., BSA, casein) other than the predetermined antigen or a closely -related antigen
- K D equilibrium dissociation constant
- an antibody that "specifically binds to human TIM3” refers to an antibody that binds to soluble or cell bound human TIM3 with a K D of 10 7 M or less, such as approximately less than 10 8 M, 10 9 M or 10 10 M or even lower.
- An antibody that "cross-reacts with cynomolgus TIM3 " refers to an antibody that binds to cynomolgus TIM3 with a K D of 10 7 M or less, such as approximately less than 10 8 M, 10 9 M or 10 10 M or even lower.
- such antibodies that do not cross-react with TIM3 from a non-human species exhibit essentially undetectable binding against these proteins in standard binding assays.
- K assoc or "k a ", as used herein, is intended to refer to the association rate of a particular antibody- antigen interaction
- k dls or "k d .” as used herein, is intended to refer to the dissociation rate of a particular antibody -antigen interaction
- K D is intended to refer to the dissociation constant, which is obtained from the ratio of k d to k a ( i.e... k d /k a) and is expressed as a molar concentration (M). K D values for antibodies can be determined using methods well established in the art.
- K D of an antibody Available methods for determining the K D of an antibody include surface plasmon resonance, a biosensor system such as a BIACORE ® system or flow cytometry and Scatchard analysis.
- high affinity for an IgG antibody refers to an antibody having a K D of 10 8 M or less, 10 9 M or less, or 10 10 M or less for a target antigen.
- high affinity binding can vary for other antibody isotypes.
- high affinity binding for an IgM isotype refers to an antibody having a K D of 10 10 M or less, or 10 8 M or less.
- EC 5 o in the context of an in vitro or in vivo assay using an antibody or antigen binding fragment thereof, refers to the concentration of an antibody or an antigen-binding portion thereof that induces a response that is 50% of the maximal response, i.e., halfway between the maximal response and the baseline.
- naturally-occurring refers to the fact that an object can be found in nature.
- a polypeptide or polynucleotide sequence that is present in an organism (including viruses) that can be isolated from a source in nature and which has not been intentionally modified by man in the laboratory is naturally- occurring.
- a "polypeptide” refers to a chain comprising at least two consecutively linked amino acid residues, with no upper limit on the length of the chain.
- One or more amino acid residues in the protein can contain a modification such as, but not limited to, glycosylation, phosphorylation or disulfide bond formation.
- a "protein” can comprise one or more polypeptides.
- nucleic acid molecule is intended to include DNA molecules and RNA molecules.
- a nucleic acid molecule can be single- stranded or double- stranded, and can be cDNA.
- Constant amino acid substitutions refer to substitutions of an amino acid residue with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine), beta-branched side chains (e.g, threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
- basic side chains e.g
- a predicted nonessential amino acid residue in an anti-TIM3 antibody is replaced with another amino acid residue from the same side chain family.
- Methods of identifying nucleotide and amino acid conservative substitutions which do not eliminate antigen binding are well-known in the art (see, e.g., Brummell et al., Biochem. 32: 1180-1187 (1993); Kobayashi et al. Protein Eng. 12(10):879-884 (1999); and Burks et al. Proc. Natl. Acad. Sci. USA 94:412-417 (1997)).
- nucleic acids For nucleic acids, the term "substantial homology" indicates that two nucleic acids, or designated sequences thereof, when optimally ahgned and compared, are identical, with appropriate nucleotide insertions or deletions, in at least about 80% of the nucleotides, at least about 90% to 95%, or at least about 98% to 99.5% of the nucleotides. Alternatively, substantial homology exists when the segments will hybridize under selective hybridization conditions, to the complement of the strand.
- polypeptides the term “substantial homology” indicates that two polypeptides, or designated sequences thereof, when optimally aligned and compared, are identical, with appropriate amino acid insertions or deletions, in at least about 80% of the amino acids, at least about 90% to 95%, or at least about 98% to 99.5% of the amino acids.
- the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm, as described in the non-limiting examples below.
- the percent identity between two nucleotide sequences can be determined using the GAP program in the GCG software package (available at worldwideweb.gcg.com), using a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80 and a length weight of 1, 2, 3, 4, 5, or 6.
- the percent identity between two nucleotide or amino acid sequences can also be determined using the algorithm of E. Meyers and W. Miller ( CABIOS , 4: 11-17 (1989)) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
- the percent identity between two amino acid sequences can be determined using the Needleman and Wunsch (J. Mol. Biol. (48):444- 453 (1970)) algorithm which has been incorporated into the GAP program in the GCG software package (available at http://www.gcg.com), using either a Blossum 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or 6.
- nucleic acid and protein sequences described herein can further be used as a "query sequence" to perform a search against public databases to, for example, identify related sequences.
- Such searches can be performed using the NBLAST and XBLAST programs (version 2.0) of Altschul, et al. (1990) J. Mol. Biol. 215:403-10.
- Gapped BLAST can be utilized as described in Altschul et al. , (1997) Nucleic Acids Res.
- the nucleic acids can be present in whole cells, in a cell lysate, or in a partially purified or substantially pure form.
- a nucleic acid is "isolated” or “rendered substantially pure” when purified away from other cellular components or other contaminants, e.g., other cellular nucleic acids (e.g., the other parts of the chromosome) or proteins, by standard techniques, including alkaline/SDS treatment, CsCl banding, column chromatography, agarose gel electrophoresis and others well known in the art. See, F. Ausubel, et al. , ed.
- Nucleic acids e.g., cDNA
- cDNA can be mutated, in accordance with standard techniques to provide gene sequences.
- these mutations can affect amino acid sequence as desired.
- these mutations can affect amino acid sequence as desired.
- DNA sequences substantially homologous to or derived from native V, D, J, constant, switches and other such sequences described herein are contemplated (where "derived” indicates that a sequence is identical or modified from another sequence).
- vector is intended to refer to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
- plasmid refers to a circular double stranded DNA loop into which additional DNA segments can be ligated.
- viral vector Another type of vector is a viral vector, wherein additional DNA segments can be ligated into the viral genome.
- Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors).
- vectors e.g., non-episomal mammalian vectors
- vectors can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome.
- certain vectors are capable of directing the expression of genes to which they are operatively linked.
- Such vectors are referred to herein as "recombinant expression vectors" (or simply, "expression vectors")
- expression vectors of utility in recombinant DNA techniques are often in the form of plasmids.
- plasmid and vector can be used interchangeably as the plasmid is the most commonly used form of vector.
- viral vectors e.g, replication defective retroviruses, adenoviruses and adeno-associated viruses
- recombinant host cell (or simply “host cell”), as used herein, is intended to refer to a cell that comprises a nucleic acid that is not naturally present in the cell, and can be a cell into which a recombinant expression vector has been introduced. It should be understood that such terms are intended to refer not only to the particular subject cell but to the progeny of such a cell. Because certain modifications can occur in succeeding generations due to either mutation or environmental influences, such progeny cannot, in fact, be identical to the parent cell, but are still included within the scope of the term "host cell” as used herein.
- an "immune response” is as understood in the art, and generally refers to a biological response within a vertebrate against foreign agents or abnormal, e.g., cancerous cells, which response protects the organism against these agents and diseases caused by them.
- An immune response is mediated by the action of one or more cells of the immune system (for example, a T lymphocyte, B lymphocyte, natural killer (NK) cell, macrophage, eosinophil, mast cell, dendritic cell or neutrophil) and soluble macromolecules produced by any of these cells or the liver (including antibodies, cytokines, and complement) that results in selective targeting, binding to, damage to, destruction of, and/or elimination from the vertebrate's body of invading pathogens, cells or tissues infected with pathogens, cancerous or other abnormal cells, or, in cases of autoimmunity or pathological inflammation, normal human cells or tissues.
- a T lymphocyte, B lymphocyte, natural killer (NK) cell for example, a T lymphocyte, B lymphocyte, natural killer (NK) cell, macrophage, eosinophil, mast cell, dendritic cell or neutrophil
- soluble macromolecules produced by any of these cells or the liver (including antibodies, cytokines, and complement) that results
- An immune reaction includes, e.g., activation or inhibition of a T cell, e.g., an effector T cell, a Th cell, a CD4 + cell, a CD8 + T cell, or a Treg cell, or activation or inhibition of any other cell of the immune system, e.g., NK cell.
- an “immunomodulator” or “immunoregulator” refers to an agent, e.g., an agent targeting a component of a signaling pathway that can be involved in modulating, regulating, or modifying an immune response.
- “Modulating,” “regulating,” or “modifying” an immune response refers to any alteration in a cell of the immune system or in the activity of such cell (e.g, an effector T cell, such as a Thl cell).
- modulation includes stimulation or suppression of the immune system which can be manifested by an increase or decrease in the number of various cell types, an increase or decrease in the activity of these cells, or any other changes which can occur within the immune system.
- Both inhibitory and stimulatory immunomodulators have been identified, some of which can have enhanced function in a tumor microenvironment.
- the immunomodulator targets a molecule on the surface of a T cell.
- immunomodulatory target is a molecule, e.g., a cell surface molecule, that is targeted for binding by, and whose activity is altered by the binding of, a substance, agent, moiety, compound or molecule.
- Immunomodulatory targets include, for example, receptors on the surface of a cell (“immunomodulatory receptors") and receptor ligands ("immunomodulatory ligands").
- Immunotherapy refers to the treatment of a subject afflicted with, or at risk of contracting or suffering a recurrence of, a disease by a method comprising inducing, enhancing, suppressing or otherwise modifying the immune system or an immune response.
- Immuno stimulating therapy or “inununo stimulatory therapy” refers to a therapy that results in increasing (inducing or enhancing) an immune response in a subject for, e.g., treating cancer.
- Patentiating an endogenous immune response means increasing the effectiveness or potency of an existing immune response in a subject. This increase in effectiveness and potency can be achieved, for example, by overcoming mechanisms that suppress the endogenous host immune response or by stimulating mechanisms that enhance the endogenous host immune response.
- T eff T effector cells refers to T cells (e.g., CD4 + and CD8 + T cells) with cytolytic activities as well as T helper (Th) cells, e.g., Thl cells, which cells secrete cytokines and activate and direct other immune cells, but does not include regulatory T cells (Treg cells).
- Th T helper
- T eff cells e.g., CD4 + and CD8 + T eff cells and Thl cells.
- An increased ability to stimulate an immune response or the immune system can result from an enhanced agonist activity of T cell co-stimulatory receptors and/or an enhanced antagonist activity of inhibitory receptors.
- An increased ability to stimulate an immune response or the immune system can be reflected by a fold increase of the EC 50 or maximal level of activity in an assay that measures an immune response, e.g, an assay that measures changes in cytokine or chemokine release, cytolytic activity (determined directly on target cells or indirectly via detecting CD 107a or granzymes) and proliferation.
- the ability to stimulate an immune response or the immune system activity can be enhanced by at least 10%, 30%, 50%, 75%, 2 fold, 3 fold, 5 fold or more.
- the term "linked” refers to the association of two or more molecules.
- the linkage can be covalent or non-covalent.
- the linkage also can be genetic (i.e., recombinantly fused). Such linkages can be achieved using a wide variety of art recognized techniques, such as chemical conjugation and recombinant protein production.
- administering refers to the physical introduction of a composition comprising a therapeutic agent to a subject, using any of the various methods and delivery systems known to those skilled in the art.
- Different routes of administration for the anti-TIM3 antibodies described herein include intravenous, intraperitoneal, intramuscular, subcutaneous, spinal or other parenteral routes of administration, for example by injection or infusion.
- parenteral administration means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intraperitoneal, intramuscular, intraarterial, intrathecal, intralymphatic, intralesional, intracapsular, intraorbital, intracardiac, intradermal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrastemal injection and infusion, as well as in vivo electroporation.
- an antibody described herein can be administered via a non-parenteral route, such as a topical, epidermal or mucosal route of administration, for example, intranasally, orally, vaginally, rectally, sublingually or topically.
- Administering can also be performed, for example, once, a plurality of times, and/or over one or more extended periods.
- T cell-mediated response refers to a response mediated by T cells, including effector T cells (e.g., CD8 + cells) and helper T cells (e.g., CD4 + cells).
- T cell mediated responses include, for example, T cell cytotoxicity and proliferation.
- cytotoxic T lymphocyte (CTL) response refers to an immune response induced by cytotoxic T cells. CTL responses are mediated primarily by CD8 + T cells.
- inhibits or “blocks” (e.g., referring to inhibition/blocking of binding of TIM3-L to TIM3 on cells) are used interchangeably and encompass both partial and complete
- the anti-TIM3 antibody inhibits binding of TIM3-L to TIM3 by at least about 50%, for example, about 60%, 70%, 80%, 90%, 95%, 99%, or 100%, determined, e.g., as further described herein. In some embodiments, the anti-TIM3 antibody inhibits binding of TIM3-L to ⁇ M3 by no more than 50%, for example, by about 40%, 30%, 20%, 10%, 5% or 1%, determined, e.g., as further described herein.
- the phrase "inhibits growth of a tumor” includes any measurable decrease in the growth of a tumor, e.g., , the inhibition of growth of a tumor by at least about 10%, for example, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 99%, or 100%.
- cancer refers a broad group of diseases characterized by the uncontrolled growth of abnormal cells in the body. Unregulated cell division can result in the formation of malignant tumors or cells that invade neighboring tissues and can metastasize to distant parts of the body through the lymphatic system or bloodstream.
- treat refers to any type of intervention or process performed on, or administering an active agent to, the subject with the objective of reversing, alleviating, ameliorating, inhibiting, or slowing down or preventing the progression, development, severity or recurrence of a symptom, complication, condition or biochemical indicia associated with a disease or enhancing overall survival.
- Treatment can be of a subject having a disease or a subject who does not have a disease (e.g., for prophylaxis).
- a "hematological malignancy” includes a lymphoma, leukemia, myeloma or a lymphoid malignancy, as well as a cancer of the spleen and the lymph nodes.
- Exemplary lymphomas include both B cell lymphomas (a B-cell hematological cancer) and T cell lymphomas.
- B-cell lymphomas include both Hodgkin's lymphomas and most non-Hodgkin's lymphomas.
- Non-limiting examples of B cell lymphomas include diffuse large B-cell lymphoma, follicular lymphoma, mucosa-associated lymphatic tissue lymphoma, small cell lymphocytic lymphoma (overlaps with chronic lymphocytic leukemia), mantle cell lymphoma (MCL), Burkitt's lymphoma, mediastinal large B cell lymphoma, Waldenstrom macroglobulinemia, nodal marginal zone B cell lymphoma, splenic marginal zone lymphoma, intravascular large B-cell lymphoma, primary effusion lymphoma, lymphomatoid granulomatosis.
- T cell lymphomas include extranodal T cell lymphoma, cutaneous T cell lymphomas, anaplastic large cell lymphoma, and angioimmunoblastic T cell lymphoma.
- Hematological malignancies also include leukemia, such as, but not limited to, secondary leukemia, chronic lymphocytic leukemia, acute myelogenous leukemia, chronic myelogenous leukemia, and acute lymphoblastic leukemia.
- Hematological malignancies further include myelomas, such as, but not limited to, multiple myeloma and smoldering multiple myeloma.
- Other hematological and/or B cell- or T-cell -associated cancers are encompassed by the term hematological malignancy.
- an effective dose or “effective dosage” is defined as an amount sufficient to achieve or at least partially achieve a desired effect.
- a “therapeutically effective amount” or “therapeutically effective dosage” of a drug or therapeutic agent is any amount of the drug that, when used alone or in combination with another therapeutic agent, promotes disease regression evidenced by a decrease in severity of disease symptoms, an increase in frequency and duration of disease symptom-free periods, or a prevention of impairment or disability due to the disease affliction.
- a therapeutically effective amount or dosage of a drug includes a "prophylactically effective amount” or a “prophylactically effective dosage”, which is any amount of the drug that, when administered alone or in combination with another therapeutic agent to a subject at risk of developing a disease or of suffering a recurrence of disease, inhibits the development or recurrence of the disease.
- a therapeutic agent to promote disease regression or inhibit the development or recurrence of the disease can be evaluated using a variety of methods known to the skilled practitioner, such as in human subjects during clinical trials, in animal model systems predictive of efficacy in humans, or by assaying the activity of the agent in in vitro assays.
- an anti-cancer agent is a drag that promotes cancer regression in a subject.
- a therapeutically effective amount of the drug promotes cancer regression to the point of eliminating the cancer.
- "Promoting cancer regression” means that administering an effective amount of the drug, alone or in combination with an antineoplastic agent, results in a reduction in tumor growth or size, necrosis of the tumor, a decrease in severity of at least one disease symptom, an increase in frequency and duration of disease symptom-free periods, a prevention of impairment or disability due to the disease affliction, or otherwise amelioration of disease symptoms in the patient.
- the terms "effective” and “effectiveness” with regard to a treatment includes both pharmacological effectiveness and physiological safely.
- Pharmacological effectiveness refers to the ability of the drug to promote cancer regression in the patient.
- Physiological safety refers to the level of toxicity, or other adverse physiological effects at the cellular, organ and/or organism level (adverse effects) resulting from administration of the drug.
- a therapeutically effective amount or dosage of the drug inhibits cell growth or tumor growth by at least about 20%, by at least about 40%, by at least about 60%, or by at least about 80% relative to untreated subjects.
- a therapeutically effective amount or dosage of the drug completely inhibits cell growth or tumor growth, i.e., inhibits cell growth or tumor growth by 100%.
- the ability of a compound to inhibit tumor growth can be evaluated using the assays described infra. Alternatively, this property of a composition can be evaluated by examining the ability of the compound to inhibit cell growth, such inhibition can be measured in vitro by assays known to the skilled practitioner.
- tumor regression can be observed and continue for a period of at least about 20 days, at least about 40 days, or at least about 60 days.
- the term "patient” includes human and other mammalian subjects that receive either prophylactic or therapeutic treatment.
- the term "subject” includes any human or non-human animal.
- the methods and compositions described herein can be used to treat a subject having cancer.
- non-human animal includes all vertebrates, e.g., mammals and non-mammals, such as non-human primates, sheep, dog, cow, chickens, amphibians, reptiles, etc.
- weight based dose or dosing means that a dose that is administered to a patient is calculated based on the weight of the patient. For example, when a patient with 60 kg body weight requires 3 mg/kg of an anti-TIM3 antibody, one can calculate and use the appropriate amount of the anti-TIM3 antibody (i.e., 180 mg) for administration.
- the use of the term "fixed dose" with regard to a method of the disclosure means that two or more different antibodies in a single composition (e.g., anti-TIM3 antibody and a second antibody, e.g., a PD-1 or PD-L1 antibody) are present in the composition in particular (fixed) ratios with each other.
- the fixed dose is based on the weight (e.g., mg) of the antibodies.
- the fixed dose is based on the concentration (e.g., mg/ml) of the antibodies.
- the ratio of the two antibodies is at least about 1: 1, about 1:2, about 1 :3, about 1 :4, about 1 :5, about 1:6, about 1:7, about 1 :8, about 1 :9, about 1 : 10, about 1 :15, about 1 :20, about 1:30, about 1:40, about 1 :50, about 1:60, about 1:70, about 1:80, about 1:90, about 1 : 100, about 1 : 120, about 1 : 140, about 1 : 160, about 1 :180, about 1:200, about 200: 1, about 180: 1, about 160: 1, about 140: 1, about 120: 1, about 100: 1, about 90: 1, about 80: 1, about 70: 1, about 60: 1, about 50: 1, about 40: 1, about 30: 1, about 20: 1, about 15:1, about 10: 1, about 9: 1, about 8: 1, about 7: 1, about 6: 1, about 5: 1, about 4:1, about 3
- a 2: 1 ratio of an anti-TIM3 antibody and a PD-1 antibody can mean that a vial or an injection can contain about 480 mg of the anti-TIM3 antibody and 240 mg of the anti-PD-1 antibody, or about 2 mg/ml of the anti-TIM3 antibody and 1 mg/ml of the anti-PD-1 antibody.
- flat dose means a dose that is administered to a patient without regard for the weight or body surface area (BSA) of the patient.
- the flat dose is therefore not provided as a mg/kg dose, but rather as an absolute amount of the agent (e.g, the anti-TIM3 antibody).
- the agent e.g, the anti-TIM3 antibody
- a 60 kg person and a 100 kg person would receive the same dose of an antibody (e.g., 480 mg of an anti-TIM3 antibody).
- antibodies e.g., fully human antibodies, which are characterized by particular functional features or properties.
- the antibodies specifically bind human TIM3, and more specifically, a particular domain (e.g., a functional domain) within the extracellular domain of human TIM3.
- the antibodies specifically bind to the site on TIM3 to which TIM3-L binds.
- the antibodies are antagonist antibodies, i.e., they inhibit or suppress the T cell inhibitory activity of TIM3 on cells, e.g., T cells.
- anti-TIM3 antibodies cross-react with TIM3 from one or more non-human primates, such as cynomolgus TIM3.
- the antibodies specifically bind to the extracellular region of human TIM3 and the extracellular region of cynomolgus TIM3.
- the antibodies bind to human TIM3 with high affinity.
- Anti-TIM3 antibodies described herein exhibit one or more of the following functional properties:
- T cell activation e.g., Thl cell activation (as evidenced, e.g., by enhanced cytokine secretion and/or proliferation);
- T cell proliferation e.g., CD4 + , CD8 + T cells, Thl cells, or TILs
- T cell proliferation e.g., CD4 + , CD8 + T cells, Thl cells, or TILs
- coculture assay such as described in the Examples
- T cells e.g., Thl cells or tumor infiltrating lymphocytes (TILs), such as TILs from human renal, lung, pancreatic, or breast cancer tumors, as determined, e.g., in the assay described in the Examples;
- TILs tumor infiltrating lymphocytes
- (m) having the heavy chain and/or light chain variable regions interact with at least 5, 10, 15, 20 or all of the following amino acids of human TIM3: P50, V51, C52, P59, V60, F61, E62, C63, G64, N65, V66, V67, L68, R69, D71, E72, D74, Ri l l, Q113, G116, 1117, Ml 18, D120, and optionally T70 and/or II 12, as determined by X-ray crystallography; and/or
- anti-TIM3 antibodies described herein bind to human TIM3 with high affinity, for example, with a K D of 10 7 M or less, 10 8 M or less, 10 9 M or less, 10 10 M or less, 10 u M or less, 10 12 M or less, 10 12 M to 10 7 M, Kr u M to 1(T 7 M, 10 10 M to 10 7 M, or lO 9 M to 1(T 7 M.
- an anti-TIM3 antibody binds to soluble human ⁇ M3, e.g., as determined by BIACORETM (e.g., as described in the Examples), with a K D of 10 7 M or less, 10 8 M or less, 10 9 M (1 nM) or less, 10 10 M or less, 10 12 M to 10 7 M, 10 U M to 10 7 M, 10 10 M to 10 7 M, 10 9 M to 10 7 M, or 10 8 M to 10 7 M.
- an anti-TIM3 antibody binds to bound (e.g., cell membrane bound) human TIM3, such as on activated human T cells, e.g., as determined by flow cytometry and Scatchard plot, with a K D of 10 7 M or less, 10 8 M or less, 10 9 M (1 nM) or less, 5xlO 10 M or less, 10 10 M or less, 10 12 M to 10 7 M, 10 11 M to 10 8 M, 10 10 Mto 10 8 M, 10 9 M to 10 8 M, 10 n Mto 10 9 M, or 10 10 Mto 10 9 M.
- bound e.g., cell membrane bound
- activated human T cells e.g., as determined by flow cytometry and Scatchard plot
- an anti-TIM3 antibody binds to bound (e.g., cell membrane bound) human TIM3, such as on activated human T cells, e.g., as determined by flow cytometry, with an EC 50 of 10 ug/mL or less, 5 ug/mL or less, 1 ug/mL or less, 0.9 ug/mL or less, 0.8 ug/mL or less, 0.7 ug/mL or less, 0.6 ug/mL or less, 0.5 ug/mL or less, 0.4 ug/mL or less, 0.3 ug/mL or less, 0.2 ug/mL or less, 0.1 ug/mL or less, 0.05 ug/mL or less, or 0.01 ug/mL or less.
- bound e.g., cell membrane bound
- an EC 50 10 ug/mL or less, 5 ug/mL or less, 1 ug/mL or less,
- anti-TIM3 antibodies described herein bind to cyno TIM3, for example, with a K D of 10 7 M or less, 10 8 M or less, 10 9 Morless, 10 10 Morless, 10 n Morless, 10 12 Morless, 10 12 Mto 10 7 M, 10 n Mto 10 7 M, 10 10 M to 10 7 M, or 10 9 M to 10 7 M.
- an anti-TIM3 antibody binds to soluble cyno TIM3, e.g., as determined by BIACORETM (e.g., as described in the Examples), with a K D of 10 7 M or less, 10 8 M or less, 10 9 M ( 1 nM) or less, 10 10 M or less, 10 12 Mto 10 7 M, 10 _11 Mto 10 7 M, 10- 10 Mto 10 7 M, 10 9 Mto 10 7 M, or 10 8 M to 10 7 M.
- Anti-TIM3 antibodies can bind to membrane bound cynomolgus TIM3, e.g., with an EC 50 of 100 nM or less, 10 nM or less, 100 nM to 0.01 nM, 100 nM to 0.1 nM, 100 nM to 1 nM, or 10 nM to 1 nM, e.g., as measured by flow cytometry (e.g., as described in the Examples).
- an anti-TIM3 antibody binds to bound (e.g., cell membrane bound) cyno TIM3, such as on activated human T cells, e.g., as determined by flow cytometry and Scatchard plot, with a K D of 10 7 M or less, 10 8 M or less, 10 9 M (1 nM) or less, 5xlO 10 M or less, 10 _1 °M or less, 10 12 Mto 10 _7 M, 10 n Mto 10 _8 M, 10 10 Mto 10 _8 M, 10 _9 Mto 10 _8 M, 10 n Mto 10 9 M, or 10 10 Mto 10 9 M.
- bound e.g., cell membrane bound
- activated human T cells e.g., as determined by flow cytometry and Scatchard plot
- anti-TIM3 antibodies described herein stimulate or enhance an immune response, e.g., by activating T cells, e.g., in the tumor.
- the anti-TEVB antibodies can activate or costimulate cells, as evidenced, e.g., by enhanced cytokine (e.g., IFN-g) secretion and/or enhanced proliferation, which may result from the inhibition of TIM3 mediated T cell inhibitory activity.
- T cell activation or co-stimulation by a TIM3 antibody occurs in the presence of CD3 stimulation.
- an anti-TIM3 antibody increases IFN-g secretion by a factor of 50%, 100% (i.e., 2 fold), 3 fold, 4 fold, 5 fold or more, optionally with a maximum of up to 10 fold, 30 fold, 100 fold, as measured, e.g., on primary human T cells and/or T cells expressing human TIM3, such as tumor infiltrating lymphocytes (TILs).
- TILs tumor infiltrating lymphocytes
- anti-TIM3 antibodies inhibit binding of phosphatidylserine to human ⁇ M3 on cells, e.g., CHO cells or activated T cells expressing human TIM3, e.g., with an EC 50 of 10 pg/ml or less, 1 pg/ml or less, 0.01 pg/ml to 10 pg/ml.0.1 pg/ml to 10 pg/ml, or 0.1 pg/ml to 1 pg/ml.
- anti-TEVB antibodies described herein bind to an epitope, e.g., a conformational epitope, in the extracellular portion of human TIM3, e.g., in the Ig like domain of the extracellular region, i.e., amino acids 22 to 202 of SEQ ID NO: 286 (FIG.25).
- an anti- TIM3 antibody binds to an epitope located within amino acids 22 to 120 of human TIM3 extracellular domain (SEQ ID NO: 286) or 1-99 of mature human TIM3 (SEQ ID NO: 290) (see Examples).
- an anti-TEVB antibody binds to, or to an epitope within, a region consisting of amino acids 58-64 of human TIM3 having SEQ ID NO: 286, which corresponds to amino acid residues 37-43 of mature human TIM3 (CPVFECG, SEQ ID NO: 296; see FIG.25).
- an anti-TEVB antibody binds to, or to an epitope within, a region consisting of amino acids 111-120 of human TIM3 having SEQ ID NO: 286, which corresponds to amino acid residues 90-99 of mature human TIM3 (RIQIPGIMND, SEQ ID NO: 298; see FIG. 25).
- an anti-TIM3 antibody binds to, or to an epitope within, a region consisting of a region consisting of amino acids 58-64 of human TIM3 having SEQ ID NO: 286 (CPVFECG, SEQ ID NO:
- an anti-TIM3 antibody binds to, or to an epitope within, a region consisting of amino acids 78-89 of human TIM3 having SEQ ID NO: 286, which corresponds to amino acid residues 57-83 of mature human TIM3 (WTSRYWLNGDFR, SEQ ID NO: 297; see FIG. 25).
- an anti-TIM3 antibody binds to substantially the same epitope as that of 13 A3, i.e., an epitope (or region of human TIM3) comprising one or more of amino acid residues C58, P59,
- an anti-TIM3 antibody binds to an epitope (or region of human TIM3) comprising one or more of amino acid residues C58, P59, F61, E62, C63, D 104, Ril l, Q113 and D120 of SEQ ID NO: 286 (FIG. 25).
- an anti-TIM3 antibody does not bind significantly, or only with significantly reduced binding affinity, to a human TIM3 protein in which one or more of amino acid residues C58, P59, F61, E62, C63, R111, and D120 of SEQ ID NO: 286 is changed to another amino acid, e.g., in a non-conservative amino acid substitution.
- an anti-TIM3 antibody does not bind significantly, or only with significantly reduced binding affinity, to a human TIM3 protein in which one or more of amino acid residues C58, P59, F61, E62, C63, D104, R111, Q113 and D120 of SEQ ID NO: 286 is changed to another amino acid, e.g., in a non-conservative amino acid substitution.
- an anti-TIM3 antibody binds to substantially the same epitope as that of 3G4, i. e., an epitope (or region of human TIM3) comprising one or more of amino acids residues C58, P59,
- an anti-TIM3 antibody binds to an epitope (or region of human TIM3) comprising one or more of amino acid residues C58, P59, V60, F61, E62, C63, D104, G116, and M118 of SEQ ID NO: 286 (FIG. 25).
- an anti-TIM3 antibody does not bind significantly, or only with significantly reduced binding affinity, to a human TIM3 protein in which one or more of amino acid residues C58, P59, V60, F61, E62, C63, G116, and Ml 18 of SEQ ID NO: 286 is changed to another amino acid, e.g., in a non-conservative amino acid substitution.
- an anti-TIM3 antibody does not bind significantly, or only with significantly reduced binding affinity, to a human TIM3 protein in which one or more of amino acid residues C58, P59, V60, F61, E62, C63, D104, G116, and Ml 18 of SEQ ID NO: 286 is changed to another amino acid, e.g., in a non-conservative amino acid substitution.
- an anti-TEVB antibody binds to substantially the same epitope as that of 17C3, i.e., an epitope (or region of human TIM3) comprising one or more of amino acids residues C58, P59, V60, F61, E62, C63, G64, and G116 of SEQ ID NO: 286 (FIG. 25).
- an anti-TIM3 antibody binds to an epitope (or region of human TIM3) comprising one or more of amino acid residues C58, P59, V60, F61, E62, C63, G64, D104, and G116 of SEQ ID NO: 286 (FIG. 25).
- an anti- TIM3 antibody does not bind significantly, or only with significantly reduced binding affinity, to a human TIM3 protein in which one or more of amino acid residues C58, P59, V60, F61, E62, C63, G64, and G116 of SEQ ID NO: 286 is changed to another amino acid, e.g., in a non-conservative amino acid substitution.
- an anti-TIM3 antibody does not bind significantly, or only with significantly reduced binding affinity, to a human TIM3 protein in which one or more of amino acid residues C58, P59, V60, F61, E62, C63, G64, D104, and G116 of SEQ ID NO: 286 is changed to another amino acid, e.g., in a non-conservative amino acid substitution.
- an anti-TIM3 antibody binds to substantially the same epitope as that of 8B9, i.e., an epitope (or region of human TIM3) comprising one or more of amino acids residues L48, W78,
- an anti-TIM3 antibody binds to an epitope (or region of human TIM3) comprising one or more of amino acid residues L48, W78, S80, R81, W83, L84, G86, D87, and R89 of SEQ ID NO: 286 (FIG. 25).
- an anti- TIM3 antibody binds to substantially the same epitope as that of 8B9, i.e., an epitope (or region of human TIM3) comprising one or more of amino acids residues L48, W78, S80, R81, W83, G86, D87, R89, and D104 of SEQ ID NO: 286 (FIG. 25).
- an anti-TIM3 antibody does not bind significantly, or only with significantly reduced binding affinity, to a human TIM3 protein in which one or more of amino acid residues L48, W78, S80, R81, W83, G86, D87, and R89 of SEQ ID NO: 286 (FIG.
- an anti-TIM3 antibody does not bind significantly, or only with significantly reduced binding affinity, to a human TIM3 protein in which one or more of amino acid residues L48, W78, S80, R81, W83, L84, G86, D87, and R89 of SEQ ID NO: 286 (FIG. 25) is changed to another amino acid, e.g., in a non-conservative amino acid substitution.
- an anti-TIM3 antibody does not bind significantly, or only with significantly reduced binding affinity, to a human TIM3 protein in which one or more of amino acid residues L48, W78, S80, R81, W83, G86, D87, R89, and D 104 of SEQ ID NO: 286 (FIG. 25) is changed to another amino acid, e.g., in a non-conservative amino acid substitution.
- anti-TIM3 antibodies compete for binding to human TIM3 with (or inhibit binding of) anti-TIM3 antibodies comprising CDRs or variable regions described herein, e.g., those of antibodies 13A3, 3G4, 17C3, 17C8, 9F6, 8B9, 8C4, 14H7, 23B3, and any of TIM3.2 to TIM3.18, TIM3.20, TIM3.21, TIM3.22, TIM3.23, TIM3.24, and TIM3.25.
- anti-TIM3 antibodies inhibit binding of antibodies 13A3, 3G4, 17C3, 17C8, 9F6, 8B9, 8C4, 14H7, 23B3, or any of TIM3.2 to TIM3.18, TIM3.20, TIM3.21, TIM3.22, TIM3.23, TIM3.24, and TIM3.25 to human TIM3 by at least 50%, 60%, 70%, 80%, 90% or by 100%.
- anti-TIM3 antibodies inhibit binding of 13A3, 3G4, 17C3, 17C8, 9F6, 8B9, 8C4, 14H7, 23B3, or any of TIM3.2 to TIM3.18, TIM3.20, TIM3.21, TIM3.22, TIM3.23, ⁇ M3.24, and TIM3.25 to human TIM3 by at least 50%, 60%, 70%, 80%, 90% or by 100% and 13A3, 3G4, 17C3, 17C8, 9F6, 8B9, 8C4, 14H7, 23B3, or any of ⁇ M3.2 to TIM3.18, TIM3.20, TIM3.21, TIM3.22, TIM3.23, TIM3.24, and TIM3.25 inhibit binding of the aiUi-TIM3 antibodies to human TIM3 by at least 50%, 60%, 70%, 80%, 90% or by 100% (e.g., compete in both directions).
- anti-TIM3 antibodies have 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or all of the following features:
- binding to membrane bound human TIM3 e.g., with an EC 50 of 1 ug/mL or less (e.g., 0.01 ug/mL to 1 ug/mL), e.g., as measured by flow cytometry (e.g., as described in the Examples);
- inducing or enhancing T cell activation e.g., by blocking or reducing the inhibitory effects of TIM3
- TIM3 -expressing T cells e.g., Thl cells or TILs
- enhanced proliferation of TIM3 expressing T cells e.g., Thl cells or TILs
- MLR mixed lymphocyte reaction
- mRIQIPGIMNDEKFNLKL 127 (SEQ ID NO: 368) as determined by HDX-MS, e.g., as described in the Examples;
- VPVCWGKGACPVFE 62 (SEQ ID NO: 367), 1U RIQIPGIMNDEKFNLKL 127 (SEQ ID NO: 368) and 119 NDEKFNLKL 127 (SEQ ID NO: 373), as determined by HDX-MS, as described in the Examples; and/or (c) competing with or cross-blocking with the binding to human TIM3 of 13 A3 or TIM3.18.IgG1.3, e.g., as described in the Examples;
- an antibody that exhibits one or more of these functional properties e.g., biochemical, immunochemical, cellular, physiological or other biological activities, or the like
- these functional properties e.g., biochemical, immunochemical, cellular, physiological or other biological activities, or the like
- anti-TIM3 antibody -induced increases in a measured parameter effects a statistically significant increase by at least 10% of the measured parameter, e.g., by at least 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 100% (i.e., 2 fold), 3 fold, 5 fold or 10 fold, and in some embodiments, an antibody described herein can increase the measured parameter, e.g., by greater than 92%, 94%, 95%, 97%,
- anti-TIM3 antibody-induced decreases in a measured parameter e.g., tumor volume, TIM3-L binding to human TIM3 in a given assay effects a statistically significant decrease by at least 10% of the measured parameter, e.g., by at least 20%, 30%, 40%, 50%, 60%, 70%, 80% or 90%, and in some embodiments, an antibody described herein can decrease the measured parameter, e.g. , by greater than 92%, 94%, 95%, 97%, 98% or 99%, relative to the same assay conducted in the absence of the antibody.
- Standard assays to evaluate the binding ability of the antibodies toward TIM3 of various species are known in the art, including for example, ELISAs, Western blots, and RIAs. Suitable assays are described in detail in the Examples.
- the binding kinetics (e.g., binding affinity) of the antibodies can also be assessed by standard assays known in the art, such as by Biacore analysis.
- Assays to evaluate the effects of the antibodies on functional properties of TIM3 e.g., ligand binding, T cell proliferation, cytokine production
- anti-TIM3 antibodies are not native antibodies or are not naturally- occurring antibodies.
- anti-TIM3 antibodies have post-translational modifications that are different from those of antibodies that are naturally-occurring, such as by having more, less or a different type of post- translational modification.
- anti-TIM3 antibodies do not have agonist activity, as determined, e.g., in cross-linking of anti-TIM3 antibodies in CHO-OKT3-CD32:T cell co-culture experiments, in which such antibodies do not enhance activity beyond anti-TIM3 alone.
- anti-TIM3 antibodies block the interaction of TIM3 with its ligand without promoting agonist activity.
- anti-TIM3 antibodies enhance IL-12 production from monocytes or dendritic cells treated with LPS.
- anti-TIM3 antibodies revive tumor infiltrating CD8 + T cells that co-express PD-1 and TIM3 by combined treatment, hence avoiding depletion of CD8 + T cells.
- Particular anti-TIM3 antibodies described herein are antibodies, e.g., monoclonal, recombinant, and/or human antibodies, having the CDR and/or variable region sequences of antibodies 13 A3, 3G4, 17C3, 17C8, 9F6, 8B9, 8C4, 14H7, 23B3, or any one of TIM3.2 to TIM3.18, TIM3.20, TIM3.21, TIM3.22, TIM3.23, TIM3.24, and TIM3.25, isolated and structurally characterized as described herein, as well as antibodies having at least 80% identity (e.g., at least 85%, at least 90%, at least 95%, or at least 99% identity) to their variable region or CDR sequences.
- VH amino acid sequences of 13A3, 8B9, 8C4, 17C3, 9F6, 3G4, 17C8, 14H7, and 23B3 are set forth in SEQ ID NOs: 34-40, 410, and 411, respectively.
- the VH amino acid sequences of mutated versions of 13A3, 8B9, 9F6, and 23B3 are set forth in SEQ ID NOs: 112-121, 364, and 412.
- the VH amino acid sequences of TIM3.20, and TIM3.21 are set forth in SEQ ID NO: 449.
- the VH amino acid sequences of TIM3.22 and TIM3.23 are set forth in SEQ ID NO: 456.
- the VL amino acid sequences of 13 A3, 17C3, and 3G4 are set forth in SEQ ID NO: 60.
- the VL amino acid sequences of 8B9, 8C4, and 17C8 are set forth in SEQ ID NO: 61.
- the VL amino acid sequence of 9F6 are set forth in SEQ ID NOs: 61, 62, and 63.
- the VL amino acid sequences of 14H7 are set forth in SEQ ID NO: 417.
- the VL amino acid sequences of 23B3 are set forth in SEQ ID NOs: 60 and 418.
- the VL amino acid sequences of the mutated versions of 13 A3, 8B9 9F6, and 23B3 are those of the corresponding nonmutated antibodies.
- VL amino acid sequences of TIM3.20 and TIM3.22 are set forth in SEQ ID NO: 450.
- the VL amino acid sequences of TIM3.21 and ⁇ M3.23 are set forth in SEQ ID NO: 63.
- a summary of the identity of SEQ ID NOs is provided in FIG. 16.
- isolated antibodies, or antigen binding portion thereof comprising heavy and light chain variable regions, wherein the heavy chain variable region comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 34-40, 112-121, 364, 410-412, 449, and 456.
- isolated antibodies, or antigen binding portions thereof comprising heavy and light chain variable regions, wherein the light chain variable region comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 60-63, 417, 418, and 450.
- anti-human TIM3 antibodies or antigen binding portion thereof, comprising:
- Anti-TIM3 antibodies can comprise the heavy and light chain CDRls, CDR2s and CDR3s of 13A3, 8B9, 8C4, 17C3, 9F6, 3G4, 17C8, 14H7, 23B3, or any one of TIM3.2 to TIM3.18, TIM3.20, TIM3.21, TIM3.22, TIM3.23, TIM3.24, or TIM3.25, or combinations thereof.
- the amino acid sequences of the VH CDRls of 13A3, 8B9, 8C4, and 17C3 are set forth in SEQ ID NOs: 41-44, respectively.
- the amino acid sequences of the VH CDRls of 9F6, 3G4, 17C8, 14H7, and 23B3 are set forth in SEQ ID NO 45.
- the amino acid sequence of the VH CDR1 of the mutated 13A3 antibodies ⁇ i.e., TIM3.10-TIM3.18) is the same as that of the nonmutated 13A3 antibody, i.e., SEQ ID NO: 41.
- the amino acid sequence of the VH CDR1 of the mutated 8B9 antibody ⁇ i.e., TIM3.8) is the same as that of the nonmutated 8B9 antibody, i.e., SEQ ID NO: 42.
- the amino acid sequence of the VH CDR1 of the mutated 9F6 antibody ⁇ i.e., TIM3.7) is the same as that of the nonmutated 9F6 antibody, i.e., SEQ ID NO: 45.
- the amino acid sequence of the VH CDR1 of the mutated 23B3 antibody i.e., TIM3.25) is the same as that of the nonmutated 23B3 antibody, i.e., SEQ ID NO: 45.
- the amino acid sequences of the VH CDR2s of 13A3, 8B9, 8C4, 17C3, 9F6, 3G4, 17C8, 14H7, and 23B3 are set forth in SEQ ID NOs: 46-52, 413, and 415, respectively.
- the amino acid sequence of the VH CDR2s of the mutated 13 A3 antibodies TIM3.10, TIM3.17, and TIM3.18 is set forth in SEQ ID NO: 122.
- the amino acid sequence of the VH CDR2s of the mutated 13A3 antibodies TIM3.11 and ⁇ M3.12 are set forth in SEQ ID NOs: 123 and 124, respectively.
- the amino acid sequence of the VH CDR2 of the mutated 13A3 antibodies TIM3.13 and TIM3.16 is that of the nonmutated 13A3 antibody, i.e., SEQ ID NO: 46.
- the amino acid sequence of the VH CDR2 of the mutated 8B9 antibody i.e., TIM3.8
- SEQ ID NO: 125 The amino acid sequence of the VH CDR2 of the mutated 9F6 antibody (i.e., TIM3.7) is the same as that of the nonmutated 9F6 antibody, i.e., SEQ ID NO: 50.
- the amino acid sequence of the VH CDR2 of the mutated 23B3 antibody i.e., TIM3.25) is the same as that of the nonmutated 23B3 antibody, i.e., SEQ ID NO: 415.
- the amino acid sequences of the VH CDR3s of 13A3, 8B9, 8C4, 17C3, 9F6, 3G4, 17C8, 14H7, and 23B3 are set forth in SEQ ID NOs: 53-59, 414, and 416, respectively.
- the amino acid sequence of the VH CDR3s of the mutated 13A3 antibodies TIM3.10 to TIM3.12 is that of the nonmutated 13A3 antibody, i.e., SEQ ID NO: 53.
- the amino acid sequence of the VH CDR3s of the mutated 13A3 antibodies TIM3 13 and TIM3.18 is set forth in SEQ ID NO: 126.
- the amino acid sequence of the VH CDR3s of the mutated 13A3 antibodies TIM3.15 and TIM3.17 is set forth in SEQ ID NO: 128.
- the amino acid sequences of the VH CDR3s of the mutated 13A3 antibodies TIM3.14 and TIM3.16 are set forth in SEQ ID NOs: 127 and 129, respectively.
- the amino acid sequence of the VH CDR3 of the mutated 8B9 antibody i.e., TIM3.8
- the amino acid sequence of the VH CDR3 of the mutated 9F6 antibody (i.e., TIM3.7) is the same as that of the nonmutated 9F6 antibody, i.e., SEQ ID NO: 57.
- the amino acid sequence of the VH CDR3 of the mutated 23B3 antibody (i.e., TIM3.25) is the same as that of the nonmutated 23B3 antibody, i.e., SEQ ID NO: 416.
- the amino acid sequences of the VL CDRls of 13A3, 8B9, 8C4, 17C3, 3G4, 17C8, 14H7, and 23B3 are set forth in SEQ ID NO: 64.
- the amino acid sequences of the VL CDR1 of 9F6 is set forth in SEQ ID NOs: 64 and 65.
- the amino acid sequences of the VL CDR2s of 13A3, 8B9, 8C4, 17C3, 3G4, 17C8, 14H7, and 23B3 are set forth in SEQ ID NO: 66.
- the amino acid sequences of the VL CDR2 of 9F6 is set forth in SEQ ID NOs: 66 and 67.
- the amino acid sequences of the VL CDR3s of 13A3, 17C3, and 3G4 are set forth in SEQ ID NO: 68.
- the amino acid sequences of the VL CDR3s of 8B9, 8C4, 17C8, and 14H7 are set forth in SEQ ID NO: 69.
- the amino acid sequences of the VL CDR3 of 9F6 are set forth in SEQ ID NOs: 69, 70, and 71.
- the amino acid sequences of the VL CDR3 of 23B3 are set forth in SEQ ID NOs: 68 and 419.
- the amino acid sequences of the VL CDRs of the mutated antibodies 13A3, 8B9, 9F6, and 23B3 are those of the corresponding nonmutated antibodies.
- FIG. 16 provides a list of the SEQ ID NOs for the CDRs of anti-TIM3 antibodies described herein.
- the CDR regions are delineated using the Kabat system (Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242).
- Kabat system is the most common numbering system for a scheme called the EU index or EU numbering system, which is based on the sequential numbering of the first human IgGl sequenced (the EU antibody; Edelman et al. 1969). Based on the Kabat numbering scheme disclosed herein, the antibody numbering can be converted into other systems known in the art, e.g., Chotia, IMGT, Martin (enhanced Chothia), or AHo numbering scheme.
- VH CDR1, 2 and 3 sequences and VL CDR1, 2 and 3 sequences can be "mixed and matched" (i.e., CDRs from different antibodies can be mixed and match, although each antibody must contain a VH CDR1, 2 and 3 and a VL CDR1, 2 and 3) to create other anti-TIM3 binding molecules described herein.
- TIM3 binding of such "mixed and matched" antibodies can be tested using the binding assays described above and in the Examples (e.g., ELISAs).
- the CDR1, CDR2 and/or CDR3 sequence from a particular VH sequence is replaced with a structurally similar CDR sequence(s).
- VL CDR sequences are mixed and matched, the CDR1, CDR2 and/or CDR3 sequence from a particular VL sequence is replaced with a structurally similar CDR sequence(s).
- VH and VL sequences can be created by substituting one or more VH and/or VL CDR region sequences with structurally similar sequences from the CDR sequences disclosed herein for monoclonal antibodies 13A3, 8B9, 8C4, 17C3, 9F6, 3G4, 17C8, 14H7, 23B3, and any one of TIM3.2 to ⁇ M3.18, TIM3.20, ⁇ M3.21, TIM3.22, TIM3.23, TIM3.24, and TIM3.25.
- anti-human TIM3 antibodies or antigen binding portion thereof comprising:
- a heavy chain variable region CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 41-45 and 469;
- a heavy chain variable region CDR2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 46-52,122-125, 413, 415, and 470;
- a heavy chain variable region CDR3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 53-59, 126-129, 414, 416, and 471;
- a light chain variable region CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 64-65 and 472;
- a light chain variable region CDR2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 66-67 and 473;
- a light chain variable region CDR3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 68-71, 419, and 474;
- the antibody specifically binds to human TIM3.
- the anti-human TIM3 antibody comprises heavy and light chain variable regions, wherein the heavy chain variable region CDR1, CDR2, and CDR3 regions comprise:
- the antibody specifically binds to human TIM3.
- the anti-human TIM3 antibody comprises heavy and light chain variable regions, wherein the light chain variable region CDR1, CDR2, and CDR3 regions comprise:
- the antibody specifically binds to human TIM3.
- the anti-TIM3 antibody comprises heavy and light chain variable regions, wherein:
- the heavy chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 41, 46, 53, respectively, and the light chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 64, 66, 68, respectively;
- the heavy chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 41, 122, 53, respectively, and the light chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 64, 66, 68, respectively;
- the heavy chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 41, 123, 53, respectively, and the light chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 64, 66, 68, respectively;
- the heavy chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 41, 124, 53, respectively, and the light chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 64, 66, 68, respectively;
- the heavy chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 41, 46, 126, respectively, and the light chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 64, 66, 68, respectively;
- the heavy chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 41, 46, 127, respectively, and the light chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 64, 66, 68, respectively;
- the heavy chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 41, 46, 128, respectively, and the light chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 64, 66, 68, respectively;
- the heavy chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 41, 46, 129, respectively, and the light chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 64, 66, 68, respectively;
- the heavy chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 41, 122, 128, respectively, and the light chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 64, 66, 68, respectively;
- the heavy chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 41, 122, 126, respectively, and the light chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 64, 66, 68, respectively;
- the heavy chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 42, 47, 54, respectively, and the light chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 64, 66, 69, respectively;
- the heavy chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 42, 125, 54, respectively, and the light chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 64, 66, 69, respectively;
- the heavy chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 43, 48, 55, respectively, and the light chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 64, 66, 69, respectively;
- the heavy chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 44, 49, 56, respectively, and the light chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 64, 66, 68, respectively;
- the heavy chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 45, 50, 57, respectively, and the light chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 64, 66, 69, respectively;
- the heavy chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 45, 50, 57, respectively, and the light chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 64, 66, 71, respectively;
- the heavy chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 45, 50, 57, respectively, and the light chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 65, 67, 70, respectively;
- the heavy chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 45, 51, 58, respectively, and the light chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 64, 66, 68, respectively;
- the heavy chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 45, 52, 59, respectively, and the light chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 64, 66, 69, respectively;
- the heavy chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 45, 413, 414, respectively, and the light chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 64, 66, 69, respectively;
- the heavy chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 45, 415, 416, respectively, and the light chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 64, 66, 68, respectively;
- the heavy chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 45, 415, 416, respectively, and the light chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 64, 66, 419, respectively;
- the heavy chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 469, 470, and 471, respectively, and the light chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 472, 473, and 474, respectively; or
- the heavy chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 469, 470, and 471, respectively
- the light chain variable region CDR1, CDR2, and CDR3 comprises SEQ ID NOs: 64, 66, and 71, respectively
- the antibody specifically binds to human TIM3.
- a VH domain, or one or more CDRs thereof, described herein can be linked to a constant domain for forming a heavy chain, e.g., a full length heavy chain.
- a VL domain, or one or more CDRs thereof, described herein can be linked to a constant domain for forming a light chain, e.g., a full length light chain.
- a full length heavy chain (with the exception of the C-terminal lysine (K) or with the exception of the C- terminal glycine and lysine (GK), which can be absent) and lull length light chain combine to form a full length antibody.
- a VH domain described herein can be fused to the constant domain of a human IgG, e.g., IgGl, IgG2, IgG3 or IgG4, which are either naturally- occurring or modified, e.g., as further described herein.
- a VH domain can comprise the amino acid sequence of any VH domain described herein fused to a human IgG, e.g., an IgGl, constant region, such as the following wild-type human IgGl constant domain amino acid sequence:
- a VH domain of an anti-TIM3 antibody can comprise the amino acid sequence of any VH domain described herein fused to an effectorless constant region, e.g., the following effectorless human IgGl constant domain amino acid sequences:
- an allotypic variant of IgGl comprises an K97R, D239E, and/or L241M (underlined and bolded above) and numbering according to that in SEQ ID NOs: 277, 294, and 295 Within the full length heavy region, e.g., 8C4 (SEQ ID NO: 3) and according to EU numbering, these amino acid substitutions are numbered K214R, D356E, and L358M.
- the constant region of an anti-TIM3 antibody can further comprises one or more mutations or substitutions at amino acids LI 17, A118, G120, A213, and P214 (underlined above) as numbered in SEQ ID NO: 277, 294, and 295, or L234, A235, G237, A330 and P331, per EU numbering.
- the constant region of an anti-TIM3 antibody comprises one or more mutations or substitutions at amino acids L117A, A118E, G120A, A213S, and P214S of SEQ ID NO: 291, or L234A, L235E, G237A, A330S and P33 IS, per EU numbering.
- the constant region of an anti-TIM3 antibody may also comprise one or more mutations or substitutions LI 17A, A118E and G120A of SEQ ID NO: 291, or L234A, L235E and G237A, per EU numbering
- a VH domain of an anti-TIM3 antibody can comprise the amino acid sequence of any VH domain described herein fused to a human IgG4 constant region, e.g., the following human IgG4 amino acid sequence or variants thereof:
- a VL domain described herein can be fused to the constant domain of a human Kappa or Lambda light chain.
- a VL domain of an anti-TIM3 antibody can comprise the amino acid sequence of any VL domain described herein fused to the following human IgGl kappa light chain amino acid sequence:
- the heavy chain constant region comprises a lysine or another amino acid at the C-terminus, e.g., it comprises the following last amino acids: LSPGK (SEQ ID NO: 279) in the heavy chain.
- the heavy chain constant region is lacking one or more amino acids at the C-terminus, and has, e.g., the C-terminal sequence LSPG (SEQ ID NO: 280) or LSP (SEQ ID NO: 281).
- amino acid sequences of exemplary heavy and light chains correspond to SEQ ID NOs: 1-28 , 72-111, 301-354, for the heavy chains and SEQ ID NOs: 29-30 and 32-33 for the light chains.
- anti-human TIM3 antibodies or antigen binding portion thereof, comprising:
- heavy and light chain sequences comprising SEQ ID Nos: 402 (or 403) and 29, respectively;
- heavy and light chain sequences comprising SEQ ID Nos: 406 (or 407) and 29, respectively;
- an anti-TUVB antibody comprises a combination of a heavy and light chain sequences set forth herein, e.g., in the preceding paragraph, wherein the antibody comprises two heavy chains and two light chains, and can further comprise at least one disulfide bond linking the two heavy chains together.
- the antibodies can also comprise disulfide bonds linking each of the light chains to each of the heavy chains.
- Heavy and light chains comprising an amino acid sequence that is at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, 80%, 75% or 70% identical to any of the heavy or light chains set forth herein (or their variable regions), e.g., SEQ ID NOs: 1-33, 72-111, 301-354, 386-409, 451, 452, 453, 454, 455, 457, 458, 459, 460, and 461-468 can be used for forming anti-human TIM3 antibodies having the desired characteristics, e.g., those further described herein.
- Exemplary variants are those comprising an allotypic variation, e.g., in the constant domain, and/or a mutation in the variable or constant region, such as the mutations disclosed herein.
- Heavy and light chains comprising an amino acid sequence that differs in at most 1-30, 1-25, 1-20, 1-15, 1-10, 1-5, 1-4, 1-3, 1-2 or 1 amino acid (by substitution, addition or deletion) from any of the heavy or light chains set forth herein (or their variable regions) can be used for forming anti-human TIM3 antibodies having the desired characteristics, e.g., those further described herein.
- the antibodies described above exhibit one or more, two or more, three or more, four or more, five or more, six or more, seven or more, eight or more, nine or more, ten or more, eleven or more, twelve or more, thirteen or more, fourteen or more, fifteen or more, sixteen or more, seventeen or more, eighteen or more, ninetee or more, or all of the following functional properties:
- soluble human TIM3 e.g., with a KD of 10 nM or less (e.g., 0.01 nM to 10 nM), e.g, as measured by Biacore, e.g., as described in the Examples;
- inducing or enhancing T cell activation e.g., by blocking or reducing the inhibitory effect of T1M3, as evidenced by (i) increased lFN-g production in TIM3 -expressing T cells (e.g., Thl cells or TILs) and/or (ii) enhanced proliferation of TIM3 -expressing T cells (e.g., Thl cells or TILs), e.g., as described in the Examples;
- MLR mixed lymphocyte reaction
- mRIQIPGIMNDEKFNLKL 127 (SEQ ID NO: 368) as determined by HDX-MS, e.g, as described in the Examples;
- Such antibodies include, for example, human antibodies, humanized antibodies, or chimeric antibodies.
- anti-TIM3 antibodies described herein bind to a conformational epitope.
- anti-TIM3 antibodies described herein bind to amino acid residues within the following region of mature human TIM3 extracellular domain (SEQ ID NO: 290):
- SEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNWLRTDERDVNYWTSRYWLNGDFRKGDVSLT IENVTLADSGIYCCRIQI PGIMND (SEQ ID NO: 299), corresponding to amino acid residues 1-99 of mature human TIM3 extracellular domain (SEQ ID NO: 290) or amino acids 22 to 120 of human TIM3 having SEQ ID NO: 286.
- anti-TIM3 antibodies described herein bind to amino acid residues within the following region of mature human TIM3 extracellular domain (SEQ ID NO: 290): CPVFECG (SEQ ID NO: 296), corresponding to amino acid residues 37-43 of mature human TIM3 extracellular domain (SEQ ID NO: 290).
- anti-TIM3 antibodies described herein bind to amino acid residues within the following region of mature human TIM3 extracellular domain (SEQ ID NO: 290): WTSRYWLNGDFR (SEQ ID NO: 297), corresponding to amino acid residues 57-83 of mature human TIM3 extracellular domain (SEQ ID NO: 290).
- anti-TIM3 antibodies described herein bind to amino acid residues within the following region of mature human TIM3 extracellular domain (SEQ ID NO: 290): RIQI PGIMND (SEQ ID NO:298), corresponding to amino acid residues 90-99 of mature human TIM3 extracellular domain (SEQ ID NO: 290).
- anti-TIM3 antibodies have the same pattern of binding to wildtype and mutated human TIM3 as that of one or more of antibodies 13A3, 3G4, 17C3, 17C8, 9F6, 8B9, 8C4, 14H7,
- an anti-TIM3 antibody binds to amino acid residues within the following regions of mature human TIM3 extracellular domain (SEQ ID NO: 290): CPVFECG (SEQ ID NO: 296), WTSRYWLNGDFRKGDVSLTIENVTLAD (SEQ ID NO: 297), and/or RIQIPGIMND (SEQ ID NO: 298).
- an anti-TDVB antibody binds to (1) 49 VPVCWGKGACPVFE 62 (SEQ ID NO: 367) and nl RIQIPGIMNDEKFNLKL 127 (SEQ ID NO: 368) or (2)
- YTPAAPGNLVPVCWGKGACPVFE 62 (SEQ ID NO: 369), 66 WLRTDERDVNY 77 (SEQ ID NO: 370), 78 WTSRYWLNGDFRKGDVSL 95 (SEQ ID NO: 371), 110 CRIQIPGIMNDEKFNLKL 127 (SEQ ID NO: 372), and 119 NDEKFNLKL 127 (SEQ ID NO: 373), as determined by HDX-MS, as described, e.g., in the Examples.
- an anti-TIM3 antibody interacts with regions of amino acid residues 40-62 and 111-127 of hTIM3, but does not significantly interact with other regions, such as the region that is N-terminal to amino acid residue Y40, the region that is located between amino acid residues E62 and Ri l l, and the region that is C- terminal to amino acid residue L127, as determined by HDX-MS, as described, e.g., in the Examples.
- an anti-TDVB antibody has reduced binding to human TIM3 in which one or more of amino acids L48, C58, P59, V60, F61, E62, C63, G64, W78, S80, R81, W83, L84, G86, D87, R89, D104, Ri l l, Q113, G116, M118, and D120 (as numbered in SEQ ID NO: 286 (FIG. 25)) is substituted with another amino acid relative to binding to wildtype human TIM3 and the antibody binds to (1)
- VPVCWGKGACPVFE 62 (SEQ ID NO: 367) and m RIQIPGIMNDEKFNLKL 127 (SEQ ID NO: 368) or (2) 40 YTPAAPGNLVPVCWGKGACPVFE 62 (SEQ ID NO: 369), 66 WLRTDERDVNY 77 (SEQ ID NO: 370), 78 WTSRYWLNGDFRKGDVSL 95 (SEQ ID NO: 371), 110 CRIQIPGIMNDEKFNLKL 127 (SEQ ID NO: 372), and 119 NDEKFNLKL 127 (SEQ ID NO: 373), as determined by HDX-MS, as described, e.g., in the Examples.
- an anti-TIM3 antibody has a similar pattern of binding to wild-type and mutated human TIM3 as that of TIM3.18.IgG1.3 or 13 A3, i.e., the antibody:
- (i) binds to (1) 49 VPVCWGKGACPVFE 62 (SEQ ID NO: 367), m RIQIPGIMNDEKFNLKL 127 (SEQ ID NO: 368), and 119 NDEKFNLKL 127 (SEQ ID NO: 373), and, e.g., but does not bind significantly to (a) peptides having sequences located N-terminal of amino acid residue 49; (b) peptides having sequences located between amino acid residue 62 and 111 (e.g, 78 WTSRYWLNGDFRKGDVSL 95 (SEQ ID NO: 371)); and (c) peptides having sequences that are located C-terminal of amino acid residue 127, as determined by HDX-MS (e.g., as described in the Examples);
- (ii) fails to bind to human TIM3, or has significantly reduced binding to human TIM3, having one or more of the following amino acid mutations, as determined, e.g., using a yeast surface display method (e.g., as described in the Examples): C58, P59, F61, E62, C63, Ri l l, D120, and optionally D104 and Q113 (numbering per SEQ ID NO: 286 (FIG. 25)); and/or
- (iii) has the heavy chain and/or light chain variable regions interact with at least 5, 10, 15, 20 or all of the following amino acids of human ⁇ M3 : P50, V51, C52, P59, V60, F61, E62, C63, G64, N65, V66, V67, L68, R69, D71, E72, D74, Ri l l, Q113, G116, 1117, Ml 18, D120, and optionally T70 and/or II 12, as determined by X-ray crystallography (e.g., as described in the Examples; numbering per SEQ ID NO: 286 (FIG. 25)).
- an anti-TDVB antibody comprises a heavy chain and a light chain, wherein the heavy chain is selected from the group consisting of SEQ ID NOs: 72-111, 305-320, 325-326, 339-340, 349- 354, 402-407, 451, 452, 454, 455, 457, 458, 459, 460, and 461-468 and/or the light chain is selected from the group consisting of SEQ ID NOs: 29-33 and 453.
- the heavy chain constant region of anti-TDVB antibodies described herein can be of any isotype, e.g., IgGl, IgG2, IgG3 and IgG4, or combinations thereof and/or modifications thereof.
- An anti-TIM3 antibody can have effector function or can have reduced or no effector function.
- anti-TIM3 antibodies comprise a modified heavy chain constant region that provides enhanced properties to the antibody.
- an anti-TDVB antibody comprises a heavy chain and an light chain, wherein the heavy chain is selected from the group consisting of SEQ ID NOs: 72-111, 349-352, 402-405, 451, 452, 454, 455, 457, 458, 459, 460, and 461-468, and/or the light chain is selected from the group consisting of SEQ ID NOs: 29-33 and 453.
- an anti-TIM3 antibody comprises a heavy chain variable region from a particular germline heavy chain immunoglobulin gene and/or a light chain variable region from a particular germline light chain immunoglobulin gene.
- human antibodies specific for TIM3 have been prepared that comprise a heavy chain variable region that is the product of or derived from a human germline VH 4-39 gene, VH 4-59 gene, VH 1-46 gene, VH 3-11, VH 4-17 gene, VH 3-10 gene, VH 6-19 gene, VH 6-13 gene, VH 4-23, VH JH4b, VH JH5b gene and/or VH JH6b gene.
- isolated monoclonal antibodies, or antigen binding portions thereof comprising a heavy chain variable region that is the product of or derived from a human VH germline gene selected from the group consisting of: VH 4-39, VH 4-59, VH 1-46, VH 3-11, VH 4-17, VH 3-10, VH6-19, VH 6-13, VH 4-23, VH JH4b, VH JH5b, VH JH6b, and any combination thereof.
- Human antibodies specific for TIM3 have been prepared that comprise a light chain variable region that is the product of or derived from a human germline VK A27 gene, VK JK5 gene, VK JK4 gene, VK JK3, VK L18 gene, and/or VK JK1 gene. Accordingly, provide herein are isolated monoclonal antibodies, or antigen binding portions thereof, comprising a light chain variable region that is the product of or derived from a human VK germline gene selected from the group consisting of: VK A27, VK JK5, VK JK4, VK JK3, VK L18, VK JK1, and any combination thereof.
- Anti-TIM3 antibodies described herein include those comprising a heavy chain variable region that is the product of or derived from one of the above-listed human germline VH genes and also comprising a light chain variable region that is the product of or derived from one of the above-listed human germline VK genes, as shown in the Figures.
- a human antibody comprises heavy and light chain variable regions that are "the product of or "derived from” a particular germline sequence if the variable regions of the antibody are obtained from a system that uses human germline immunoglobulin genes.
- Such systems include immunizing a transgenic mouse carrying human immunoglobulin genes with the antigen of interest or screening a human
- a human antibody that is "the product of or "derived from” a human germline immunoglobulin sequence can be identified as such by comparing the amino acid sequence of the human antibody to the amino acid sequences of human germline immunoglobulins and selecting the human germline immunoglobulin sequence that is closest in sequence greatest % identity) to the sequence of the human antibody.
- a human antibody that is "the product of or "derived from” a particular human germline immunoglobulin sequence can contain amino acid differences as compared to the germline sequence, due to, for example, naturally- occurring somatic mutations or intentional introduction of site-directed mutation.
- a selected human antibody typically is at least 90% identical in amino acids sequence to an amino acid sequence encoded by a human germline immunoglobulin gene and contains amino acid residues that identify the human antibody as being human when compared to the germline immunoglobulin amino acid sequences of other species (e.g., murine germline sequences).
- a human antibody can be at least 95%, or even at least 96%, 97%, 98%, or 99% identical in amino acid sequence to the amino acid sequence encoded by the germline immunoglobulin gene.
- a human antibody derived from a particular human germline sequence will display no more than 10 amino acid differences from the amino acid sequence encoded by the human germline immunoglobulin gene.
- the human antibody can display no more than 5, or even no more than 4, 3, 2, or 1 amino acid difference from the amino acid sequence encoded by the germline immunoglobulin gene.
- antibodies having heavy and light chain variable regions comprising amino acid sequences that are homologous to the amino acid sequences of the anti-TIM3 antibodies described herein, and wherein the antibodies retain the desired functional properties of the anti-TIM3 antibodies described herein.
- an isolated anti-TIM3 antibody, or antigen binding portion thereof can comprise a heavy chain variable region and a light chain variable region, wherein:
- the heavy chain variable region comprises an amino acid sequence that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to an amino acid sequence selected from the group consisting of SEQ ID NOs: 34-40,112-121, 364, 410-412, 449, and 456, or comprises 1, 2, 3, 4, 5, 1-2, 1-3, 1-4, 1-5, 1-10, 1-15, 1-20, 1-25, or 1-50 amino acid changes (i.e., amino acid substitutions, additions or deletions) relative to an amino acid sequence selected from the group consisting of SEQ ID NOs: 34-40, 112-121, 364, 410-412, 449, and 456, wherein optionally the heavy chain variable region comprises the CDR sequences of one of the anti-TIM3 antibodies described herein;
- the light chain variable region comprises an amino acid sequence that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to an amino acid sequence selected from the group consisting of SEQ ID NOs: 60-63, 417, and 418, or comprises 1, 2, 3, 4, 5, 1-2, 1-3, 1-4, 1-5, 1-10, 1-15, 1-20, 1-25, or 1-50 amino acid changes (i.e., amino acid substitutions, additions or deletions) relative to an amino acid sequence selected from the group consisting of SEQ ID NOs: 60-63, 417, 418, and 450, wherein optionally the light chain variable region comprises the CDR sequences of one of the anti-TIM3 antibodies described herein;
- the antibody exhibits 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 17, 18, 19, or all of the following functional properties:
- soluble human TIM3 e.g., with a K D of 10 nM or less (e.g., 0.01 nM to 10 nM), e.g., as measured by Biacore, e.g., as described in the Examples;
- inducing or enhancing T cell activation e.g., by blocking or reducing the inhibitory effect of TIM3
- IFN-g production in TIM3 -expressing T cells e.g., Thl cells or TILs
- enhanced proliferation of TIM3 -expressing T cells e.g., Thl cells or TILs
- MLR mixed lymphocyte reaction
- mRIQIPGIMNDEKFNLKL 127 (SEQ ID NO: 368) as determined by HDX-MS, e.g., as described in the Examples;
- VPVCWGKGACPVFE 62 (SEQ ID NO: 367), m RIQIPGIMNDEKFNLKL 127 (SEQ ID NO: 368) and 119 NDEKFNLKL 127 (SEQ ID NO: 373), as determined by HDX-MS, as described in the Examples; and/or (c) competing with or cross-blocking with the binding to human TIM3 of 13A3 or TIM3.18.IgG1.3, e.g., as described in the Examples;
- the antibody can exhibit one or more, two or more, three or more, four or more, five or more, six or more, seven or more, eight or more, nine or more, or all of the functional properties listed as (1) through (20) above.
- the antibody can be, for example, a human antibody, a humanized antibody or a chimeric antibody.
- An isolated anti-TIM3 antibody, or antigen binding portion thereof, can comprise a heavy chain and a light chain, wherein:
- the heavy chain comprises an amino acid sequence that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-28, 72- 111, and 349-352, 388-391 (14H7/TIM3.24 HC IgGl. lf and IgGlJf), 396-399 (23B3 HC IgGl. lf and IgG1.3f), 402-405 (TIM3.25 HC IgGlf and IgG1.3f), 451, 452, 461, 462 (TIM3.20 HC IgGlf and IgG1.3f),
- the light chain comprises an amino acid sequence that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to an amino acid sequence selected from the group consisting of SEQ ID NOs: 29-33,
- 408, 409, and 453, or comprises 1, 2, 3, 4, 5, 1-2, 1-3, 1-4, 1-5, 1-10, 1-15, 1-20, 1-25, or 1-50 amino acid changes (i.e., amino acid substitutions, additions or deletions) relative to an amino acid sequence selected from the group consisting of SEQ ID NOs: 29-33, 408, 409, and 453, wherein optionally the light chain variable region comprises the CDR sequences of one of the anti-TIM3 antibodies described herein;
- the antibody specifically binds to human TIM3, and (d) the antibody exhibits 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or all of the following functional properties:
- soluble human TIM3 e.g., with a K D of 10 nM or less (e.g., 0.01 nM to 10 nM), e.g., as measured by Biacore, e.g., as described in the Examples;
- binding to membrane bound human TIM3 e.g., with an EC 50 of 1 ug/mL or less (e.g., 0.01 ug/mL to 1 ug/mL), e.g., as measured by flow cytometry (e.g., as described in the Examples);
- inducing or enhancing T cell activation e.g., by blocking or reducing the inhibitory effect of TIM3
- IFN-g production in TIM3 -expressing T cells e.g, Thl cells or TILs
- enhanced proliferation of TIM3 -expressing T cells e.g., Thl cells or TILs
- MLR mixed lymphocyte reaction
- mRIQIPGIMNDEKFNLKL 127 (SEQ ID NO: 368) as determined by HDX-MS, e.g., as described in the Examples;
- anti-TIM3 antibodies comprising a VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and/or VL CDR3 that differs from the corresponding CDR of 13 A3, 3G4, 17C3, 17C8, 9F6, 8B9, 8C4, 14H7, 23B3, or any of TIM3.2 to TIM3.18, TIM3.20, TIM3.21, TIM3.22, TIM3.23, TIM3.24, and TIM3.25 in 1, 2, 3, 4, 5, 1-2, 1-3, 1-4, or 1-5 amino acid changes (i.e., amino acid substitutions, additions or deletions).
- an anti-TIM3 antibody comprises 1-5 amino acid changes in each of 1, 2, 3, 4, 5 or 6 of the CDRs relative to the corresponding sequence in 13A3, 3G4, 17C3, 17C8, 9F6, 8B9, 8C4, 14H7, 23B3, or any of TIM3.2 to ⁇ M3.18, TIM3.20, TIM3.21, TIM3.22, TIM3.23, TIM3.24, and TIM3.25.
- an anti-TIM3 antibody comprises at total of 1-5 amino acid changes across all CDRs relative to the CDRs in 13A3, 3G4, 17C3, 17C8, 9F6, 8B9, 8C4, 14H7, 23B3, or any of TIM3.2 to TIM3.18, TIM3.20, TIM3.21, TIM3.22, TIM3.23, TIM3.24, and TIM3.25.
- an anti-TIM3 antibody comprises VH and VL CDRs consisting of those of 13A3, wherein one or more of the amino acids in one or more CDRs are those of one of the other anti-TIM3 antibodies disclosed herein.
- an anti-TIM3 antibody comprises a VH CDR1 comprising one or more amino acid modifications relative to SRSYYWG (SEQ ID NO: 41), and can comprise, e.g., the following degenerate sequence: X1X2X3X4YX5X6 (SEQ ID NO: 282), wherein Xi is any amino acid, e.g., S or none; X 2 is any amino acid, e.g., R or none; X 3 is any amino acid, e.g., S, R, or D; X 4 is any amino acid, e.g., Y or H; X 5 is any amino acid, e.g., W or M; and X 6 is any amino acid, e.g., G, N, S, or H.
- an anti-TDVB antibody comprises a VH CDR2 comprising one or more amino acid modifications relative to SIYYSGFTYYNPSLKS (SEQ ID NO: 46), and can comprise, e.g., the following degenerate sequence: X1IX2X3X4GX5X6X7X8YX9X10X11X12X13X14 (SEQ ID NO: 283), wherein Xi is any amino acid, e.g., S, Y, I, or F; X 2 is any amino acid, e.g., Y, H, N, or S; X3 is any amino acid, e.g., Y, P, G, T, S, or N; X4 is any amino acid, e.g., S, T, R, or G; X5 is any amino acid, e.g., F, S, or D; X6 is any amino acid, e.g., S, T, or I; X
- an anti-TDVB antibody comprises a VH CDR3 comprising one or more amino acid modifications relative to GGPYGDYAHWFDP (SEQ ID NO: 53), and can comprise, e.g., the following degenerate sequence: X 1 X 2 X 3 X 4 X 5 X 6 7 X 8 X 9 X 10 X 11 X 12 X 13 X 14 X 15 X 16 X 17 X 18 X 19 X 20 (SEQ ID NO: 284), wherein Xi is any amino acid, e.g., D, E, G, or none; X 2 is any amino acid, e.g., F, G, R, or none; X3 is any amino acid, e.g., Y, M, I, or none; X4 is any amino acid, e.g., G, S, V, or none; X5 is any amino acid, e.g., G, T, R, S, or none;
- an anti-TDVB antibody comprises a VL CDR1 comprising an amino acid sequence as set forth in SEQ ID NO: 64 or SEQ ID NO: 65.
- an anti-TDVB antibody comprises a VL CDR2 comprising an amino acid sequence as set forth in SEQ ID NO: 66 or SEQ ID NO: 67.
- an anti-TDVB antibody comprises a VL CDR3 comprising one or more amino acid modifications relative to QQYGSSPIT (SEQ ID NO: 68), and can comprise, e.g., the following degenerate sequence: QQX 1 X 2 SX 3 X 4 X 5 X 6 (SEQ ID NO: 285), wherein Xi is any amino acid, e.g., F or Y; X 2 is any amino acid, e.g., N or G; X 3 is any amino acid, e.g., Y or S; X 4 is any amino acid, e.g., P or none; X 5 is any amino acid, e.g., I, R, L, or none; X 6 is any amino acid, e.g., T or none.
- Anti-TDVB antibodies can comprise a heavy chain variable region comprising CDR1, CDR2 and CDR3 sequences and a light chain variable region comprising CDR1, CDR2 and CDR3 sequences, wherein one or more of these CDR sequences comprise specified amino acid sequences based on the anti-TDVB antibodies described herein (e.g., 13A3, 3G4, 17C3, 17C8, 9F6, 8B9, 8C4, 14H7, 23B3, or any of TIM3.2 to TEVB.18, TIM3.20, TIM3.21, TIM3.22, TIM3.23, TIM3.24, and TIM3.25), or conservative modifications thereof, and wherein the antibodies retain the desired functional properties of the anti-TIM3 antibodies described herein.
- the anti-TDVB antibodies described herein e.g., 13A3, 3G4, 17C3, 17C8, 9F6, 8B9, 8C4, 14H7, 23B3, or any of TIM3.2 to TEVB.18, TIM3.20, TIM3.21, TIM3.22, TIM3.2
- an isolated anti-TIM3 antibody, or antigen binding portion thereof can comprise a heavy chain variable region comprising CDR1, CDR2, and CDR3 sequences and a light chain variable region comprising CDR1, CDR2, and CDR3 sequences, wherein:
- the heavy chain variable region CDR3 sequence comprises an amino acid sequence selected from the group consisting of amino acid sequences of SEQ ID NOs: 53-59, 126-129, 414, 416, and 471, and conservative modifications thereof, e.g., 1, 2, 3, 4, 5, 1-2, 1-3, 1-4 or 1-5 conservative amino acid substitutions, wherein optionally the heavy chain variable region comprises the CDR sequences of one of the anti-TIM3 antibodies described herein;
- the light chain variable region CDR3 sequence comprises an amino acid sequence selected from the group consisting of amino acid sequence of SEQ ID NOs: 68-71, 419, and 474, and conservative modifications thereof, e.g., 1, 2, 3, 4, 5, 1-2, 1-3, 1-4 or 1-5 conservative amino acid substitutions, wherein optionally the light chain variable region comprises the CDR sequences of one of the anti-TIM3 antibodies described herein;
- the antibody exhibits 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or all of the following features:
- soluble human TIM3 e.g., with a K D of 10 nM or less (e.g., 0.01 nM to 10 nM), e.g., as measured by Biacore, e.g., as described in the Examples;
- binding to membrane bound human TIM3 e.g., with an EC 50 of 1 ug/mL or less (e.g., 0.01 ug/mL to 1 ug/mL), e.g., as measured by flow cytometry (e.g., as described in the Examples);
- inducing or enhancing T cell activation e.g., by blocking or reducing the inhibitory effect of TIM3
- IFN-g production in TIM3 -expressing T cells e.g., Thl cells or TILs
- enhanced proliferation of TIM3 -expressing T cells e.g., Thl cells or TILs
- MLR mixed lymphocyte reaction
- mRIQIPGIMNDEKFNLKL 127 (SEQ ID NO: 368) as determined by HDX-MS, e.g, as described in the Examples;
- VPVCWGKGACPVFE 62 (SEQ ID NO: 367), m RIQIPGIMNDEKFNLKL 127 (SEQ ID NO: 368) and 119 NDEKFNLKL 127 (SEQ ID NO: 373), as determined by HDX-MS, as described in the Examples; and/or (c) competing with or cross-blocking with the binding to human TIM3 of 13A3 or TIM3.18.IgG1.3, e.g., as described in the Examples;
- the heavy chain variable region CDR2 sequence comprises an amino acid sequence selected from the group consisting of amino acid sequences of SEQ ID NOs: 46-52, 122-125, 413,
- the light chain variable region CDR2 sequence comprises an amino acid sequence selected from the group consisting of amino acid sequences of SEQ ID NOs: 66-67 and 473, and conservative modifications thereof, e.g., 1, 2, 3, 4, 5, 1-2, 1-3, 1-4 or 1-5 conservative amino acid substitutions.
- the heavy chain variable region CDR1 sequence comprises an amino acid sequence selected from the group consisting of amino acid sequences of SEQ ID NOs: 41-45 and 469, and conservative modifications thereof, e.g., 1, 2, 3, 4, 5, 1-2, 1-3, 1-4 or 1-5 conservative amino acid substitutions; and the light chain variable region CDR1 sequence comprises an amino acid sequence selected from the group consisting of amino acid sequences of SEQ ID NOs: 64-65 and 472, and conservative modifications thereof, e.g., 1, 2, 3, 4, 5, 1-2, 1-3, 1-4 or 1-5 conservative amino acid substitutions.
- the antibody can exhibit one or more, two or more, three or more, four or more, five or more, six or more, seven or more, eight or more, nine or more, or all of the functional properties listed as (1) through (20) above.
- Such antibodies can be, for example, human antibodies, humanized antibodies or chimeric antibodies.
- amino acid substitutions can also be made in portions of the antibodies other than, or in addition to, the CDRs.
- conservative amino acid modifications can be made in a framework region or in the Fc region.
- a variable region or a heavy or light chain can comprise 1, 2, 3, 4, 5, 1-2, 1-3, 1-4, 1- 5, 1-10, 1-15, 1-20, 1-25, or 1-50 conservative amino acid substitutions relative to the anti-TIM3 antibody sequences provided herein.
- an anti-TIM3 antibody comprises a combination of conservative and non-conservative amino acid modification.
- antibodies that compete for binding to human TIM3 with one or more of the particular anti-TIM3 antibodies described herein e.g., antibodies 13A3, 3G4, 17C3, 17C8, 9F6, 8B9, 8C4,
- Such competing antibodies can be identified based on their ability to competitively inhibit binding to human TIM3 of one or more of monoclonal antibodies 13 A3, 3G4, 17C3, 17C8, 9F6, 8B9, 8C4, 14H7, 23B3, and/or TIM3.2- TIM3.18, TIM3.20, TIM3.21, TIM3.22, TIM3.23, IM3.24, and TIM3.25 in standard TIM3 binding assays.
- standard ELISA assays or competitive ELISA assays can be used in which a recombinant human TIM3 protein is immobilized on the plate, various concentrations of unlabeled first antibody is added, the plate is washed, labeled second antibody is added, and the amount of label is measured. If the increasing concentration of the unlabeled (first) antibody (also referred to as the "blocking antibody") inhibits the binding of the labeled (second) antibody, the first antibody is said to inhibit the binding of the second antibody to the target on the plate, or is said to compete with the binding of the second antibody.
- Biacore analysis can be used to assess the ability of the antibodies to compete. The ability of a test antibody to inhibit the binding of an anti-TIM3 antibody described herein to TIM3 demonstrates that the test antibody can compete with the antibody for binding to human TIM3.
- anti-TIM3 antibodies that inhibit the binding of an anti-TIM3 antibodies described herein to TIM3 on cells, e.g., activated T cells, by at least 50%, 55%, 60%, 65%, 70%,
- PBMCs Peripheral Blood Mononuclear Cells
- PHA-L phytohaemagglutinin
- Peprotech#200-02 200IU/mL recombinant IL-2
- the activated T cells are resuspended in FACS buffer (PBS with 5% Fetal Bovine Semm) and seeded at 10 5 cells per sample well in a 96 well plate.
- FACS buffer PBS with 5% Fetal Bovine Semm
- the plate is set on ice followed by the addition of unconjugated first antibody at concentrations ranging from 0 to 50 pg/mL (three-fold titration starting from a highest concentration of 50 pg/niL).
- An unrelated IgG can be used as an isotype control for the first antibody and added at the same concentrations (three-fold titration starting from a highest concentration of 50 pg/mL).
- a sample pre-incubated with 50pg/mL unlabeled second antibody can be included as a positive control for complete blocking (100% inhibition) and a sample without antibody in the primaiy incubation can be used as a negative control (no competition; 0% inhibition).
- labeled e.g., biotinylated
- second antibody is added at a concentration of 2pg/mL per well without washing. Samples are incubated for another 30 minutes on ice. Unbound antibodies are removed by washing the cells with FACS buffer. Cell -bound labeled second antibody is detected with an agent that detects the label, e.g., PE conjugated streptavidin (Invitrogen, catalog#S21388) for detecting biotin.
- an agent that detects the label e.g., PE conjugated streptavidin (Invitrogen, catalog#S21388) for detecting biotin.
- the samples are acquired on a FACS Calibur Flow Cytometer (BD, San Jose) and analyzed with FLOWJO ® software (Tree Star, Inc., Ashland, OR).
- the results can be represented as the % inhibition (i.e., subtracting from 100% the amount of label at each concentration divided by the amount of label obtained with no blocking antibody).
- the same experiment is then conducted in the reverse, i.e., the first antibody is the second antibody and the second antibody is the first antibody.
- an antibody at least partially (e.g., at least 10%, 20%, 30%, 40%, 50%,
- a first and a second antibody “cross-block" binding of each other to the target, when the antibodies compete with each other both ways, i. e., in competition experiments in which the first antibody is added first and in competition experiments in which the second antibody is added first.
- anti-TIM3 antibodies bind to the same epitope as that of the anti-TIM3 antibodies described herein (e.g., 13A3, 3G4, 17C3, 17C8, 9F6, 8B9, 8C4, 14H7, 23B3, and/or TIM3.2- TIM3.18, TIM3.20, TIM3.21, TIM3.22, TIM3.23, TIM3.24, and TIM3.25), e.g., as determined by a given epitope mapping technique.
- Techniques for determining antibodies that bind to the "same epitope on TIM3" with the anti-TIM3 antibodies described herein include, for example, epitope mapping methods, such as, x-ray analyses of crystals of antigemantibody complexes which provides atomic resolution of the epitope. Other methods monitor the binding of the antibody to antigen fragments or mutated variations of the antigen where loss of binding due to a modification of an amino acid residue within the antigen sequence is often considered an indication of an epitope component (see FIG. 25). In addition, computational combinatorial methods for epitope mapping can also be used.
- Methods can also rely on the ability of an antibody of interest to affinity isolate specific short peptides (either in native three dimensional form or in denatured form) from combinatorial phage display peptide libraries.
- the peptides are then regarded as leads for the definition of the epitope corresponding to the antibody used to screen the peptide library.
- For epitope mapping computational algorithms have also been developed which have been shown to map conformational discontinuous epitopes.
- Antibodies that compete for binding with, or bind to the same epitope as, the anti-TIM3 antibodies described herein can be identified by using art-known methods. For example, mice can be immunized with human TIM3 as described herein, hybridomas produced, and the resulting monoclonal antibodies screened for the ability to compete with an antibody described herein for binding to human TIM3. Mice can also be immunized with a smaller fragment of TIM3 containing the epitope to which the antibody binds. The epitope or region comprising the epitope can be localized by, e.g., screening for binding to a series of overlapping peptides spanning TIM3.
- the method of Jespers et al can be used to guide the selection of antibodies having the same epitope and therefore similar properties to an anti-TIM3 antibody described herein
- phage display first the heavy chain of the anti-TIM3 antibody is paired with a repertoire of (human) light chains to select a TIM3 -binding antibody, and then the new light chain is paired with a repertoire of (human) heavy chains to select a (human) TIM3 -binding antibody having the same epitope or epitope region as an anti-TIM3 antibody described herein.
- variants of an antibody described herein can be obtained by mutagenesis of cDNA encoding the heavy and light chains of the antibody.
- Binding characteristics of a specific antibody can also be determined by assessing binding of the antibody to peptides comprising fragments of TIM3, e.g., non-denatured or denatured fragments.
- a series of overlapping peptides encompassing the sequence of TIM3 e.g., human TIM3 can be synthesized and screened for binding, e.g., in a direct ELISA, a competitive ELISA (where the peptide is assessed for its ability to prevent binding of an antibody to TIM3 bound to a well of a micro titer plate), or on a chip.
- Binding characteristics of anti-TIM3 antibodies can also be obtained by MS-based protein footprinting, such as Hydrogen/deuterium exchange mass spectrometry (HDX-MS) and Fast Photochemical Oxidation of Proteins (FPOP).
- HDX-MS can be conducted, e.g., as described in WO2015/18735 and in Wei et al. (2014) Drug Discovery Today 19:95, the methods of which are specifically incorporated by reference herein.
- FPOP can be conducted as described, e.g., in Hambley and Gross (2005) J. American Soc. Mass Spectrometry 16:2057, the methods of which are specifically incorporated by reference herein.
- Binding characteristics anti-TIM3 antibodies can also be obtained by structural methods, such as X-ray crystal structure determination (e.g., W02005/044853), molecular modeling and nuclear magnetic resonance (NMR) spectroscopy, including NMR determination of the H-D exchange rates of labile amide hydrogens in TIM3 when free and when bound in a complex with an antibody of interest (Zinn- Justin et al. (1992) Biochemistry 31, 11335-11347; Zinn-Justin et al. (1993) Biochemistry 32, 6884-6891).
- structural methods such as X-ray crystal structure determination (e.g., W02005/044853), molecular modeling and nuclear magnetic resonance (NMR) spectroscopy, including NMR determination of the H-D exchange rates of labile amide hydrogens in TIM3 when free and when bound in a complex with an antibody of interest (Zinn- Justin et al. (1992) Biochemistry 31, 11335-11347; Zinn-Justin et al. (19
- crystallization can be accomplished using any of the known methods in the art (e.g., Giege et al. (1994) Acta Crystallogr. D50:339-350; McPherson (1990) Eur. J. Biochem. 189: 1-23), including microbatch (e.g., Chayen (1997) Structure 5: 1269-1274), hanging-drop vapor diffusion (e.g., McPherson (1976) J. Biol. Chem. 251 :6300-6303), seeding and dialysis. It is desirable to use a protein preparation having a concentration of at least about 1 mg/mL or about 10 mg/mL to about 20 mg/mL.
- Ciy stallization can be best achieved in a precipitant solution containing polyethylene glycol 1000-20,000 (PEG; average molecular weight ranging from about 1000 to about 20,000 Da), about 5000 to about 7000 Da, or about 6000 Da, with concentrations ranging from about 10% to about 30% (w/v). It can also be desirable to include a protein stabilizing agent, e.g., glycerol at a concentration ranging from about 0.5% to about 20%. A suitable salt, such as sodium chloride, lithium chloride or sodium citrate can also be desirable in the precipitant solution, in a concentration ranging from about 1 mM to about 1000 mM. The precipitant is buffered to a pH of from about 3.0 to about 5.0.
- buffers useful in the precipitant solution can vary and are well-known in the art (Scopes, Protein Purification: Principles and Practice, Third ed., (1994) Springer-Verlag, New York).
- useful buffers include, but are not limited to, HEPES, Tris, MES and acetate. Crystals can be grow at a wide range of temperatures, including 2°C, 4°C, 8°C and 26°C.
- Antibody antigen crystals can be studied using well-known X-ray diffraction techniques and can be refined using computer software such as X-PLOR (Yale University, 1992, distributed by Molecular Simulations, Inc.; see e.g., Blundell & Johnson (1985) Meth. Enzymol. 114 & 115, H. W. Wyckoff el al, eds., Academic Press; U.S. Patent Application Publication No. 2004/0014194), and BUSTER (Bricogne ( 1993) . Ida Cryst. D49:37-60; Bricogne (1997) Meth. Enzymol. 276A:361-423, Carter & Sweet, eds.; Roversi et al. (2000) Acta Cryst. D56: 1313-1323), the disclosures of which are hereby incorporated by reference in their entireties.
- Anti-TIM3 antibodies can bind to the same epitope as any of the anti-TIM3 antibodies having amino acid sequences described herein, as determined by an epitope mapping technique, such as a technique described herein.
- anti-TIM3 antibodies described herein bind to an epitope, e.g., a conformational epitope, in the extracellular portion of human TIM3, e.g., in the Ig like domain or IgV domain of the extracellular region, i.e., amino acids 22 to 130 of SEQ ID NO: 286 (FIG. 25).
- an anti-TIM3 antibody binds to an epitope located within amino acids 22 to 120 of human TIM3 extracellular domain (SEQ ID NO: 286) or 1-99 of mature human TIM3 (SEQ ID NO: 290) ( ee Examples).
- an anti-TIM3 antibody binds to, or to an epitope within, a region consisting of amino acids 58-64 of human TIM3 having SEQ ID NO: 286, which corresponds to amino acid residues 37-43 of mature human TIM3 (CPVFECG, SEQ ID NO: 296; see FIG. 25). In some embodiments, an anti-TIM3 antibody binds to, or to an epitope within, a region consisting of amino acids 111-120 of human TIM3 having SEQ ID NO: 286, which corresponds to amino acid residues 90-99 of mature human TIM3 (RIQIPGIMND, SEQ ID NO: 298; see FIG. 25).
- an anti-TIM3 antibody binds to, or to an epitope within, a region consisting of amino acids 58-64 of human TIM3 having SEQ ID NO: 286 (CPVFECG, SEQ ID N0296) and a region consisting of amino acids 111-120 of human TIM3 having SEQ ID NO: 286 (RIQIPGIMND, SEQ ID NO: 298; see FIG. 25).
- an anti-TIM3 antibody binds to, or to an epitope within, a region consisting of amino acids 78-89 of human TIM3 having SEQ ID NO: 286, which corresponds to amino acid residues 57-83 of mature human TIM3 (WTSRYWLNGDFR, SEQ ID NO: 297; see FIG. 25).
- an anti-TIM3 antibody binds to substantially the same epitope as that of 13 A3. In some embodiments, an anti-TIM3 antibody binds to an epitope (or region of human TIM3) comprising one or more of amino acid residues C58, P59, F61, E62, C63, Ri l l, and D 120 of SEQ ID NO: 286 (FIG. 25). In some embodiments, an anti-TIM3 antibody binds to an epitope (or region of human TIM3) comprising one or more of amino acid residues C58, P59, F61, E62, C63, D 104, Ri l l, Q113 and D120 of SEQ ID NO: 286 (FIG. 25).
- an anti-TIM3 antibody does not bind significantly, or only with significantly reduced binding affinity, to a human TIM3 protein in which one or more of amino acid residues C58, P59, F61, E62, C63, R111, and D120 of SEQ ID NO: 286 is changed to another amino acid, e.g., in a non-conservative amino acid substitution.
- an anti-TIM3 antibody does not bind significantly, or only with significantly reduced binding affinity, to a human TIM3 protein in which one or more of amino acid residues C58, P59, F61, E62, C63, D104, Ri l l, Q113 and D120 of SEQ ID NO: 286 is changed to another amino acid, e.g., in a non-conservative amino acid substitution.
- an anti-TIM3 antibody binds to substantially the same epitope as that of 3G4. In some embodiments, an anti-TIM3 antibody binds to an epitope (or region of human TIM3) comprising one or more of amino acids residues C58, P59, V60, F61, E62, C63, G116, and Ml 18 of SEQ ID NO: 286 (FIG. 25). In some embodiments, an anti-TIM3 antibody binds to an epitope (or region of human TIM3) comprising one or more of amino acid residues C58, P59, V60, F61, E62, C63, D104, G116, and M118 of SEQ ID NO: 286 (FIG. 25).
- an anti-TIM3 antibody does not bind significantly, or only with significantly reduced binding affinity, to a human TIM3 protein in which one or more of amino acid residues C58, P59, V60, F61, E62, C63, G116, and Ml 18 of SEQ ID NO: 286 is changed to another amino acid, e.g., in a nonconservative amino acid substitution.
- an anti-TIM3 antibody does not bind significantly, or only with significantly reduced binding affinity, to a human TIM3 protein in which one or more of amino acid residues C58, P59, V60, F61, E62, C63, D104, G116, and M118 of SEQ ID NO: 286 is changed to another amino acid, e.g., in a non-conservative amino acid substitution.
- an anti-TIM3 antibody binds to substantially the same epitope as that of 17C3.
- an anti-TIM3 antibody binds to an epitope (or region of human TIM3) comprising one or more of amino acids residues C58, P59, V60, F61, E62, C63, G64, and G116 of SEQ ID NO: 286 (FIG. 25).
- an anti-TIM3 antibody binds to an epitope (or region of human TIM3) comprising one or more of amino acid residues C58, P59, V60, F61, E62, C63, G64, D104, and G116 of SEQ ID NO: 286 (FIG. 25).
- an anti-TIM3 antibody does not bind significantly, or only with significantly reduced binding affinity, to a human TIM3 protein in which one or more of amino acid residues C58, P59, V60, F61, E62, C63, G64, and G116 of SEQ ID NO: 286 is changed to another amino acid, e.g., in a nonconservative amino acid substitution.
- an anti-TIM3 antibody does not bind significantly, or only with significantly reduced binding affinity, to a human TIM3 protein in which one or more of amino acid residues C58, P59, V60, F61, E62, C63, G64, D104, and G116 of SEQ ID NO: 286 is changed to another amino acid, e.g., in a non-conservative amino acid substitution.
- an anti-TIM3 antibody binds to substantially the same epitope as that of 8B9. In some embodiments, an anti-TIM3 antibody binds to an epitope (or region of human TIM3) comprising one or more of amino acids residues L48, W78, S80, R81, W83, G86, D87, and R89 of SEQ ID NO: 286 (FIG. 25). In some embodiments, an anti-TIM3 antibody binds to an epitope (or region of human TIM3) comprising one or more of amino acid residues L48, W78, S80, R81, W83, L84, G86, D87, and R89 of SEQ ID NO: 286 (FIG. 25).
- an anti-TIM3 antibody binds to substantially the same epitope as that of 8B9. In some embodiments, an anti-TIM3 antibody binds to an epitope (or region of human TIM3) comprising one or more of amino acids residues L48. W78, S80, R81. W83. G86, D87, R89. and D104 of SEQ ID NO: 286 (FIG. 25).
- an anti-TIM3 antibody does not bind significantly, or only with significantly reduced binding affinity, to a human TIM3 protein in which one or more of amino acid residues L48, W78, S80, R81, W83, G86, D87, and R89 of SEQ ID NO: 286 is changed to another amino acid, e.g., in a nonconservative amino acid substitution.
- an anti-TIM3 antibody does not bind significantly, or only with significantly reduced binding affinity, to a human TIM3 protein in which one or more of amino acid residues L48, W78, S80, R81, W83, L84, G86, D87, and R89 of SEQ ID NO: 286 is changed to another amino acid, e.g., in a non-conservative amino acid substitution.
- an anti-TIM3 antibody does not bind significantly, or only with significantly reduced binding affinity, to a human TIM3 protein in which one or more of amino acid residues L48, W78, S80, R81, W83, G86, D87, R89, and D104 of SEQ ID NO: 286 (FIG. 25) is changed to another amino acid, e.g., in a non-conservative amino acid substitution.
- anti-TIM3 antibodies compete for binding to human TIM3 with (or inhibit binding of) anti-TIM3 antibodies comprising CDRs or variable regions described herein, e.g., those of antibodies 13A3, 3G4, 17C3, 17C8, 9F6, 8B9, 8C4, 14H7, 23B3, and any of TIM3.2 to TIM3.18, TIM3.20, TIM3.21, TIM3.22, TIM3.23, TIM3.24, and TIM3.25.
- anti-TIM3 antibodies inhibit binding of antibodies 13A3, 3G4, 17C3, 17C8, 9F6, 8B9, 8C4, 14H7, 23B3, or any of TIM3.2 to TIM3.18, TIM3.20, TIM3.21, TIM3.22, TIM3.23, TIM3.24, and TIM3.25 to human TIM3 by at least 50%, 60%, 70%, 80%, 90% or by 100%.
- anti-TIM3 antibodies inhibit binding of 13A3, 3G4, 17C3, 17C8, 9F6, 8B9, 8C4, 14H7, 23B3, or any of TIM3.2 to TIM3.18, TIM3.20, TIM3.21, TIM3.22, TIM3.23, ⁇ M3.24, and TIM3.25 to human TIM3 by at least 50%, 60%, 70%, 80%, 90% or by 100% and 13A3, 3G4, 17C3, 17C8, 9F6, 8B9, 8C4, 14H7, 23B3, or any of ⁇ M3.2 to TIM3.18, TIM3.20, TIM3.21, TIM3.22, TIM3.23, TIM3.24, and TIM3.25 inhibit binding of the anti-TIM.3 antibodies to human TIM3 by at least 50%, 60%, 70%, 80%, 90% or by 100% (e.g., compete in both directions).
- anti-TIM3 antibodies compete for binding to human TIM3 with anti-TIM3 antibodies comprising CDRs or variable regions of anti-TIM3 antibodies 13 A3, 3G4, 17C3, 17C8, 9F6, 14H7, and 23B3 (and variants thereof). In some embodiments, anti-TIM3 antibodies do not compete for binding to human TIM3 with anti-TIM3 antibodies comprising CDRs or variable regions of anti-TIM3 antibodies 8B9 and 8C4 (and variants thereof).
- variable region engineering that can be performed is CDR grafting.
- Antibodies interact with target antigens predominantly through amino acid residues that are located in the six heavy and light chain complementarity determining regions (CDRs). For this reason, the amino acid sequences within CDRs are more diverse between individual antibodies than sequences outside of CDRs. Because CDR sequences are responsible for most antibody -antigen interactions, it is possible to express recombinant antibodies that mimic the properties of specific naturally -occurring antibodies by constructing expression vectors that include CDR sequences from the specific naturally-occurring antibody grafted onto framework sequences from a different antibody with different properties (see, e.g., Riechmann, L. et al. (1998) Nature 332:323-327; Jones, P. el al.
- some embodiments described herein pertain to an isolated monoclonal antibody, or antigen binding portion thereof, comprising a heavy chain variable region comprising CDR1, CDR2, and CDR3 sequences comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 41-45 and 469; SEQ ID NOs: 46-52, 122-125, 413, 415, and 470; and SEQ ID NOs: 53-59, 126-129, 414, 416, and 471; respectively, and a light chain variable region comprising CDR1, CDR2, and CDR3 sequences comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 64-65 and 472; SEQ ID NOs: 66-67 and 473; and SEQ ID NOs: 68-71, 419, and 474; respectively.
- Such antibodies contain the VH and VL CDR sequences of monoclonal antibodies 13A3, 3G4, 17C3, 17C8, 9F6, 8B9, 8C4, 14H7, 23B3, or any one of TIM3.2 to TIM3.18, TIM3.20, TIM3.21, TIM3.22, TIM3.23, TIM3.24, or TIM3.25, yet can contain different framework sequences from these antibodies.
- Such framework sequences can be obtained from public DNA databases or published references that include germline antibody gene sequences.
- germline DNA sequences for human heavy and light chain variable region genes can be found in the "VBase" human germline sequence database (available on the Internet at www.mrc-cpe.cam.ac.uk/vbase), as well as in Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242; Tomlinson, I. M, et al.
- the framework sequences for use in the anti-TIM3 antibodies described herein are those that are structurally similar to the framework sequences used by the anti-TIM3 antibodies described herein.
- the VH CDR1, 2 and 3 sequences, and the VL CDR1, 2 and 3 sequences can be grafted onto framework regions that have the identical sequence as that found in the germline immunoglobulin gene from which the framework sequence derive, or the CDR sequences can be grafted onto framework regions that contain one or more mutations as compared to the germline sequences.
- it has been found that in certain instances it is beneficial to mutate residues within the framework regions to maintain or enhance the antigen binding ability of the antibody see, e.g., U.S. Patent Nos. 5,530, 101; 5,585,089; 5,693,762; and 6,180,370 to Queen et al).
- Engineered anti-TIM3 antibodies described herein include those in which modifications have been made to framework residues within VH and/or VL, e.g., to improve the properties of the antibody, e.g., a mutation at amino acid 107 in 9F6.
- framework modifications are made to decrease the immunogenicity of the antibody.
- one approach is to "backmutate" one or more framework residues to the corresponding germline sequence. More specifically, an antibody that has undergone somatic mutation can contain framework residues that differ from the germline sequence from which the antibody is derived. Such residues can be identified by comparing the antibody framework sequences to the germline sequences from which the antibody is derived.
- the somatic mutations can be "backmutated” to the germline sequence by, for example, site-directed mutagenesis or PCR-mediated mutagenesis. Such "backmutated” antibodies are also intended to be encompassed.
- Another type of framework modification involves mutating one or more residues within the framework region, or even within one or more CDR regions, to remove T cell epitopes to thereby reduce the potential immunogenicity of the antibody. This approach is also referred to as "deimmunization" and is described in further detail in U S. Patent Publication No. 20030153043 by Carr et al.
- variable region modification is to mutate amino acid residues within the VH and/or VL CDR1, CDR2 and/or CDR3 regions to thereby improve one or more binding properties (e.g., affinity) of the antibody of interest.
- Site-directed mutagenesis or PCR-mediated mutagenesis can be performed to introduce the mutation(s) and the effect on antibody binding, or other functional property of interest, can be evaluated in in vitro or in vivo assays as described herein and provided in the Examples. In some embodiments, conservative modifications (as discussed above) are introduced.
- the mutations can be amino acid substitutions, additions or deletions. Moreover, typically no more than one, two, three, four or five residues within a CDR region are altered.
- isolated anti-TIM3 monoclonal antibodies, or antigen binding portions thereof, comprising a heavy chain variable region comprising:
- VH CDR1 region comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 41-45 and 469, or an amino acid sequence having one, two, three, four or five amino acid substitutions, deletions or additions as compared to SEQ ID NOs: 41-45 and 469;
- VH CDR2 region comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 46-52, 122-125, 413, 415, and 470, or an amino acid sequence having one, two, three, four or five amino acid substitutions, deletions or additions as compared to SEQ ID NOs: 46-52, 122-125, 413, 415, and 470;
- VH CDR3 region comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 53-59, 126-129, 414, 416, and 471, or an amino acid sequence having one, two, three, four or five amino acid substitutions, deletions or additions as compared to SEQ ID NOs: 53-59, 126-129, 414, 416, and 471;
- VL CDR1 region comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 64-65 and 472, or an amino acid sequence having one, two, three, four or five amino acid substitutions, deletions or additions as compared to SEQ ID NOs: 64-65 and 472;
- VL CDR2 region comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 66-67 and 473, or an amino acid sequence having one, two, three, four or five amino acid substitutions, deletions or additions as compared to SEQ ID NOs: 66-67 and 473; and
- VL CDR3 region comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 68-71, 419, and 474, or an amino acid sequence having one, two, three, four or live amino acid substitutions, deletions or additions as compared to SEQ ID NOs: 68-71, 419, and 474.
- Methionine residues in CDRs of antibodies can be oxidized, resulting in potential chemical degradation and consequent reduction in potency of the antibody. Accordingly, also provided are anti-TIM3 antibodies which have one or more methionine residues in the heavy and/or light chain CDRs replaced with amino acid residues which do not undergo oxidative degradation.
- the methionine residues in the CDRs of antibodies 13A3, 3G4, 17C3, 17C8, 9F6, 8B9, 8C4, 14H7, 23B3, or any of TIM3.2 to TIM3.18, TIM3.20, TIM3.21, TIM3.22, TIM3.23, TIM3.24, and TIM3.25 are replaced with amino acid residues which do not undergo oxidative degradation
- deamidation sites can be removed from anti-TIM3 antibodies, particularly in the CDRs.
- Anti-TIM3 variable regions described herein can be linked (e.g., covalently linked or fused) to an
- lgGl an lgGl, IgG2, IgG3 or IgG4 Fc, which can be of any allotype or isoallotype, e.g., for lgGl : Glm, Glml(a), Glm2(x), Glm3(f), Glml7(z); for IgG2: G2m, G2m23(n); for IgG3 : G3m, G3m21(gl), G3m28(g5), G3ml l(b0), G3m5(bl), G3ml3(b3), G3ml4(b4), G3ml0(b5), G3ml5(s), G3ml6(t), G3m6(c3), G3m24(c5), G3m26(u), G3m27(v); and for K: Km, Kml, Km2, Km3 (see, e.g.,
- anti-TIM3 variable regions described herein are linked to an effectorless or mostly effectorless Fc, e.g., IgGl.
- variable regions described herein can be linked to an Fc comprising one or more modification, typically to alter one or more functional properties of the antibody, such as serum half-life, complement fixation, Fc receptor binding, and/or antigen-dependent cellular cytotoxicity.
- an antibody described herein can be chemically modified (e.g., , one or more chemical moieties can be attached to the antibody) or be modified to alter its glycosylation, to alter one or more functional properties of the antibody.
- the numbering of residues in the Fc region is that of the EU index of Kabat.
- the Fc region encompasses domains derived from the constant region of an immunoglobulin, including a fragment, analog, variant, mutant or derivative of the constant region.
- Suitable immunoglobulins include IgGl, IgG2, IgG3, IgG4, and other classes such as IgA, IgD, IgE and IgM,
- the constant region of an immunoglobulin is defined as a naturally- occurring or synthetically -produced polypeptide homologous to the immunoglobulin C-terminal region, and can include a CHI domain, a hinge, a CH2 domain, a CH3 domain, or a CH4 domain, separately or in combination.
- Ig molecules interact with multiple classes of cellular receptors.
- IgG molecules interact with three classes of Fey receptors (FcyR) specific for the IgG class of antibody, namely FcyRI, FcyRII, and FcyRIII.
- FcyR Fey receptors
- the important sequences for the binding of IgG to the FcyR receptors have been reported to be located in the CH2 and CH3 domains.
- the serum half-life of an antibody is influenced by the ability of that antibody to bind to an Fc receptor (FcR).
- the Fc region is a variant Fc region, e.g., an Fc sequence that has been modified (e.g., by amino acid substitution, deletion and/or insertion) relative to a parent Fc sequence (e.g., an unmodified Fc polypeptide that is subsequently modified to generate a variant), to provide desirable structural features and/or biological activity
- variants of the constant region or portions thereof e.g., CHI, CL, hinge, CH2 or CH3 domains can comprise 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more mutations, and/or at most 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1 mutation, or 1-10 or 1-5 mutations, or comprise an amino acid sequence that is at least about 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to that of the corresponding wild-lype region or domain (CHI,
- Fc region variants will generally comprise at least one amino acid modification in the Fc region. Combining amino acid modifications is thought to be particularly desirable.
- the variant Fc region can include two, three, four, five, etc. substitutions therein, e.g., of the specific Fc region positions identified herein.
- a variant Fc region can also comprise a sequence alteration wherein amino acids involved in disulfide bond formation are removed or replaced with other amino acids. Such removal can avoid reaction with other cysteine-containing proteins present in the host cell used to produce the anti-TIM3 antibodies described herein. Even when cysteine residues are removed, single chain Fc domains can still form a dimeric Fc domain that is held together non-covalently .
- the Fc region can be modified to make it more compatible with a selected host cell. For example, one can remove the PA sequence near the N-terminus of a typical native Fc region, which can be recognized by a digestive enzyme in E. coli such as proline
- one or more glycosylation sites within the Fc domain can be removed. Residues that are typically glycosylated (e.g., asparagine) can confer cytolytic response. Such residues can be deleted or substituted with unglycosylated residues (e.g., alanine).
- sites involved in interaction with complement such as the Clq binding site, can be removed from the Fc region. For example, one can delete or substitute the EKK sequence of human IgGl.
- sites that affect binding to Fc receptors can be removed, preferably sites other than salvage receptor binding sites.
- an Fc region can be modified to remove an ADCC site.
- ADCC sites are known in the art; see, for example, Molec. Immunol. 29 (5): 633-9 (1992) with regard to ADCC sites in IgGl. Specific examples of variant Fc domains are disclosed for example, in WO 97/34631 and WO 96/32478.
- the hinge region of Fc is modified such that the number of cysteine residues in the hinge region is altered, e.g., increased or decreased.
- This approach is described further in U.S. Patent No. 5,677,425 by Bodmer et al.
- the number of cysteine residues in the hinge region of Fc is altered to, for example, facilitate assembly of the light and heavy chains or to increase or decrease the stability of the antibody.
- the Fc hinge region of an antibody is mutated to decrease the biological half-life of the antibody.
- one or more amino acid mutations are introduced into the CH2-CH3 domain interface region of the Fc-hinge fragment such that the antibody has impaired Staphylococcyl protein A (SpA) binding relative to native Fc-hinge domain SpA binding.
- SpA Staphylococcyl protein A
- the Fc region is altered by replacing at least one amino acid residue with a different amino acid residue to alter the effector function(s) of the antibody.
- one or more amino acids selected from amino acid residues 234, 235, 236, 237, 297, 318, 320, 322, 330, and/or 331 can be replaced with a different amino acid residue such that the antibody has an altered affinity for an effector ligand but retains the antigen-binding ability of the parent antibody.
- the effector ligand to which affinity is altered can be, for example, an Fc receptor or the Cl component of complement. This approach is described in further detail in U.S. Patent Nos. 5,624,821 and 5,648,260, both by Winter et al.
- one or more amino acids selected from amino acid residues 329, 331 and 322 can be replaced with a different amino acid residue such that the antibody has altered Clq binding and/or reduced or abolished complement dependent cytotoxicity (CDC).
- CDC complement dependent cytotoxicity
- one or more amino acid residues within amino acid positions 231 and 239 are altered to thereby alter the ability of the antibody to fix complement This approach is described further in PCT Publication WO 94/29351 by Bodmer et al.
- the Fc region can be modified to decrease antibody dependent cellular cytotoxicity (ADCC) and/or to decrease the affinity for an Fey receptor by modifying one or more amino acids at the following positions: 234, 235, 236, 238, 239, 240, 241 , 243, 244, 245, 247, 248, 249, 252, 254, 255, 256, 258, 262, 263, 264, 265, 267, 268, 269, 270, 272, 276, 278, 280, 283, 285, 286, 289, 290, 292, 293, 294, 295,
- ADCC antibody dependent cellular cytotoxicity
- substitutions include 236A, 239D, 239E, 268D, 267E, 268E, 268F, 324T, 332D, and
- 332E Exemplary variants include 239D/332E, 236A/332E, 236A/239D/332E, 268F/324T, 267E/268F, 267E/324T, and 267E/268F7324T.
- Other modifications for enhancing FcyR and complement interactions include but are not limited to substitutions 298 A, 333A, 334A, 326A, 2471, 339D, 339Q, 280H, 290S, 298D, 298V, 243L, 292P, 300L, 396L, 3051, and 396L. These and other modifications are reviewed in Strohl, 2009, Current Opinion in Biotechnology 20:685-691.
- Fc modifications that increase binding to an Fey receptor include amino acid modifications at any one or more of amino acid positions 238, 239, 248, 249, 252, 254, 255, 256, 258, 265, 267, 268, 269, 270, 272, 279, 280, 283, 285, 298, 289, 290, 292, 293, 294, 295, 296, 298, 301, 303, 305, 307, 312, 315, 324, 327, 329, 330, 335, 337, 338, 340, 360, 373, 376, 379, 382, 388, 389, 398, 414, 416, 419, 430, 434, 435, 437, 438 or 439 of the Fc region, wherein the numbering of the residues in the Fc region is that of the EU index as in abat (WO00/42072).
- Fc modifications that can be made to Fes are those for reducing or ablating binding to FcyR and/or complement proteins, thereby reducing or ablating Fc-mediated effector functions such as ADCC,
- ADCP, and CDC ADCP, and CDC.
- Exemplary modifications include but are not limited substitutions, insertions, and deletions at positions 234, 235, 236, 237, 267, 269, 325, 328, 330, and/or 331 (e.g., 330 and 331), wherein numbering is according to the EU index.
- Exemplary substitutions include but are not limited to 234A, 235E, 236R, 237A, 267R, 269R, 325L, 328R, 330S, and 33 IS (e.g., 330S, and 33 IS), wherein numbering is according to the EU index.
- An Fc variant can comprise 236R/328R.
- Other modifications for reducing FcyR and complement interactions include substitutions 297 A, 234A, 235A, 237A, 318A, 228P, 236E, 268Q, 309L, 330S, 331 S,
- the Fc region can comprise a non-naturally-occurring amino acid residue at additional and/or alternative positions known to one skilled in the art (see, e.gaci U.S. Pat. Nos. 5,624,821; 6,277,375; 6,737,056; 6,194,551; 7,317,091; 8,101,720; PCX Patent Publications WO 00/42072; WO 01/58957; WO 02/06919; WO 04/016750; WO 04/029207; WO 04/035752; WO 04/074455; WO 04/099249; WO 04/063351; WO 05/070963; WO 05/040217, WO 05/092925 and WO 06/0201 14).
- Fc variants that enhance affinity for an inhibitory receptor FcyRIIb can also be used. Such variants can provide an Fc fusion protein with immunomodulatory activities related to FcyRIIb cells, including for example B cells and monocytes. In some embodiments, the Fc variants provide selectively enhanced affinity to FcyRIIb relative to one or more activating receptors. Modifications for altering binding to FcyRIIb include one or more modifications at a position selected from the group consisting of 234, 235, 236, 237, 239, 266, 267, 268, 325, 326, 327, 328, 330, 331, and 332, according to the EU index.
- Exemplary substitutions for enhancing FcyRIIb affinity include but are not limited to 234A, 234D, 234E, 234F, 234W, 235D, 235E, 235F, 235R, 235Y, 236D, 236N, 237A, 237D, 237N, 239D, 239E, 266M, 267D, 267E, 268D, 268E, 327D, 327E, 328F, 328W,
- FcyRIIb FcyRIIb
- the affinities and binding properties of an Fc region for its ligand can be determined by a variety of in vitro assay methods (biochemical or immunological based assays) known in the art including but not limited to, equilibrium methods (e.g., enzyme-linked immunosorbent assay (ELISA), or radioimmunoassay (RIA)), or kinetics (e.g., BIACORE analysis), and other methods such as indirect binding assays, competitive inhibition assays, fluorescence resonance energy transfer (FRET), gel electrophoresis and chromatography (e.g., gel filtration).
- in vitro assay methods biochemical or immunological based assays
- equilibrium methods e.g., enzyme-linked immunosorbent assay (ELISA), or radioimmunoassay (RIA)
- kinetics e.g., BIACORE analysis
- indirect binding assays e.g., competitive inhibition assays, fluorescence resonance energy transfer (FRET), gel electrophoresis and
- the antibody is modified to increase its biological half-life.
- this can be done by increasing the binding affinity of the Fc region for FcRn,
- one or more of more of following residues can be mutated: 252, 254, 256, 433, 435, 436, as described in U.S. Pat. No. 6,277,375.
- Specific exemplary substitutions include one or more of the following: T252L, T254S, and/or T256F.
- the antibody can be altered within the CHI or CL region to contain a salvage receptor binding epitope taken from two loops of a CH2 domain of an Fc region of an IgG, as described in U.S.
- Other exemplary variants that increase binding to FcRn and/or improve pharmacokinetic properties include substitutions at positions 259, 308, 428, and 434, including for example 2591, 308F, 428L, 428M, 434S, 4341 1. 434F, 434Y, and 434X1.
- Other variants that increase Fc binding to FcRn include: 250E, 250Q, 428 L, 428F, 250Q/428L (Hinton et al. 2004, J. Biol. Chem. 279(8): 6213-6216, Hinton et al.
- hybrid IgG isotypes with particular biological characteristics can be used.
- an IgGl/IgG3 hybrid variant can be constructed by substituting IgGl positions in the CH2 and/or CH3 region with the amino acids from IgG3 at positions where the two isotypes differ.
- a hybrid variant IgG antibody can be constructed that comprises one or more substitutions, e.g., 274Q, 276K, 300F, 339T, 356E, 358M, 384S, 392N, 397M, 4221, 435R, and 436F.
- an IgGl/IgG2 hybrid variant can be constructed by substituting IgG2 positions in the CH2 and/or CH3 region with amino acids from IgGl at positions where the two isotypes differ.
- a hybrid variant IgG antibody can be constructed that comprises one or more substitutions, e.g., one or more of the following amino acid substitutions: 233E, 234L, 235L, -236G (referring to an insertion of a glycine at position 236), and 327 A.
- S239D/I332E/A330L mutations which showed the greatest increase in affinity for FcyRIIIa, a decrease in FcyRIIb binding, and strong cytotoxic activity in cynomolgus monkeys (Lazar et al, 2006).
- Introduction of the triple mutations into antibodies such as alemtuzumab (CD52-specific), trastuzumab (HER2/neu-specific), rituximab (CD20-specific), and cetuximab (EGFR- specific) translated into greatly enhanced ADCC activity in vitro, and the S239D/I332E variant showed an enhanced capacity to deplete B cells in monkeys (Lazar et al, 2006).
- IgGl mutants containing L235 V, F243L, R292P, Y300L and P396L mutations which exhibited enhanced binding to FcyRIIIa and concomitantly enhanced ADCC activity in transgenic mice expressing human FcyRIIIa in models of B cell malignancies and breast cancer have been identified
- Fc mutants include:
- an Fc is chosen that has reduced binding to FcyRs.
- An exemplary Fc, e.g., IgGl Fc, with reduced FcyR binding comprises the following three amino acid substitutions: L234A, L235E and G237A.
- an Fc is chosen that has reduced complement fixation.
- An exemplary Fc, e.g., IgGl Fc, with reduced complement fixation has the following two amino acid substitutions: A330S and P331S.
- an Fc is chosen that has essentially no effector function, i.e., it has reduced binding to FcyRs and reduced complement fixation.
- An exemplary Fc, e.g., IgGl Fc, that is effectorless comprises the following five mutations: L234A, L235E, G237A, A330S and P33 IS.
- IgG4 constant domain when using an IgG4 constant domain, it can include the substitution S228P, which mimics the hinge sequence in IgGl and thereby stabilizes IgG4 molecules.
- the glycosylation of an antibody is modified.
- an aglycoslated antibody can be made (i.e., the antibody lacks glycosylation).
- Glycosylation can be altered to, for example, increase the affinity of the antibody for antigen.
- carbohydrate modifications can be accomplished by, for example, altering one or more sites of glycosylation within the antibody sequence.
- one or more amino acid substitutions can be made that result in elimination of one or more variable region framework glycosylation sites to thereby eliminate glycosylation at that site.
- Such aglycosylation can increase the affinity of the antibody for antigen.
- Such an approach is described in further detail in U.S. Patent Nos. 5,714,350 and 6,350,861 by Co et al.
- Glycosylation of the constant region on N297 can be prevented by mutating the N297 residue to another residue, e.g., N297A, and/or by mutating an adjacent amino acid, e.g., 298 to thereby reduce glycosylation on N297.
- an antibody can be made that has an altered type of glycosylation, such as a hypofucosylated antibody having reduced amounts of fucosyl residues or an antibody having increased bisecting GlcNac structures.
- Such altered glycosylation patterns have been demonstrated to increase the ADCC ability of antibodies.
- carbohydrate modifications can be accomplished by, for example, expressing the antibody in a host cell with altered glycosylation machinery. Cells with altered glycosylation machinery have been described in the art and can be used as host cells in which to express recombinant anti-TDVB antibodies described herein to thereby produce an antibody with altered glycosylation.
- PCT Publication WO 03/035835 by Presta describes a variant CHO cell line, Led 3 cells, with reduced ability to attach fucose to Asn(297)-linked carbohydrates, also resulting in hypofucosylation of antibodies expressed in that host cell (see also Shields, R.L. et al. (2002) J. Biol. Chem. 277:26733-26740).
- PCT Publication WO 99/54342 by Umana et al.
- glycoprotein-modifying glycosyl transferases e.g., beta(l,4)-N- acetylglucosaminyltransferase III (GnTIII)
- GnTIII glycoprotein-modifying glycosyl transferases
- an antibody can be pegylated to, for example, increase the biological (e.g., serum) half-life of the antibody.
- the antibody, or fragment thereof typically is reacted with polyethylene glycol (PEG), such as a reactive ester or aldehyde derivative of PEG, under conditions in which one or more PEG groups become attached to the antibody or antibody fragment.
- PEG polyethylene glycol
- the pegylation is carried out via an acylation reaction or an alkylation reaction with a reactive PEG molecule (or an analogous reactive water- soluble polymer).
- polyethylene glycol is intended to encompass any of the forms of PEG that have been used to derivatize other proteins, such as mono (CI-CIO) alkoxy- or arylox -polyethylene glycol or polyethylene glycol-maleimide.
- the antibody to be pegylated is an aglycosylated antibody. Methods for pegylating proteins are known in the art and can be applied to the anti- TIM3 antibodies described herein. See, for example, EP 0 154 316 by Nishimura et al. and EP 0 401 384 by Ishikawa et al.
- an anti-TIM3 antibody comprises a heavy chain constant region and a light chain constant region, wherein the heavy chain constant region is selected from the group consisting of SEQ ID NOs: 130-133.
- Anti-TIM3 antibodies e.g., those described herein, have some or all of the physical characteristics of the specific anti-TIM3 antibodies described herein, such as the characteristics described in the Examples.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Biomedical Technology (AREA)
- Food Science & Technology (AREA)
- Cell Biology (AREA)
- Pathology (AREA)
- Microbiology (AREA)
- General Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- Biotechnology (AREA)
- Physics & Mathematics (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Priority Applications (10)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020257017108A KR20250078626A (ko) | 2018-01-12 | 2019-01-11 | Tim3에 대한 항체 및 그의 용도 |
| JP2020538616A JP7358361B2 (ja) | 2018-01-12 | 2019-01-11 | Tim3に対する抗体およびその使用 |
| KR1020207022936A KR102813913B1 (ko) | 2018-01-12 | 2019-01-11 | Tim3에 대한 항체 및 그의 용도 |
| CN201980018622.8A CN111886255B (zh) | 2018-01-12 | 2019-01-11 | 抗tim3抗体及其用途 |
| CN202510367409.5A CN120192415A (zh) | 2018-01-12 | 2019-01-11 | 抗tim3抗体及其用途 |
| US16/961,545 US12129297B2 (en) | 2018-01-12 | 2019-01-11 | Antibodies against TIM3 and uses thereof |
| EP19702762.6A EP3737700A1 (en) | 2018-01-12 | 2019-01-11 | Antibodies against tim3 and uses thereof |
| JP2023165245A JP7762186B2 (ja) | 2018-01-12 | 2023-09-27 | Tim3に対する抗体およびその使用 |
| US18/891,677 US20250115664A1 (en) | 2018-01-12 | 2024-09-20 | Antibodies against tim3 and uses thereof |
| JP2025175516A JP2026035570A (ja) | 2018-01-12 | 2025-10-17 | Tim3に対する抗体およびその使用 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201862616723P | 2018-01-12 | 2018-01-12 | |
| US62/616,723 | 2018-01-12 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/961,545 A-371-Of-International US12129297B2 (en) | 2018-01-12 | 2019-01-11 | Antibodies against TIM3 and uses thereof |
| US18/891,677 Division US20250115664A1 (en) | 2018-01-12 | 2024-09-20 | Antibodies against tim3 and uses thereof |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2019140229A1 true WO2019140229A1 (en) | 2019-07-18 |
Family
ID=65269094
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2019/013246 Ceased WO2019140229A1 (en) | 2018-01-12 | 2019-01-11 | Antibodies against tim3 and uses thereof |
Country Status (6)
| Country | Link |
|---|---|
| US (2) | US12129297B2 (enExample) |
| EP (1) | EP3737700A1 (enExample) |
| JP (3) | JP7358361B2 (enExample) |
| KR (2) | KR20250078626A (enExample) |
| CN (2) | CN111886255B (enExample) |
| WO (1) | WO2019140229A1 (enExample) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN113214396A (zh) * | 2020-07-31 | 2021-08-06 | 北京市神经外科研究所 | 抗tim3的单链抗体及其在制备治疗肿瘤的药物中的用途 |
| WO2021169948A1 (zh) * | 2020-02-24 | 2021-09-02 | 苏州恒康生命科学有限公司 | Tim3结合分子及其应用 |
| EP4083065A1 (en) | 2021-01-28 | 2022-11-02 | NantBio, Inc. | Anti-tim3 monoclonal antibodies and chimeric antigen receptors |
Families Citing this family (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN109757103B (zh) | 2016-07-14 | 2024-01-02 | 百时美施贵宝公司 | 针对tim3的抗体及其用途 |
| EP3737700A1 (en) | 2018-01-12 | 2020-11-18 | Bristol-Myers Squibb Company | Antibodies against tim3 and uses thereof |
| CN112961239B (zh) * | 2021-02-24 | 2021-09-10 | 北京昭衍生物技术有限公司 | Tim抑制剂及其应用 |
| EP4326773A4 (en) | 2021-04-23 | 2025-09-24 | Suzhou Neologics Bioscience Co Ltd | ANTIBODIES TARGETING TIM-3 AND THEIR USES |
| WO2026059950A1 (en) * | 2024-09-10 | 2026-03-19 | Agilent Technologies, Inc. | Anti-human tim3 antibodies for in vitro diagnostics |
| CN120230216B (zh) * | 2025-05-29 | 2025-09-09 | 上海宏成药业有限公司 | 抗lair1抗体及其用途 |
Citations (171)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4399216A (en) | 1980-02-25 | 1983-08-16 | The Trustees Of Columbia University | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US4439196A (en) | 1982-03-18 | 1984-03-27 | Merck & Co., Inc. | Osmotic drug delivery system |
| US4447233A (en) | 1981-04-10 | 1984-05-08 | Parker-Hannifin Corporation | Medication infusion pump |
| US4447224A (en) | 1982-09-20 | 1984-05-08 | Infusaid Corporation | Variable flow implantable infusion apparatus |
| US4475196A (en) | 1981-03-06 | 1984-10-02 | Zor Clair G | Instrument for locating faults in aircraft passenger reading light and attendant call control system |
| US4486194A (en) | 1983-06-08 | 1984-12-04 | James Ferrara | Therapeutic device for administering medicaments through the skin |
| US4487603A (en) | 1982-11-26 | 1984-12-11 | Cordis Corporation | Implantable microinfusion pump system |
| US4522811A (en) | 1982-07-08 | 1985-06-11 | Syntex (U.S.A.) Inc. | Serial injection of muramyldipeptides and liposomes enhances the anti-infective activity of muramyldipeptides |
| EP0154316A2 (en) | 1984-03-06 | 1985-09-11 | Takeda Chemical Industries, Ltd. | Chemically modified lymphokine and production thereof |
| US4596556A (en) | 1985-03-25 | 1986-06-24 | Bioject, Inc. | Hypodermic injection apparatus |
| US4634665A (en) | 1980-02-25 | 1987-01-06 | The Trustees Of Columbia University In The City Of New York | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US4683195A (en) | 1986-01-30 | 1987-07-28 | Cetus Corporation | Process for amplifying, detecting, and/or-cloning nucleic acid sequences |
| WO1987004462A1 (en) | 1986-01-23 | 1987-07-30 | Celltech Limited | Recombinant dna sequences, vectors containing them and method for the use thereof |
| US4790824A (en) | 1987-06-19 | 1988-12-13 | Bioject, Inc. | Non-invasive hypodermic injection device |
| WO1989001036A1 (en) | 1987-07-23 | 1989-02-09 | Celltech Limited | Recombinant dna expression vectors |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| EP0338841A1 (en) | 1988-04-18 | 1989-10-25 | Celltech Limited | Recombinant DNA methods, vectors and host cells |
| US4881175A (en) | 1986-09-02 | 1989-11-14 | Genex Corporation | Computer based system and method for determining and displaying possible chemical structures for converting double- or multiple-chain polypeptides to single-chain polypeptides |
| US4941880A (en) | 1987-06-19 | 1990-07-17 | Bioject, Inc. | Pre-filled ampule and non-invasive hypodermic injection device assembly |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| EP0401384A1 (en) | 1988-12-22 | 1990-12-12 | Kirin-Amgen, Inc. | Chemically modified granulocyte colony stimulating factor |
| US5013653A (en) | 1987-03-20 | 1991-05-07 | Creative Biomolecules, Inc. | Product and process for introduction of a hinge region into a fusion protein to facilitate cleavage |
| US5064413A (en) | 1989-11-09 | 1991-11-12 | Bioject, Inc. | Needleless hypodermic injection device |
| US5091513A (en) | 1987-05-21 | 1992-02-25 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
| WO1992003918A1 (en) | 1990-08-29 | 1992-03-19 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5132405A (en) | 1987-05-21 | 1992-07-21 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
| US5179017A (en) | 1980-02-25 | 1993-01-12 | The Trustees Of Columbia University In The City Of New York | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| WO1993012227A1 (en) | 1991-12-17 | 1993-06-24 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| US5258498A (en) | 1987-05-21 | 1993-11-02 | Creative Biomolecules, Inc. | Polypeptide linkers for production of biosynthetic proteins |
| US5260203A (en) | 1986-09-02 | 1993-11-09 | Enzon, Inc. | Single polypeptide chain binding molecules |
| US5312335A (en) | 1989-11-09 | 1994-05-17 | Bioject Inc. | Needleless hypodermic injection device |
| WO1994025585A1 (en) | 1993-04-26 | 1994-11-10 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5374548A (en) | 1986-05-02 | 1994-12-20 | Genentech, Inc. | Methods and compositions for the attachment of proteins to liposomes using a glycophospholipid anchor |
| WO1994029351A2 (en) | 1993-06-16 | 1994-12-22 | Celltech Limited | Antibodies |
| US5383851A (en) | 1992-07-24 | 1995-01-24 | Bioject Inc. | Needleless hypodermic injection device |
| US5399331A (en) | 1985-06-26 | 1995-03-21 | The Liposome Company, Inc. | Method for protein-liposome coupling |
| US5416016A (en) | 1989-04-03 | 1995-05-16 | Purdue Research Foundation | Method for enhancing transmembrane transport of exogenous molecules |
| US5427908A (en) | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
| WO1995017886A1 (en) | 1993-12-27 | 1995-07-06 | Baxter International Inc. | Water soluble non-immunogenic polyamide cross-linking agents |
| US5476786A (en) | 1987-05-21 | 1995-12-19 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
| US5476996A (en) | 1988-06-14 | 1995-12-19 | Lidak Pharmaceuticals | Human immune system in non-human animal |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5545807A (en) | 1988-10-12 | 1996-08-13 | The Babraham Institute | Production of antibodies from transgenic animals |
| WO1996032478A1 (en) | 1995-04-14 | 1996-10-17 | Genentech, Inc. | Altered polypeptides with increased half-life |
| WO1997013852A1 (en) | 1995-10-10 | 1997-04-17 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| WO1997034631A1 (en) | 1996-03-18 | 1997-09-25 | Board Of Regents, The University Of Texas System | Immunoglobin-like domains with increased half lives |
| US5677425A (en) | 1987-09-04 | 1997-10-14 | Celltech Therapeutics Limited | Recombinant antibody |
| US5714350A (en) | 1992-03-09 | 1998-02-03 | Protein Design Labs, Inc. | Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region |
| WO1998024884A1 (en) | 1996-12-02 | 1998-06-11 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies |
| US5789650A (en) | 1990-08-29 | 1998-08-04 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5811097A (en) | 1995-07-25 | 1998-09-22 | The Regents Of The University Of California | Blockade of T lymphocyte down-regulation associated with CTLA-4 signaling |
| US5814318A (en) | 1990-08-29 | 1998-09-29 | Genpharm International Inc. | Transgenic non-human animals for producing heterologous antibodies |
| WO1998042752A1 (en) | 1997-03-21 | 1998-10-01 | Brigham And Women's Hospital Inc. | Immunotherapeutic ctla-4 binding peptides |
| US5837243A (en) | 1995-06-07 | 1998-11-17 | Medarex, Inc. | Therapeutic compounds comprised of anti-Fc receptor antibodies |
| US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US5874299A (en) | 1990-08-29 | 1999-02-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5877397A (en) | 1990-08-29 | 1999-03-02 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5885793A (en) | 1991-12-02 | 1999-03-23 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US5922845A (en) | 1996-07-11 | 1999-07-13 | Medarex, Inc. | Therapeutic multispecific compounds comprised of anti-Fcα receptor antibodies |
| US5939598A (en) | 1990-01-12 | 1999-08-17 | Abgenix, Inc. | Method of making transgenic mice lacking endogenous heavy chains |
| WO1999045962A1 (en) | 1998-03-13 | 1999-09-16 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5969108A (en) | 1990-07-10 | 1999-10-19 | Medical Research Council | Methods for producing members of specific binding pairs |
| WO1999054342A1 (en) | 1998-04-20 | 1999-10-28 | Pablo Umana | Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity |
| US6075181A (en) | 1990-01-12 | 2000-06-13 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| WO2000037504A2 (en) | 1998-12-23 | 2000-06-29 | Pfizer Inc. | Human monoclonal antibodies to ctla-4 |
| WO2000042072A2 (en) | 1999-01-15 | 2000-07-20 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US6121022A (en) | 1995-04-14 | 2000-09-19 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US6150584A (en) | 1990-01-12 | 2000-11-21 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US6162963A (en) | 1990-01-12 | 2000-12-19 | Abgenix, Inc. | Generation of Xenogenetic antibodies |
| US6165745A (en) | 1992-04-24 | 2000-12-26 | Board Of Regents, The University Of Texas System | Recombinant production of immunoglobulin-like domains in prokaryotic cells |
| US6172197B1 (en) | 1991-07-10 | 2001-01-09 | Medical Research Council | Methods for producing members of specific binding pairs |
| US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
| WO2001014424A2 (en) | 1999-08-24 | 2001-03-01 | Medarex, Inc. | Human ctla-4 antibodies and their uses |
| WO2001058957A2 (en) | 2000-02-11 | 2001-08-16 | Lexigen Pharmaceuticals Corp. | Enhancing the circulating half-life of antibody-based fusion proteins |
| US6277375B1 (en) | 1997-03-03 | 2001-08-21 | Board Of Regents, The University Of Texas System | Immunoglobulin-like domains with increased half-lives |
| WO2002006919A2 (en) | 2000-07-18 | 2002-01-24 | Aegis Analytical Corporation | System, method and computer program product for mapping data of multi-database origins |
| EP1176195A1 (en) | 1999-04-09 | 2002-01-30 | Kyowa Hakko Kogyo Co., Ltd. | Method for controlling the activity of immunologically functional molecule |
| WO2002043478A2 (en) | 2000-11-30 | 2002-06-06 | Medarex, Inc. | Transgenic transchromosomal rodents for making human antibodies |
| US6437095B1 (en) | 1999-08-02 | 2002-08-20 | Hoffmann-La Roche Inc. | Method for producing chimeric polypeptides |
| WO2002092780A2 (en) | 2001-05-17 | 2002-11-21 | Diversa Corporation | Novel antigen binding molecules for therapeutic, diagnostic, prophylactic, enzymatic, industrial, and agricultural applications, and methods for generating and screening thereof |
| WO2002096910A1 (en) | 2001-05-31 | 2002-12-05 | Medarex, Inc. | Cytotoxins, prodrugs, linkers and stabilizers useful therefor |
| WO2003035835A2 (en) | 2001-10-25 | 2003-05-01 | Genentech, Inc. | Glycoprotein compositions |
| US20030153043A1 (en) | 1997-05-21 | 2003-08-14 | Biovation Limited | Method for the production of non-immunogenic proteins |
| WO2003074679A2 (en) | 2002-03-01 | 2003-09-12 | Xencor | Antibody optimization |
| WO2003099196A2 (en) | 2002-05-23 | 2003-12-04 | Cure Tech Ltd. | Humanized immunomodulatory monoclonal antibodies for the treatment of neoplastic disease or immunodeficiency |
| US20040014194A1 (en) | 2002-03-27 | 2004-01-22 | Schering Corporation | Beta-secretase crystals and methods for preparing and using the same |
| WO2004016750A2 (en) | 2002-08-14 | 2004-02-26 | Macrogenics, Inc. | FcϜRIIB-SPECIFIC ANTIBODIES AND METHODS OF USE THEREOF |
| WO2004029207A2 (en) | 2002-09-27 | 2004-04-08 | Xencor Inc. | Optimized fc variants and methods for their generation |
| WO2004035752A2 (en) | 2002-10-15 | 2004-04-29 | Protein Design Labs, Inc. | ALTERATION OF FcRn BINDING AFFINITIES OR SERUM HALF-LIVES OF ANTIBODIES BY MUTAGENESIS |
| US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| WO2004063351A2 (en) | 2003-01-09 | 2004-07-29 | Macrogenics, Inc. | IDENTIFICATION AND ENGINEERING OF ANTIBODIES WITH VARIANT Fc REGIONS AND METHODS OF USING SAME |
| WO2004074455A2 (en) | 2003-02-20 | 2004-09-02 | Applied Molecular Evolution | Fc REGION VARIANTS |
| WO2004099249A2 (en) | 2003-05-02 | 2004-11-18 | Xencor, Inc. | Optimized fc variants and methods for their generation |
| WO2005040217A2 (en) | 2003-10-17 | 2005-05-06 | Cambridge University Technical Services Limited | Antibodies having a mutated amino acid residue at position 268 (ch2 region) in constant regions |
| WO2005044853A2 (en) | 2003-11-01 | 2005-05-19 | Genentech, Inc. | Anti-vegf antibodies |
| WO2005070963A1 (en) | 2004-01-12 | 2005-08-04 | Applied Molecular Evolution, Inc | Fc region variants |
| WO2005092925A2 (en) | 2004-03-24 | 2005-10-06 | Xencor, Inc. | Immunoglobulin variants outside the fc region |
| US20060004081A1 (en) | 2004-05-19 | 2006-01-05 | Medarex, Inc. | Cytotoxic compounds and conjugates |
| US20060024317A1 (en) | 2004-05-19 | 2006-02-02 | Medarex, Inc | Chemical linkers and conjugates thereof |
| WO2006020114A2 (en) | 2004-08-04 | 2006-02-23 | Applied Molecular Evolution, Inc. | Variant fc regions |
| WO2006029879A2 (en) | 2004-09-17 | 2006-03-23 | F.Hoffmann-La Roche Ag | Anti-ox40l antibodies |
| WO2006105021A2 (en) | 2005-03-25 | 2006-10-05 | Tolerrx, Inc. | Gitr binding molecules and uses therefor |
| US20060247295A1 (en) | 2005-04-08 | 2006-11-02 | Medarex, Inc. | Cytotoxic compounds and conjugates with cleavable substrates |
| WO2006121168A1 (en) | 2005-05-09 | 2006-11-16 | Ono Pharmaceutical Co., Ltd. | Human monoclonal antibodies to programmed death 1(pd-1) and methods for treating cancer using anti-pd-1 antibodies alone or in combination with other immunotherapeutics |
| WO2006122150A1 (en) | 2005-05-10 | 2006-11-16 | Incyte Corporation | Modulators of indoleamine 2,3-dioxygenase and methods of using the same |
| WO2007005874A2 (en) | 2005-07-01 | 2007-01-11 | Medarex, Inc. | Human monoclonal antibodies to programmed death ligand 1 (pd-l1) |
| WO2007038658A2 (en) | 2005-09-26 | 2007-04-05 | Medarex, Inc. | Antibody-drug conjugates and methods of use |
| WO2007051081A1 (en) | 2005-10-26 | 2007-05-03 | Medarex, Inc. | Methods and compounds for preparing cc-1065 analogs |
| WO2007059404A2 (en) | 2005-11-10 | 2007-05-24 | Medarex, Inc. | Duocarmycin derivatives as novel cytotoxic compounds and conjugates |
| WO2007075598A2 (en) | 2005-12-20 | 2007-07-05 | Incyte Corporation | N-hydroxyamidinoheterocycles as modulators of indoleamine 2,3-dioxygenase |
| US7317091B2 (en) | 2002-03-01 | 2008-01-08 | Xencor, Inc. | Optimized Fc variants |
| WO2008036653A2 (en) | 2006-09-19 | 2008-03-27 | Incyte Corporation | N-hydroxyamidinoheterocycles as modulators of indoleamine 2,3-dioxygenase |
| WO2008036642A2 (en) | 2006-09-19 | 2008-03-27 | Incyte Corporation | N-hydroxyamidinoheterocycles as modulators of indoleamine 2,3-dioxygenase |
| WO2008083312A2 (en) | 2006-12-28 | 2008-07-10 | Medarex, Inc. | Chemical linkers and cleavable substrates and conjugates thereof |
| WO2008103693A2 (en) | 2007-02-21 | 2008-08-28 | Medarex, Inc. | Chemical linkers with single amino acids and conjugates thereof |
| WO2008132601A1 (en) | 2007-04-30 | 2008-11-06 | Immutep | Cytotoxic anti-lag-3 monoclonal antibody and its use in the treatment or prevention of organ transplant rejection and autoimmune disease |
| JP2008278814A (ja) | 2007-05-11 | 2008-11-20 | Igaku Seibutsugaku Kenkyusho:Kk | アゴニスティック抗ヒトgitr抗体による免疫制御の解除とその応用 |
| WO2009014708A2 (en) | 2007-07-23 | 2009-01-29 | Cell Genesys, Inc. | Pd-1 antibodies in combination with a cytokine-secreting cell and methods of use thereof |
| WO2009015777A1 (de) | 2007-08-02 | 2009-02-05 | Knorr-Bremse Systeme für Nutzfahrzeuge GmbH | Induktiver weg- oder drehwinkelsensor mit zwischen zwei spulen angeordnetem abschirmblech |
| WO2009044273A2 (en) | 2007-10-05 | 2009-04-09 | Immutep | Use of recombinant lag-3 or the derivatives thereof for eliciting monocyte immune response |
| WO2009059278A1 (en) | 2007-11-02 | 2009-05-07 | Centocor, Inc. | Semi-synthetic glp-1 peptide-fc fusion constructs, methods and uses |
| US20090145493A1 (en) | 2004-11-23 | 2009-06-11 | Pip Co., Ltd. | Built-in wall water service box |
| WO2009073620A2 (en) | 2007-11-30 | 2009-06-11 | Newlink Genetics | Ido inhibitors |
| WO2009114335A2 (en) | 2008-03-12 | 2009-09-17 | Merck & Co., Inc. | Pd-1 binding proteins |
| WO2009115652A2 (fr) | 2008-01-03 | 2009-09-24 | Universite De La Mediterannee, Aix-Marseille Ii | Composition et procedes utilisables lors d'un traitement anti-vih |
| US7635757B2 (en) | 1999-08-23 | 2009-12-22 | Dana-Farber Cancer Institute, Inc. | B7-4 Antibodies and uses therefor |
| US20090317368A1 (en) | 1999-11-30 | 2009-12-24 | Lieping Chen | B7-h1, a novel immunoregulatory molecule |
| WO2010019570A2 (en) | 2008-08-11 | 2010-02-18 | Medarex, Inc. | Human antibodies that bind lymphocyte activation gene-3 (lag-3), and uses thereof |
| US20100069614A1 (en) | 2008-06-27 | 2010-03-18 | Merus B.V. | Antibody producing non-human mammals |
| US20110007023A1 (en) | 2009-07-09 | 2011-01-13 | Sony Ericsson Mobile Communications Ab | Display device, touch screen device comprising the display device, mobile device and method for sensing a force on a display device |
| WO2011028683A1 (en) | 2009-09-03 | 2011-03-10 | Schering Corporation | Anti-gitr antibodies |
| WO2011056652A1 (en) | 2009-10-28 | 2011-05-12 | Newlink Genetics | Imidazole derivatives as ido inhibitors |
| WO2011066389A1 (en) | 2009-11-24 | 2011-06-03 | Medimmmune, Limited | Targeted binding agents against b7-h1 |
| WO2011070024A1 (en) | 2009-12-10 | 2011-06-16 | F. Hoffmann-La Roche Ag | Antibodies binding preferentially human csf1r extracellular domain 4 and their use |
| WO2011072204A1 (en) | 2009-12-10 | 2011-06-16 | Regeneron Pharmaceuticals, Inc. | Mice that make heavy chain antibodies |
| WO2011097603A1 (en) | 2010-02-08 | 2011-08-11 | Regeneron Pharmaceuticals, Inc. | Common light chain mouse |
| WO2011107553A1 (en) | 2010-03-05 | 2011-09-09 | F. Hoffmann-La Roche Ag | Antibodies against human csf-1r and uses thereof |
| WO2011109400A2 (en) | 2010-03-04 | 2011-09-09 | Macrogenics,Inc. | Antibodies reactive with b7-h3, immunologically active fragments thereof and uses thereof |
| WO2011131407A1 (en) | 2010-03-05 | 2011-10-27 | F. Hoffmann-La Roche Ag | Antibodies against human csf-1r and uses thereof |
| WO2011140249A2 (en) | 2010-05-04 | 2011-11-10 | Five Prime Therapeutics, Inc. | Antibodies that bind csf1r |
| WO2011163311A1 (en) | 2010-06-22 | 2011-12-29 | Regeneron Pharmaceuticals, Inc. | Mice expressing alight chain with human lambda variable and mouse constant regions |
| WO2011161699A2 (en) | 2010-06-25 | 2011-12-29 | Aurigene Discovery Technologies Limited | Immunosuppression modulating compounds |
| US8101720B2 (en) | 2004-10-21 | 2012-01-24 | Xencor, Inc. | Immunoglobulin insertions, deletions and substitutions |
| WO2012032433A1 (en) | 2010-09-09 | 2012-03-15 | Pfizer Inc. | 4-1bb binding molecules |
| US8217149B2 (en) | 2008-12-09 | 2012-07-10 | Genentech, Inc. | Anti-PD-L1 antibodies, compositions and articles of manufacture |
| WO2012142237A1 (en) | 2011-04-15 | 2012-10-18 | Newlink Geneticks Corporation | Fused imidazole derivatives useful as ido inhibitors |
| WO2012145493A1 (en) | 2011-04-20 | 2012-10-26 | Amplimmune, Inc. | Antibodies and other molecules that bind b7-h1 and pd-1 |
| WO2012148873A2 (en) | 2011-04-25 | 2012-11-01 | Regeneron Pharmaceuticals, Inc. | Non-human animals expressing antibodies having a common light chain |
| WO2013079174A1 (en) | 2011-11-28 | 2013-06-06 | Merck Patent Gmbh | Anti-pd-l1 antibodies and uses thereof |
| WO2013087699A1 (en) | 2011-12-15 | 2013-06-20 | F. Hoffmann-La Roche Ag | Antibodies against human csf-1r and uses thereof |
| WO2013119716A1 (en) | 2012-02-06 | 2013-08-15 | Genentech, Inc. | Compositions and methods for using csf1r inhibitors |
| WO2013132044A1 (en) | 2012-03-08 | 2013-09-12 | F. Hoffmann-La Roche Ag | Combination therapy of antibodies against human csf-1r and uses thereof |
| WO2013169264A1 (en) | 2012-05-11 | 2013-11-14 | Five Prime Therapeutics, Inc. | Methods of treating conditions with antibodies that bind colony stimulating factor 1 receptor (csf1r) |
| WO2013173223A1 (en) | 2012-05-15 | 2013-11-21 | Bristol-Myers Squibb Company | Cancer immunotherapy by disrupting pd-1/pd-l1 signaling |
| WO2014008218A1 (en) | 2012-07-02 | 2014-01-09 | Bristol-Myers Squibb Company | Optimization of antibodies that bind lymphocyte activation gene-3 (lag-3), and uses thereof |
| WO2014036357A1 (en) | 2012-08-31 | 2014-03-06 | Five Prime Therapeutics, Inc. | Methods of treating conditions with antibodies that bind colony stimulating factor 1 receptor (csf1r) |
| WO2015018735A2 (de) | 2013-08-05 | 2015-02-12 | Tridonic Gmbh & Co Kg | Dimmbare led-leuchtmittelstrecke |
| WO2015031667A2 (en) | 2013-08-30 | 2015-03-05 | Amgen Inc. | Gitr antigen binding proteins |
| WO2015184099A1 (en) | 2014-05-28 | 2015-12-03 | 4-Antibody Ag | Anti-gitr antibodies and methods of use thereof |
| WO2015187835A2 (en) | 2014-06-06 | 2015-12-10 | Bristol-Myers Squibb Company | Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof |
| WO2016054638A1 (en) | 2014-10-03 | 2016-04-07 | Dana-Farber Cancer Institute, Inc. | Glucocorticoid-induced tumor necrosis factor receptor (gitr) antibodies and methods of use thereof |
| WO2016057846A1 (en) | 2014-10-08 | 2016-04-14 | Novartis Ag | Compositions and methods of use for augmented immune response and cancer therapy |
| WO2016071448A1 (en) * | 2014-11-06 | 2016-05-12 | F. Hoffmann-La Roche Ag | Anti-tim3 antibodies and methods of use |
| WO2017178493A1 (en) * | 2016-04-12 | 2017-10-19 | Symphogen A/S | Anti-tim-3 antibodies and compositions |
Family Cites Families (27)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5896046A (en) | 1997-01-27 | 1999-04-20 | International Business Machines Corporation | Latch structure for ripple domino logic |
| WO2000045962A2 (de) | 1998-09-11 | 2000-08-10 | Peter Baumgarten | Verfahren und vorrichtung zur sanierung von leitungsrohren |
| US20060152510A1 (en) | 2002-06-19 | 2006-07-13 | Jochen Dick | Cross-platform and data-specific visualisation of 3d data records |
| PL378812A1 (pl) | 2003-02-13 | 2006-05-29 | Pfizer Products Inc. | Zastosowania przeciwciał przeciw receptorowi insulinopodobnego czynnika wzrostowego I |
| JP5225069B2 (ja) | 2005-03-23 | 2013-07-03 | ゲンマブ エー/エス | 多発性骨髄腫の治療のためのcd38に対する抗体 |
| AU2011262758B8 (en) | 2010-06-11 | 2014-09-04 | Kyowa Kirin Co., Ltd. | Anti-tim-3 antibody |
| TWI452136B (zh) | 2010-11-17 | 2014-09-11 | 中外製藥股份有限公司 | A multiple specific antigen-binding molecule that replaces the function of Factor VIII in blood coagulation |
| WO2013006490A2 (en) | 2011-07-01 | 2013-01-10 | Cellerant Therapeutics, Inc. | Antibodies that specifically bind to tim3 |
| US8790651B2 (en) | 2011-07-21 | 2014-07-29 | Zoetis Llc | Interleukin-31 monoclonal antibody |
| HUE045065T2 (hu) * | 2014-01-31 | 2019-12-30 | Novartis Ag | TIM-3 antitest molekulák és felhasználásaik |
| KR20170068504A (ko) | 2014-10-08 | 2017-06-19 | 노파르티스 아게 | 키메라 항원 수용체 요법에 대한 치료 반응성을 예측하는 바이오마커 및 그의 용도 |
| GB201419094D0 (en) | 2014-10-27 | 2014-12-10 | Agency Science Tech & Res | Anti-TIM-3-antibodies |
| KR20170075778A (ko) | 2014-10-27 | 2017-07-03 | 에이전시 포 사이언스, 테크놀로지 앤드 리서치 | 항-tim-3 항체 |
| ES2808153T3 (es) | 2014-10-31 | 2021-02-25 | Mereo Biopharma 5 Inc | Terapia de combinación para tratamiento de enfermedad |
| JP6668345B2 (ja) | 2014-11-21 | 2020-03-18 | ブリストル−マイヤーズ スクイブ カンパニーBristol−Myers Squibb Company | 修飾された重鎖定常領域を含む抗体 |
| WO2017055404A1 (en) | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Bispecific antibodies specific for pd1 and tim3 |
| PE20181326A1 (es) | 2015-11-03 | 2018-08-20 | Janssen Biotech Inc | Anticuerpos que se unen especificamente a pd-1 y sus usos |
| EP3464360B1 (en) | 2016-05-27 | 2025-11-12 | Agenus Inc. | Anti-tim-3 antibodies and methods of use thereof |
| CN109757103B (zh) | 2016-07-14 | 2024-01-02 | 百时美施贵宝公司 | 针对tim3的抗体及其用途 |
| JOP20190133A1 (ar) | 2016-12-08 | 2019-06-02 | Innovent Biologics Suzhou Co Ltd | أجسام مضادة لـ Tim-3 لمزجها بأجسام مضادة لـ PD-1 |
| UA129904C2 (uk) | 2017-04-05 | 2025-09-10 | Ле Лаборатуар Сервьє | Комбінація антитіла до tim-3 й антитіла до pd-1 для лікування раку |
| JOP20190222A1 (ar) | 2017-04-11 | 2019-09-24 | Zymeworks Inc | الأجسام المضادة ثنائية النوعية المضادة لـ pd-l1 والمضادة لـ tim-3 |
| BR112020003362A2 (pt) | 2017-08-28 | 2020-08-18 | Bristol-Myers Squibb Company | antagonistas de tim-3 para o tratamento e diagnóstico de cânceres |
| CN111655288A (zh) | 2017-11-16 | 2020-09-11 | 诺华股份有限公司 | 组合疗法 |
| EP3737700A1 (en) | 2018-01-12 | 2020-11-18 | Bristol-Myers Squibb Company | Antibodies against tim3 and uses thereof |
| EP3740506A1 (en) | 2018-01-16 | 2020-11-25 | Bristol-Myers Squibb Company | Methods of treating cancer with antibodies against tim3 |
| US12590171B2 (en) * | 2019-09-27 | 2026-03-31 | Nanjing GenScript Biotech Co., Ltd. | Anti-VHH domain antibodies and use thereof |
-
2019
- 2019-01-11 EP EP19702762.6A patent/EP3737700A1/en active Pending
- 2019-01-11 WO PCT/US2019/013246 patent/WO2019140229A1/en not_active Ceased
- 2019-01-11 CN CN201980018622.8A patent/CN111886255B/zh active Active
- 2019-01-11 US US16/961,545 patent/US12129297B2/en active Active
- 2019-01-11 KR KR1020257017108A patent/KR20250078626A/ko active Pending
- 2019-01-11 KR KR1020207022936A patent/KR102813913B1/ko active Active
- 2019-01-11 JP JP2020538616A patent/JP7358361B2/ja active Active
- 2019-01-11 CN CN202510367409.5A patent/CN120192415A/zh active Pending
-
2023
- 2023-09-27 JP JP2023165245A patent/JP7762186B2/ja active Active
-
2024
- 2024-09-20 US US18/891,677 patent/US20250115664A1/en active Pending
-
2025
- 2025-10-17 JP JP2025175516A patent/JP2026035570A/ja active Pending
Patent Citations (202)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5179017A (en) | 1980-02-25 | 1993-01-12 | The Trustees Of Columbia University In The City Of New York | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US4634665A (en) | 1980-02-25 | 1987-01-06 | The Trustees Of Columbia University In The City Of New York | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US4399216A (en) | 1980-02-25 | 1983-08-16 | The Trustees Of Columbia University | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US4475196A (en) | 1981-03-06 | 1984-10-02 | Zor Clair G | Instrument for locating faults in aircraft passenger reading light and attendant call control system |
| US4447233A (en) | 1981-04-10 | 1984-05-08 | Parker-Hannifin Corporation | Medication infusion pump |
| US4439196A (en) | 1982-03-18 | 1984-03-27 | Merck & Co., Inc. | Osmotic drug delivery system |
| US4522811A (en) | 1982-07-08 | 1985-06-11 | Syntex (U.S.A.) Inc. | Serial injection of muramyldipeptides and liposomes enhances the anti-infective activity of muramyldipeptides |
| US4447224A (en) | 1982-09-20 | 1984-05-08 | Infusaid Corporation | Variable flow implantable infusion apparatus |
| US4487603A (en) | 1982-11-26 | 1984-12-11 | Cordis Corporation | Implantable microinfusion pump system |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US4486194A (en) | 1983-06-08 | 1984-12-04 | James Ferrara | Therapeutic device for administering medicaments through the skin |
| EP0154316A2 (en) | 1984-03-06 | 1985-09-11 | Takeda Chemical Industries, Ltd. | Chemically modified lymphokine and production thereof |
| US4596556A (en) | 1985-03-25 | 1986-06-24 | Bioject, Inc. | Hypodermic injection apparatus |
| US5399331A (en) | 1985-06-26 | 1995-03-21 | The Liposome Company, Inc. | Method for protein-liposome coupling |
| WO1987004462A1 (en) | 1986-01-23 | 1987-07-30 | Celltech Limited | Recombinant dna sequences, vectors containing them and method for the use thereof |
| US4683195A (en) | 1986-01-30 | 1987-07-28 | Cetus Corporation | Process for amplifying, detecting, and/or-cloning nucleic acid sequences |
| US4683195B1 (enExample) | 1986-01-30 | 1990-11-27 | Cetus Corp | |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| US5374548A (en) | 1986-05-02 | 1994-12-20 | Genentech, Inc. | Methods and compositions for the attachment of proteins to liposomes using a glycophospholipid anchor |
| US5455030A (en) | 1986-09-02 | 1995-10-03 | Enzon Labs, Inc. | Immunotheraphy using single chain polypeptide binding molecules |
| US4881175A (en) | 1986-09-02 | 1989-11-14 | Genex Corporation | Computer based system and method for determining and displaying possible chemical structures for converting double- or multiple-chain polypeptides to single-chain polypeptides |
| US5260203A (en) | 1986-09-02 | 1993-11-09 | Enzon, Inc. | Single polypeptide chain binding molecules |
| US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
| US5648260A (en) | 1987-03-18 | 1997-07-15 | Scotgen Biopharmaceuticals Incorporated | DNA encoding antibodies with altered effector functions |
| US5013653A (en) | 1987-03-20 | 1991-05-07 | Creative Biomolecules, Inc. | Product and process for introduction of a hinge region into a fusion protein to facilitate cleavage |
| US5258498A (en) | 1987-05-21 | 1993-11-02 | Creative Biomolecules, Inc. | Polypeptide linkers for production of biosynthetic proteins |
| US5132405A (en) | 1987-05-21 | 1992-07-21 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
| US5091513A (en) | 1987-05-21 | 1992-02-25 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
| US5482858A (en) | 1987-05-21 | 1996-01-09 | Creative Biomolecules, Inc. | Polypeptide linkers for production of biosynthetic proteins |
| US5476786A (en) | 1987-05-21 | 1995-12-19 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
| US4790824A (en) | 1987-06-19 | 1988-12-13 | Bioject, Inc. | Non-invasive hypodermic injection device |
| US4941880A (en) | 1987-06-19 | 1990-07-17 | Bioject, Inc. | Pre-filled ampule and non-invasive hypodermic injection device assembly |
| WO1989001036A1 (en) | 1987-07-23 | 1989-02-09 | Celltech Limited | Recombinant dna expression vectors |
| US5677425A (en) | 1987-09-04 | 1997-10-14 | Celltech Therapeutics Limited | Recombinant antibody |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| EP0338841A1 (en) | 1988-04-18 | 1989-10-25 | Celltech Limited | Recombinant DNA methods, vectors and host cells |
| US5698767A (en) | 1988-06-14 | 1997-12-16 | Lidak Pharmaceuticals | Human immune system in non-human animal |
| US5476996A (en) | 1988-06-14 | 1995-12-19 | Lidak Pharmaceuticals | Human immune system in non-human animal |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5403484A (en) | 1988-09-02 | 1995-04-04 | Protein Engineering Corporation | Viruses expressing chimeric binding proteins |
| US5571698A (en) | 1988-09-02 | 1996-11-05 | Protein Engineering Corporation | Directed evolution of novel binding proteins |
| US5545807A (en) | 1988-10-12 | 1996-08-13 | The Babraham Institute | Production of antibodies from transgenic animals |
| EP0401384A1 (en) | 1988-12-22 | 1990-12-12 | Kirin-Amgen, Inc. | Chemically modified granulocyte colony stimulating factor |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5585089A (en) | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5693762A (en) | 1988-12-28 | 1997-12-02 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US6180370B1 (en) | 1988-12-28 | 2001-01-30 | Protein Design Labs, Inc. | Humanized immunoglobulins and methods of making the same |
| US5416016A (en) | 1989-04-03 | 1995-05-16 | Purdue Research Foundation | Method for enhancing transmembrane transport of exogenous molecules |
| US5312335A (en) | 1989-11-09 | 1994-05-17 | Bioject Inc. | Needleless hypodermic injection device |
| US5064413A (en) | 1989-11-09 | 1991-11-12 | Bioject, Inc. | Needleless hypodermic injection device |
| US5939598A (en) | 1990-01-12 | 1999-08-17 | Abgenix, Inc. | Method of making transgenic mice lacking endogenous heavy chains |
| US6075181A (en) | 1990-01-12 | 2000-06-13 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US6162963A (en) | 1990-01-12 | 2000-12-19 | Abgenix, Inc. | Generation of Xenogenetic antibodies |
| US6150584A (en) | 1990-01-12 | 2000-11-21 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US6114598A (en) | 1990-01-12 | 2000-09-05 | Abgenix, Inc. | Generation of xenogeneic antibodies |
| US5580717A (en) | 1990-05-01 | 1996-12-03 | Affymax Technologies N.V. | Recombinant library screening methods |
| US5427908A (en) | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
| US5969108A (en) | 1990-07-10 | 1999-10-19 | Medical Research Council | Methods for producing members of specific binding pairs |
| US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| WO1992003918A1 (en) | 1990-08-29 | 1992-03-19 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5877397A (en) | 1990-08-29 | 1999-03-02 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5874299A (en) | 1990-08-29 | 1999-02-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5814318A (en) | 1990-08-29 | 1998-09-29 | Genpharm International Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5770429A (en) | 1990-08-29 | 1998-06-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5789650A (en) | 1990-08-29 | 1998-08-04 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US6172197B1 (en) | 1991-07-10 | 2001-01-09 | Medical Research Council | Methods for producing members of specific binding pairs |
| US6582915B1 (en) | 1991-12-02 | 2003-06-24 | Medical Research Council | Production of anti-self bodies from antibody segment repertories and displayed on phage |
| US5885793A (en) | 1991-12-02 | 1999-03-23 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US6593081B1 (en) | 1991-12-02 | 2003-07-15 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US6544731B1 (en) | 1991-12-02 | 2003-04-08 | Medical Research Council | Production of anti-self antibodies from antibody segment repertories and displayed on phage |
| US6555313B1 (en) | 1991-12-02 | 2003-04-29 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US6521404B1 (en) | 1991-12-02 | 2003-02-18 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| WO1993012227A1 (en) | 1991-12-17 | 1993-06-24 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5714350A (en) | 1992-03-09 | 1998-02-03 | Protein Design Labs, Inc. | Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region |
| US6350861B1 (en) | 1992-03-09 | 2002-02-26 | Protein Design Labs, Inc. | Antibodies with increased binding affinity |
| US6165745A (en) | 1992-04-24 | 2000-12-26 | Board Of Regents, The University Of Texas System | Recombinant production of immunoglobulin-like domains in prokaryotic cells |
| US5383851A (en) | 1992-07-24 | 1995-01-24 | Bioject Inc. | Needleless hypodermic injection device |
| US5399163A (en) | 1992-07-24 | 1995-03-21 | Bioject Inc. | Needleless hypodermic injection methods and device |
| WO1994025585A1 (en) | 1993-04-26 | 1994-11-10 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| WO1994029351A2 (en) | 1993-06-16 | 1994-12-22 | Celltech Limited | Antibodies |
| WO1995017886A1 (en) | 1993-12-27 | 1995-07-06 | Baxter International Inc. | Water soluble non-immunogenic polyamide cross-linking agents |
| WO1996032478A1 (en) | 1995-04-14 | 1996-10-17 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US6121022A (en) | 1995-04-14 | 2000-09-19 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US5837243A (en) | 1995-06-07 | 1998-11-17 | Medarex, Inc. | Therapeutic compounds comprised of anti-Fc receptor antibodies |
| US5811097A (en) | 1995-07-25 | 1998-09-22 | The Regents Of The University Of California | Blockade of T lymphocyte down-regulation associated with CTLA-4 signaling |
| WO1997013852A1 (en) | 1995-10-10 | 1997-04-17 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| WO1997034631A1 (en) | 1996-03-18 | 1997-09-25 | Board Of Regents, The University Of Texas System | Immunoglobin-like domains with increased half lives |
| US5922845A (en) | 1996-07-11 | 1999-07-13 | Medarex, Inc. | Therapeutic multispecific compounds comprised of anti-Fcα receptor antibodies |
| WO1998024884A1 (en) | 1996-12-02 | 1998-06-11 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies |
| US6277375B1 (en) | 1997-03-03 | 2001-08-21 | Board Of Regents, The University Of Texas System | Immunoglobulin-like domains with increased half-lives |
| WO1998042752A1 (en) | 1997-03-21 | 1998-10-01 | Brigham And Women's Hospital Inc. | Immunotherapeutic ctla-4 binding peptides |
| US6207156B1 (en) | 1997-03-21 | 2001-03-27 | Brigham And Women's Hospital, Inc. | Specific antibodies and antibody fragments |
| US20030153043A1 (en) | 1997-05-21 | 2003-08-14 | Biovation Limited | Method for the production of non-immunogenic proteins |
| WO1999045962A1 (en) | 1998-03-13 | 1999-09-16 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
| WO1999054342A1 (en) | 1998-04-20 | 1999-10-28 | Pablo Umana | Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity |
| WO2000037504A2 (en) | 1998-12-23 | 2000-06-29 | Pfizer Inc. | Human monoclonal antibodies to ctla-4 |
| US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| WO2000042072A2 (en) | 1999-01-15 | 2000-07-20 | Genentech, Inc. | Polypeptide variants with altered effector function |
| EP1176195A1 (en) | 1999-04-09 | 2002-01-30 | Kyowa Hakko Kogyo Co., Ltd. | Method for controlling the activity of immunologically functional molecule |
| US6437095B1 (en) | 1999-08-02 | 2002-08-20 | Hoffmann-La Roche Inc. | Method for producing chimeric polypeptides |
| US7635757B2 (en) | 1999-08-23 | 2009-12-22 | Dana-Farber Cancer Institute, Inc. | B7-4 Antibodies and uses therefor |
| WO2001014424A2 (en) | 1999-08-24 | 2001-03-01 | Medarex, Inc. | Human ctla-4 antibodies and their uses |
| US20090317368A1 (en) | 1999-11-30 | 2009-12-24 | Lieping Chen | B7-h1, a novel immunoregulatory molecule |
| WO2001058957A2 (en) | 2000-02-11 | 2001-08-16 | Lexigen Pharmaceuticals Corp. | Enhancing the circulating half-life of antibody-based fusion proteins |
| WO2002006919A2 (en) | 2000-07-18 | 2002-01-24 | Aegis Analytical Corporation | System, method and computer program product for mapping data of multi-database origins |
| WO2002043478A2 (en) | 2000-11-30 | 2002-06-06 | Medarex, Inc. | Transgenic transchromosomal rodents for making human antibodies |
| WO2002092780A2 (en) | 2001-05-17 | 2002-11-21 | Diversa Corporation | Novel antigen binding molecules for therapeutic, diagnostic, prophylactic, enzymatic, industrial, and agricultural applications, and methods for generating and screening thereof |
| WO2002096910A1 (en) | 2001-05-31 | 2002-12-05 | Medarex, Inc. | Cytotoxins, prodrugs, linkers and stabilizers useful therefor |
| US6989452B2 (en) | 2001-05-31 | 2006-01-24 | Medarex, Inc. | Disulfide prodrugs and linkers and stabilizers useful therefor |
| US7129261B2 (en) | 2001-05-31 | 2006-10-31 | Medarex, Inc. | Cytotoxic agents |
| US7087600B2 (en) | 2001-05-31 | 2006-08-08 | Medarex, Inc. | Peptidyl prodrugs and linkers and stabilizers useful therefor |
| WO2003035835A2 (en) | 2001-10-25 | 2003-05-01 | Genentech, Inc. | Glycoprotein compositions |
| US7317091B2 (en) | 2002-03-01 | 2008-01-08 | Xencor, Inc. | Optimized Fc variants |
| WO2003074679A2 (en) | 2002-03-01 | 2003-09-12 | Xencor | Antibody optimization |
| US20040014194A1 (en) | 2002-03-27 | 2004-01-22 | Schering Corporation | Beta-secretase crystals and methods for preparing and using the same |
| WO2003099196A2 (en) | 2002-05-23 | 2003-12-04 | Cure Tech Ltd. | Humanized immunomodulatory monoclonal antibodies for the treatment of neoplastic disease or immunodeficiency |
| WO2004016750A2 (en) | 2002-08-14 | 2004-02-26 | Macrogenics, Inc. | FcϜRIIB-SPECIFIC ANTIBODIES AND METHODS OF USE THEREOF |
| WO2004029207A2 (en) | 2002-09-27 | 2004-04-08 | Xencor Inc. | Optimized fc variants and methods for their generation |
| WO2004035752A2 (en) | 2002-10-15 | 2004-04-29 | Protein Design Labs, Inc. | ALTERATION OF FcRn BINDING AFFINITIES OR SERUM HALF-LIVES OF ANTIBODIES BY MUTAGENESIS |
| WO2004063351A2 (en) | 2003-01-09 | 2004-07-29 | Macrogenics, Inc. | IDENTIFICATION AND ENGINEERING OF ANTIBODIES WITH VARIANT Fc REGIONS AND METHODS OF USING SAME |
| WO2004074455A2 (en) | 2003-02-20 | 2004-09-02 | Applied Molecular Evolution | Fc REGION VARIANTS |
| WO2004099249A2 (en) | 2003-05-02 | 2004-11-18 | Xencor, Inc. | Optimized fc variants and methods for their generation |
| WO2005040217A2 (en) | 2003-10-17 | 2005-05-06 | Cambridge University Technical Services Limited | Antibodies having a mutated amino acid residue at position 268 (ch2 region) in constant regions |
| WO2005044853A2 (en) | 2003-11-01 | 2005-05-19 | Genentech, Inc. | Anti-vegf antibodies |
| WO2005070963A1 (en) | 2004-01-12 | 2005-08-04 | Applied Molecular Evolution, Inc | Fc region variants |
| WO2005092925A2 (en) | 2004-03-24 | 2005-10-06 | Xencor, Inc. | Immunoglobulin variants outside the fc region |
| US20060004081A1 (en) | 2004-05-19 | 2006-01-05 | Medarex, Inc. | Cytotoxic compounds and conjugates |
| US20060024317A1 (en) | 2004-05-19 | 2006-02-02 | Medarex, Inc | Chemical linkers and conjugates thereof |
| WO2006020114A2 (en) | 2004-08-04 | 2006-02-23 | Applied Molecular Evolution, Inc. | Variant fc regions |
| WO2006029879A2 (en) | 2004-09-17 | 2006-03-23 | F.Hoffmann-La Roche Ag | Anti-ox40l antibodies |
| US8101720B2 (en) | 2004-10-21 | 2012-01-24 | Xencor, Inc. | Immunoglobulin insertions, deletions and substitutions |
| US20090145493A1 (en) | 2004-11-23 | 2009-06-11 | Pip Co., Ltd. | Built-in wall water service box |
| WO2006105021A2 (en) | 2005-03-25 | 2006-10-05 | Tolerrx, Inc. | Gitr binding molecules and uses therefor |
| US20060247295A1 (en) | 2005-04-08 | 2006-11-02 | Medarex, Inc. | Cytotoxic compounds and conjugates with cleavable substrates |
| WO2006121168A1 (en) | 2005-05-09 | 2006-11-16 | Ono Pharmaceutical Co., Ltd. | Human monoclonal antibodies to programmed death 1(pd-1) and methods for treating cancer using anti-pd-1 antibodies alone or in combination with other immunotherapeutics |
| WO2006122150A1 (en) | 2005-05-10 | 2006-11-16 | Incyte Corporation | Modulators of indoleamine 2,3-dioxygenase and methods of using the same |
| WO2007005874A2 (en) | 2005-07-01 | 2007-01-11 | Medarex, Inc. | Human monoclonal antibodies to programmed death ligand 1 (pd-l1) |
| US7943743B2 (en) | 2005-07-01 | 2011-05-17 | Medarex, Inc. | Human monoclonal antibodies to programmed death ligand 1 (PD-L1) |
| WO2007038658A2 (en) | 2005-09-26 | 2007-04-05 | Medarex, Inc. | Antibody-drug conjugates and methods of use |
| WO2007051081A1 (en) | 2005-10-26 | 2007-05-03 | Medarex, Inc. | Methods and compounds for preparing cc-1065 analogs |
| WO2007059404A2 (en) | 2005-11-10 | 2007-05-24 | Medarex, Inc. | Duocarmycin derivatives as novel cytotoxic compounds and conjugates |
| WO2007075598A2 (en) | 2005-12-20 | 2007-07-05 | Incyte Corporation | N-hydroxyamidinoheterocycles as modulators of indoleamine 2,3-dioxygenase |
| WO2008036642A2 (en) | 2006-09-19 | 2008-03-27 | Incyte Corporation | N-hydroxyamidinoheterocycles as modulators of indoleamine 2,3-dioxygenase |
| WO2008036653A2 (en) | 2006-09-19 | 2008-03-27 | Incyte Corporation | N-hydroxyamidinoheterocycles as modulators of indoleamine 2,3-dioxygenase |
| WO2008083312A2 (en) | 2006-12-28 | 2008-07-10 | Medarex, Inc. | Chemical linkers and cleavable substrates and conjugates thereof |
| WO2008103693A2 (en) | 2007-02-21 | 2008-08-28 | Medarex, Inc. | Chemical linkers with single amino acids and conjugates thereof |
| WO2008132601A1 (en) | 2007-04-30 | 2008-11-06 | Immutep | Cytotoxic anti-lag-3 monoclonal antibody and its use in the treatment or prevention of organ transplant rejection and autoimmune disease |
| JP2008278814A (ja) | 2007-05-11 | 2008-11-20 | Igaku Seibutsugaku Kenkyusho:Kk | アゴニスティック抗ヒトgitr抗体による免疫制御の解除とその応用 |
| WO2009014708A2 (en) | 2007-07-23 | 2009-01-29 | Cell Genesys, Inc. | Pd-1 antibodies in combination with a cytokine-secreting cell and methods of use thereof |
| WO2009015777A1 (de) | 2007-08-02 | 2009-02-05 | Knorr-Bremse Systeme für Nutzfahrzeuge GmbH | Induktiver weg- oder drehwinkelsensor mit zwischen zwei spulen angeordnetem abschirmblech |
| WO2009044273A2 (en) | 2007-10-05 | 2009-04-09 | Immutep | Use of recombinant lag-3 or the derivatives thereof for eliciting monocyte immune response |
| WO2009059278A1 (en) | 2007-11-02 | 2009-05-07 | Centocor, Inc. | Semi-synthetic glp-1 peptide-fc fusion constructs, methods and uses |
| WO2009073620A2 (en) | 2007-11-30 | 2009-06-11 | Newlink Genetics | Ido inhibitors |
| WO2009115652A2 (fr) | 2008-01-03 | 2009-09-24 | Universite De La Mediterannee, Aix-Marseille Ii | Composition et procedes utilisables lors d'un traitement anti-vih |
| WO2009114335A2 (en) | 2008-03-12 | 2009-09-17 | Merck & Co., Inc. | Pd-1 binding proteins |
| US20100069614A1 (en) | 2008-06-27 | 2010-03-18 | Merus B.V. | Antibody producing non-human mammals |
| WO2010019570A2 (en) | 2008-08-11 | 2010-02-18 | Medarex, Inc. | Human antibodies that bind lymphocyte activation gene-3 (lag-3), and uses thereof |
| US20110150892A1 (en) | 2008-08-11 | 2011-06-23 | Medarex, Inc. | Human antibodies that bind lymphocyte activation gene-3 (lag-3) and uses thereof |
| US8217149B2 (en) | 2008-12-09 | 2012-07-10 | Genentech, Inc. | Anti-PD-L1 antibodies, compositions and articles of manufacture |
| US20110007023A1 (en) | 2009-07-09 | 2011-01-13 | Sony Ericsson Mobile Communications Ab | Display device, touch screen device comprising the display device, mobile device and method for sensing a force on a display device |
| WO2011028683A1 (en) | 2009-09-03 | 2011-03-10 | Schering Corporation | Anti-gitr antibodies |
| WO2011056652A1 (en) | 2009-10-28 | 2011-05-12 | Newlink Genetics | Imidazole derivatives as ido inhibitors |
| WO2011066389A1 (en) | 2009-11-24 | 2011-06-03 | Medimmmune, Limited | Targeted binding agents against b7-h1 |
| WO2011070024A1 (en) | 2009-12-10 | 2011-06-16 | F. Hoffmann-La Roche Ag | Antibodies binding preferentially human csf1r extracellular domain 4 and their use |
| WO2011072204A1 (en) | 2009-12-10 | 2011-06-16 | Regeneron Pharmaceuticals, Inc. | Mice that make heavy chain antibodies |
| WO2011097603A1 (en) | 2010-02-08 | 2011-08-11 | Regeneron Pharmaceuticals, Inc. | Common light chain mouse |
| WO2011109400A2 (en) | 2010-03-04 | 2011-09-09 | Macrogenics,Inc. | Antibodies reactive with b7-h3, immunologically active fragments thereof and uses thereof |
| WO2011107553A1 (en) | 2010-03-05 | 2011-09-09 | F. Hoffmann-La Roche Ag | Antibodies against human csf-1r and uses thereof |
| WO2011131407A1 (en) | 2010-03-05 | 2011-10-27 | F. Hoffmann-La Roche Ag | Antibodies against human csf-1r and uses thereof |
| WO2011140249A2 (en) | 2010-05-04 | 2011-11-10 | Five Prime Therapeutics, Inc. | Antibodies that bind csf1r |
| US20120073004A1 (en) | 2010-06-22 | 2012-03-22 | Regeneron Pharmaceuticals, Inc. | Hybrid Light Chain Mice |
| US20120070861A1 (en) | 2010-06-22 | 2012-03-22 | Regeneron Pharmaceuticals, Inc. | Human Lambda Light Chain Mice |
| WO2011163314A1 (en) | 2010-06-22 | 2011-12-29 | Regeneron Pharmaceuticals, Inc. | Hybrid light chain mice |
| WO2011163311A1 (en) | 2010-06-22 | 2011-12-29 | Regeneron Pharmaceuticals, Inc. | Mice expressing alight chain with human lambda variable and mouse constant regions |
| WO2011161699A2 (en) | 2010-06-25 | 2011-12-29 | Aurigene Discovery Technologies Limited | Immunosuppression modulating compounds |
| WO2012032433A1 (en) | 2010-09-09 | 2012-03-15 | Pfizer Inc. | 4-1bb binding molecules |
| WO2012142237A1 (en) | 2011-04-15 | 2012-10-18 | Newlink Geneticks Corporation | Fused imidazole derivatives useful as ido inhibitors |
| WO2012145493A1 (en) | 2011-04-20 | 2012-10-26 | Amplimmune, Inc. | Antibodies and other molecules that bind b7-h1 and pd-1 |
| WO2012148873A2 (en) | 2011-04-25 | 2012-11-01 | Regeneron Pharmaceuticals, Inc. | Non-human animals expressing antibodies having a common light chain |
| WO2013079174A1 (en) | 2011-11-28 | 2013-06-06 | Merck Patent Gmbh | Anti-pd-l1 antibodies and uses thereof |
| WO2013087699A1 (en) | 2011-12-15 | 2013-06-20 | F. Hoffmann-La Roche Ag | Antibodies against human csf-1r and uses thereof |
| WO2013119716A1 (en) | 2012-02-06 | 2013-08-15 | Genentech, Inc. | Compositions and methods for using csf1r inhibitors |
| WO2013132044A1 (en) | 2012-03-08 | 2013-09-12 | F. Hoffmann-La Roche Ag | Combination therapy of antibodies against human csf-1r and uses thereof |
| WO2013169264A1 (en) | 2012-05-11 | 2013-11-14 | Five Prime Therapeutics, Inc. | Methods of treating conditions with antibodies that bind colony stimulating factor 1 receptor (csf1r) |
| WO2013173223A1 (en) | 2012-05-15 | 2013-11-21 | Bristol-Myers Squibb Company | Cancer immunotherapy by disrupting pd-1/pd-l1 signaling |
| WO2014008218A1 (en) | 2012-07-02 | 2014-01-09 | Bristol-Myers Squibb Company | Optimization of antibodies that bind lymphocyte activation gene-3 (lag-3), and uses thereof |
| WO2014036357A1 (en) | 2012-08-31 | 2014-03-06 | Five Prime Therapeutics, Inc. | Methods of treating conditions with antibodies that bind colony stimulating factor 1 receptor (csf1r) |
| WO2015018735A2 (de) | 2013-08-05 | 2015-02-12 | Tridonic Gmbh & Co Kg | Dimmbare led-leuchtmittelstrecke |
| WO2015031667A2 (en) | 2013-08-30 | 2015-03-05 | Amgen Inc. | Gitr antigen binding proteins |
| WO2015184099A1 (en) | 2014-05-28 | 2015-12-03 | 4-Antibody Ag | Anti-gitr antibodies and methods of use thereof |
| WO2015187835A2 (en) | 2014-06-06 | 2015-12-10 | Bristol-Myers Squibb Company | Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof |
| WO2016054638A1 (en) | 2014-10-03 | 2016-04-07 | Dana-Farber Cancer Institute, Inc. | Glucocorticoid-induced tumor necrosis factor receptor (gitr) antibodies and methods of use thereof |
| WO2016057846A1 (en) | 2014-10-08 | 2016-04-14 | Novartis Ag | Compositions and methods of use for augmented immune response and cancer therapy |
| WO2016057841A1 (en) | 2014-10-08 | 2016-04-14 | Novartis Ag | Compositions and methods of use for augmented immune response and cancer therapy |
| WO2016071448A1 (en) * | 2014-11-06 | 2016-05-12 | F. Hoffmann-La Roche Ag | Anti-tim3 antibodies and methods of use |
| WO2017178493A1 (en) * | 2016-04-12 | 2017-10-19 | Symphogen A/S | Anti-tim-3 antibodies and compositions |
Non-Patent Citations (181)
| Title |
|---|
| "Cancer: Principles and Practice of Oncology", 1997 |
| "Concise Dictionary of Biomedicine and Molecular Biology", 2002, CRC PRESS |
| "Current Protocols in Molecular Biology", 1987, GREENE PUBLISHING AND WILEY INTERSCIENCE |
| "DNA Cloning", vol. I;II, 1985 |
| "Epitope Mapping Protocols in Methods in Molecular Biology", vol. 66, 1996 |
| "Fundamental immunology", 1999, LIPPINCOTT-RAVEN |
| "Gene Transfer Vectors For Mammalian Cells", 1987, COLD SPRING HARBOR LABORATORY |
| "Handbook Of Experimental Immunology", vol. I-IV, 1986 |
| "Immobilized Cells And Enzymes", 1986, IRL PRESS |
| "Immunochemical Methods In Cell And Molecular Biology", 1987, ACADEMIC PRESS |
| "Manipulating the Mouse Embryo", 1986, COLD SPRING HARBOR LABORATORY PRESS, COLD SPRING HARBOR |
| "Methods In Enzymology", ACADEMIC PRESS, INC. |
| "Methods In Enzymology", vol. 154;155 |
| "Molecular Cloning A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS |
| "Molecular Cloning: A Laboratory Manual", 1992, COLD SPRINGS HARBOR LABORATORY |
| "Nucleic Acid Hybridization", 1984 |
| "Oligonucleotide Synthesis", 1984 |
| "Oxford Dictionary Of Biochemistry And Molecular Biology, Revised", 2000, OXFORD UNIVERSITY PRESS |
| "Sustained and Controlled Release Drug Delivery Systems", 1978, MARCEL DEKKER, INC. |
| "The Dictionary of Cell and Molecular Biology", 1999, ACADEMIC PRESS |
| "Transcription And Translation", 1984 |
| "Using Antibodies", 1999, COLD SPRING HARBOR LABORATORY PRESS, COLD SPRING HARBOR |
| ALEXANDER A J; HUGHES D E, ANAL CHEM, vol. 67, 1995, pages 3626 - 32 |
| ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 10 |
| ALTSCHUL ET AL., NUCLEIC ACIDS RES., vol. 25, no. 17, 1997, pages 3389 - 3402 |
| ANDERSON AC, CANCER IMMUNOL RES., vol. 2, 2014, pages 393 - 8 |
| AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 1989, JOHN WILEY AND SONS |
| BERGE, S.M. ET AL., J. PHARM. SCI., vol. 66, 1977, pages 1 - 19 |
| BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426 |
| BLUNDELL; JOHNSON ET AL.: "Meth. Enzymol.", 1985, ACADEMIC PRESS, pages: 114,115 |
| BORDUSA, F., HIGHLIGHTS IN BIOORGANIC CHEMISTRY, 2004, pages 389 - 403 |
| BOSS, M. A.; WOOD, C. R., IMMUNOLOGY TODAY, vol. 6, 1985, pages 12 - 13 |
| BRENNAN ET AL., SCIENCE, vol. 229, 1985, pages 81 - 83 |
| BRICOGNE, ACTA CRYST., vol. D49, 1993, pages 37 - 60 |
| BRICOGNE, METH. ENZYMOL., vol. 276A, 1997, pages 361 - 423 |
| BRISCOE ET AL., AM. J. PHYSIOL., vol. 1233, 1995, pages 134 |
| BRUMMELL ET AL., BIOCHEM., vol. 32, 1993, pages 1180 - 1187 |
| BURKS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 94, 1997, pages 412 - 417 |
| CAMACHO ET AL., J. CLIN. ONCOLOGY, vol. 22, 2004, pages 145 |
| CHAYEN, STRUCTURE, vol. 5, 1997, pages 1269 - 1274 |
| CHEN ET AL., PHARM RES, vol. 20, 2003, pages 1952 - 60 |
| CHEN, J. ET AL., EMBO J., vol. 12, 1993, pages 821 - 830 |
| CHEN, J. ET AL., INTERNATIONAL IMMUNOLOGY, vol. 5, 1993, pages 647 - 656 |
| CHEUNG ET AL., VIROLOGY, vol. 176, 1990, pages 546 |
| CHOI ET AL., NATURE GENETICS, vol. 4, 1993, pages 117 - 123 |
| COX, J. P. L. ET AL.: "A Directory of Human Germ-line V Segments Reveals a Strong Bias in their Usage", EUR. J. IMMUNOL., vol. 24, 1994, pages 827 - 836, XP003004702, DOI: doi:10.1002/eji.1830240409 |
| CROOKS: "Antisense drug Technology: Principles, strategies and applications", 2007, CRC PRESS |
| CUNNINGHAM; WELLS, SCIENCE, vol. 244, 1989, pages 1081 - 1085 |
| DALL ACQUA ET AL., JOURNAL OF IMMUNOLOGY, vol. 169, 2002, pages 5171 - 5180 |
| DALL'ACQUA ET AL., JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 281, 2006, pages 23514 - 23524 |
| DE GRAAF, A. J. ET AL., BIOCONJUG. CHEM., vol. 20, 2009, pages 1281 - 1295 |
| DEKRUYFF ET AL., J. IMMUNOLOGY, 2010 |
| DRANOFF ET AL., PROC. NATL. ACAD. SCI U.S.A., vol. 90, 1993, pages 3539 - 43 |
| E. MEYERS; W. MILLER, CABIOS, vol. 4, 1989, pages 11 - 17 |
| FISHWILD ET AL., NATURE BIOTECHNOLOGY, vol. 14, 1996, pages 845 - 851 |
| FISHWILD, D. ET AL., NATURE BIOTECHNOLOGY, vol. 14, 1996, pages 845 - 851 |
| FOON, K., ASCO EDUCATIONAL BOOK SPRING, 2000, pages 730 - 738 |
| FOURCADE J ET AL., J EXP MED., vol. 207, 2010, pages 2175 - 2186 |
| FREEMEN ET AL., IMMUNOL REV., vol. 235, 2010, pages 172 |
| FRESE, M. A.; DIERKS, T., CHEMBIOCHEM., vol. 10, 2009, pages 425 - 427 |
| FRESHNEY: "Culture Of Animal Cells", 1987, ALAN R. LISS, INC. |
| FULDA ET AL., NAT MED, vol. 8, 2002, pages 808 - 15 |
| GALA; MORRISON, J. IMMUNOL, vol. 172, 2004, pages 5489 - 94 |
| GAUTIER, A. ET AL., CHEM. BIOL., vol. 15, 2008, pages 128 - 136 |
| GHIRLANDO ET AL., IMMUNOL LETT, vol. 68, 1999, pages 47 - 52 |
| GIEGE ET AL., ACTA CRYSTALLOGR., vol. D50, 1994, pages 339 - 350 |
| GLENNIE ET AL., J. IMMUNOL., vol. 139, 1987, pages 2367 - 2375 |
| GOEDDEL: "Methods in Enzymology 185", 1990, ACADEMIC PRESS, article "Gene Expression Technology" |
| GREENBERG; RIDDELL, SCIENCE, vol. 285, 1999, pages 546 - 51 |
| HACKENBERGER, C. P. R.; SCHWARZER, D., ANGEW. CHEM. INT. ED. ENGL., vol. 47, 2008, pages 10030 - 10074 |
| HAHNE ET AL., SCIENCE, vol. 274, 1996, pages 1363 - 1365 |
| HAMBLEY; GROSS, J. AMERICAN SOC. MASS SPECTROMETRY, vol. 16, 2005, pages 2057 |
| HAN G ET AL., FRONT LMMUNOL., vol. 4, 2013, pages 449 |
| HARDING, F.; LONBERG, N., ANN. N.Y. ACAD. SCI., vol. 764, 1995, pages 536 - 546 |
| HARLOW; LANE; ANTIBODIES: "A Laboratory Manual", 1988, COLD SPRING HARBOR PRESS |
| HE ET AL., J. IMMUNOL., vol. 173, 2004, pages 4919 - 28 |
| HE YAYI ET AL: "TIM-3, a promising target for cancer immunotherapy", ONCOTARGETS AND THERAPY, DOVE MEDICAL PRESS LTD, GB, vol. 11, 1 January 2018 (2018-01-01), pages 7005 - 7009, XP002789761, ISSN: 1178-6930 * |
| HINTON ET AL., J. BIOL. CHEM., vol. 279, no. 8, 2004, pages 6213 - 6216 |
| HINTON ET AL., JOURNAL OF IMMUNOLOGY, vol. 176, 2006, pages 346 - 356 |
| HOLLIGER, PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 6448 |
| HOWARD; O'GARRA, IMMUNOLOGY TODAY, vol. 13, 1992, pages 198 - 200 |
| HURWITZ ET AL., PRO. NATL. ACAD. SCI. USA, vol. 95, no. 17, 1998, pages 10067 - 10071 |
| HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883 |
| HUTLOFF ET AL., NATURE, vol. 397, 1999, pages 262 - 266 |
| HYER ET AL., CANCER RESEARCH, vol. 65, 2005, pages 4799 - 808 |
| J.J. KILLION; I.J. FIDLER, IMMUNOMETHODS, vol. 4, 1994, pages 273 |
| JEFFERIES ET AL., MABS, vol. 1, 2009, pages 1 |
| JEFFERIS ET AL., MABS, vol. 1, 2009, pages 1 |
| JESPERS ET AL., BIOTECHNOLOGY, vol. 12, 1994, pages 899 |
| JONES, P. ET AL., NATURE, vol. 321, 1986, pages 522 - 525 |
| K. KEINANEN; M.L. LAUKKANEN, FEBSLETT., vol. 346, 1994, pages 123 |
| KABAT, E. A. ET AL.: "Sequences of Proteins of Immunological Interest", 1991, U.S. DEPARTMENT OF HEALTH AND HUMAN SERVICES, NIH |
| KARPOVSKY ET AL., J. EXP. MED., vol. 160, 1984, pages 1686 |
| KEHRL ET AL., J. EXP. MED., vol. 163, 1986, pages 1037 - 1050 |
| KHAYAT, D.: "ASCO Educational Book Spring", 2000, pages: 414 - 428 |
| KIM ET AL., SCIENCE, vol. 266, 1994, pages 2011 - 2013 |
| KIRKLAND ET AL., J. IMMUNOL., vol. 137, 1986, pages 3614 |
| KOBAYASHI ET AL., PROTEIN ENG., vol. 12, no. 10, 1999, pages 879 - 884 |
| KOHLER; MILSTEIN, NATURE, vol. 256, 1975, pages 495 |
| KOSTELNY, J. IMMUNOL., vol. 148, 1992, pages 1547 - 1553 |
| KRISHNAMURTHY R; MANNING M C, CURR PHARM BIOTECHNOL, vol. 3, 2002, pages 361 - 71 |
| KUGLER ET AL., NATURE MEDICINE, vol. 6, 2000, pages 332 - 336 |
| KUROIWA ET AL., NATURE BIOTECHNOLOGY, vol. 20, 2002, pages 889 - 894 |
| LIU, MA ET AL., PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 8648 |
| LOGOTHETIS, C: "ASCO Educational Book Spring", 2000, pages: 300 - 302 |
| LONBERG ET AL., NATURE, vol. 368, no. 6474, 1994, pages 856 - 859 |
| LONBERG, N.: "Handbook of Experimental Pharmacology", vol. 113, 1994, pages: 49 - 101 |
| LONBERG, N.; HUSZAR, D., INTERN. REV. IMMUNOL., vol. 13, 1995, pages 65 - 93 |
| LONBERG, NATURE BIOTECH., vol. 23, no. 9, 2005, pages 1117 - 1125 |
| M. OWAIS ET AL., ANTIMICROB. AGENTS CHEMOTHER., vol. 39, 1995, pages 180 |
| MARSHALL ET AL., ANNU REV BIOCHEM, vol. 41, 1972, pages 673 - 702 |
| MCCAFFERTY ET AL., NATURE, vol. 348, 1990, pages 552 - 554 |
| MCPHERSON, EUR. J. BIOCHEM., vol. 189, 1990, pages 1 - 23 |
| MCPHERSON, J. BIOL. CHEM., vol. 251, 1976, pages 6300 - 6303 |
| MELERO ET AL., NATURE MEDICINE, vol. 3, 1997, pages 682 - 685 |
| MIMURA ET AL., MOL IMMUNOL, vol. 37, 2000, pages 697 - 706 |
| MOKYR ET AL., CANCER RES., vol. 58, 1998, pages 5301 - 5304 |
| MOKYR ET AL., CANCER RESEARCH, vol. 58, 1998, pages 5301 - 5304 |
| MOLDENHAUER ET AL., SCAND. J. IMMUNOL., vol. 32, 1990, pages 77 |
| MOLEC. IMMUNOL., vol. 29, no. 5, 1992, pages 633 - 9 |
| MOREL ET AL., MOL. IMMUNOL., vol. 25, no. 1, 1988, pages 7 |
| MORRISON, S., SCIENCE, vol. 229, 1985, pages 1202 |
| MURRAY ET AL., J. CHROMATOGR SCI, vol. 40, 2002, pages 343 - 9 |
| NAKAYAMA M ET AL., BLOOD, vol. 113, 2009, pages 3821 - 30 |
| NEEDLEMAN; WUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 444 - 453 |
| NESTLE ET AL., NATURE MEDICINE, vol. 4, 1998, pages 328 - 332 |
| NGIOW ET AL., CANCER RES., vol. 71, 2011, pages 3540 |
| OVERWIJK ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 96, 1999, pages 2982 - 2987 |
| P.G. BLOEMAN ET AL., FEBSLETT., vol. 357, 1995, pages 140 |
| PAREKH ET AL., NATURE, vol. 316, 1985, pages 452 - 7 |
| PAULUS, BEHRING INS. MITT., vol. 78, 1985, pages 118 - 132 |
| PERBAL, A PRACTICAL GUIDE TO MOLECULAR CLONING, 1984 |
| POLJAK, STRUCTURE, vol. 2, 1994, pages 1121 - 1123 |
| QUEEN, C. ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 86, 1989, pages 10029 - 10033 |
| R. J. KAUFMAN; P. A. SHARP, MOL. BIOL., vol. 759, 1982, pages 601 - 621 |
| REN, H. ET AL., ANGEW. CHEM. INT. ED. ENGL., vol. 48, 2009, pages 9658 - 9662 |
| RESTIFO, N.; SZNOL, M., CANCER VACCINES, vol. 61, pages 3023 - 3043 |
| RIDGE ET AL., NATURE, vol. 393, 1998, pages 474 - 478 |
| RIECHMANN, L. ET AL., NATURE, vol. 332, 1998, pages 323 - 327 |
| RIEDL S ET AL., BIOCHIM BIOPHYSACTA, vol. 1808, 2011, pages 2638 - 2645 |
| ROSEMARIE ET AL., JIMMUNOL, vol. 184, 2010, pages 1918 |
| ROSENBERG, S A, IMMUNITY, vol. 10, 1999, pages 281 - 7 |
| ROSENBERG, S.: "ASCO Educational Book Spring", 2000, ASCO EDUCATIONAL BOOK SPRING, article "Development of Cancer Vaccines", pages: 60 - 62 |
| ROSENBERG; WHITE, J. IMMUNOTHER EMPHASIS TUMOR IMMUNOL, vol. 19, no. 1, 1996, pages 81 - 4 |
| ROVERSI ET AL.: "Acta Cryst.", vol. D56, 2000, pages: 1313 - 1323 |
| SCHENK ET AL., NATURE, vol. 400, 1999, pages 173 - 177 |
| SCHREIER ET AL., J. BIOL. CHEM., vol. 269, 1994, pages 9090 |
| SCOPES: "Protein Purification: Principles and Practice", 1994, SPRINGER-VERLAG |
| SENTER, P. D., CURR. OPIN. CHEM. BIOL., vol. 13, 2009, pages 235 - 244 |
| SHIELDS ET AL., JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 276, no. 9, 2001, pages 6591 - 6604 |
| SHIELDS, R.L. ET AL., J. BIOL. CHEM., vol. 276, 2001, pages 6591 - 6604 |
| SHIELDS, R.L. ET AL., J. BIOL. CHEM., vol. 277, 2002, pages 26733 - 26740 |
| SONGSIVILAI; LACHMANN, CLIN. EXP. IMMUNOL., vol. 79, 1990, pages 315 - 321 |
| SPIRO, GLYCOBIOLOGY, vol. 12, 2002, pages 43R - 56R |
| STAHLI ET AL., METHODS IN ENZYMOLOGY, vol. 9, 1983, pages 242 |
| STROHL, CURRENT OPINION IN BIOTECHNOLOGY, vol. 20, 2009, pages 685 - 691 |
| SUNBUL, M.; YIN, J., ORG. BIOMOL. CHEM., vol. 7, 2009, pages 3361 - 3371 |
| SUOT; SRIVASTAVA, SCIENCE, vol. 269, 1995, pages 1585 - 1588 |
| TAKEBE, Y. ET AL., MOL. CELL. BIOL., vol. 8, 1988, pages 466 - 472 |
| TAKI, M. ET AL., PROT. ENG. DES. SEL., vol. 17, 2004, pages 119 - 126 |
| TAMURA ET AL., SCIENCE, vol. 278, 1997, pages 117 - 120 |
| TANSEY, DRUG DISCOVERY TODAY, vol. 00, 2009, pages 1 |
| TAYLOR, E. VOGEL; IMPERIALI, B: "Nucleic Acids and Molecular Biology", vol. 22, 2009, PROTEIN ENGINEERING, pages: 65 - 96 |
| TAYLOR, L. ET AL., INTERNATIONAL IMMUNOLOGY, vol. 6, 1994, pages 579 - 591 |
| TAYLOR, L. ET AL., NUCLEIC ACIDS RESEARCH, vol. 20, 1992, pages 6287 - 6295 |
| TOMIZUKA ET AL., PROC. NATL. ACAD. SCI. USA, vol. 97, 2000, pages 722 - 727 |
| TOMLINSON, I. M. ET AL.: "The Repertoire of Human Germline V Sequences Reveals about Fifty Groups of V Segments with Different Hypervariable Loops", MOL. BIOL., vol. 227, 1992, pages 776 - 798, XP024020607, DOI: doi:10.1016/0022-2836(92)90223-7 |
| TUAILLON ET AL., IMMUNOL., vol. 152, 1994, pages 2912 - 2920 |
| TUAILLON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 3720 - 3724 |
| UMANA ET AL., NAT. BIOTECH., vol. 17, 1999, pages 176 - 180 |
| UMEZAWA ET AL., BIOCHEM. BIOPHYS. RES. COMMUN., vol. 153, 1988, pages 1038 |
| URLAUB; CHASIN, PROC. NATL. ACAD. SCI. USA, vol. 77, 1980, pages 4216 - 4220 |
| V.V. RANADE, J. CLIN. PHARMACOL., vol. 29, 1989, pages 685 |
| VAN ELSAS ET AL., J. EXP. MED., vol. 194, 2001, pages 481 - 489 |
| WALLICK ET AL., J EXP MED, vol. 168, 1988, pages 1099 - 109 |
| WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 546 |
| WEI ET AL., DRUG DISCOVERY TODAY, vol. 19, 2014, pages 95 |
| WEINBERG ET AL., IMMUNOL, vol. 164, 2000, pages 2160 - 2169 |
| YEUNG ET AL., JLMMUNOL, vol. 182, 2010, pages 7663 - 7671 |
| ZINN- JUSTIN ET AL., BIOCHEMISTRY, vol. 31, 1992, pages 11335 - 11347 |
| ZINN-JUSTIN ET AL., BIOCHEMISTRY, vol. 32, 1993, pages 6884 - 6891 |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2021169948A1 (zh) * | 2020-02-24 | 2021-09-02 | 苏州恒康生命科学有限公司 | Tim3结合分子及其应用 |
| CN113214396A (zh) * | 2020-07-31 | 2021-08-06 | 北京市神经外科研究所 | 抗tim3的单链抗体及其在制备治疗肿瘤的药物中的用途 |
| CN113214396B (zh) * | 2020-07-31 | 2022-04-19 | 北京市神经外科研究所 | 抗tim3的单链抗体及其在制备治疗肿瘤的药物中的用途 |
| EP4083065A1 (en) | 2021-01-28 | 2022-11-02 | NantBio, Inc. | Anti-tim3 monoclonal antibodies and chimeric antigen receptors |
| US11753467B2 (en) | 2021-01-28 | 2023-09-12 | Nantbio, Inc. | Anti-TIM3 monoclonal antibodies and chimeric antigen receptors |
| US12098201B2 (en) | 2021-01-28 | 2024-09-24 | Nantbio, Inc. | Anti-TIM3 monoclonal antibodies and chimeric antigen receptors |
Also Published As
| Publication number | Publication date |
|---|---|
| US20220089720A1 (en) | 2022-03-24 |
| KR20250078626A (ko) | 2025-06-02 |
| JP2024012285A (ja) | 2024-01-30 |
| JP7762186B2 (ja) | 2025-10-29 |
| JP2026035570A (ja) | 2026-03-04 |
| CN111886255B (zh) | 2025-04-04 |
| US20250115664A1 (en) | 2025-04-10 |
| KR102813913B1 (ko) | 2025-05-30 |
| JP7358361B2 (ja) | 2023-10-10 |
| KR20200108870A (ko) | 2020-09-21 |
| CN120192415A (zh) | 2025-06-24 |
| CN111886255A (zh) | 2020-11-03 |
| US12129297B2 (en) | 2024-10-29 |
| EP3737700A1 (en) | 2020-11-18 |
| JP2021511026A (ja) | 2021-05-06 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12312403B2 (en) | Antibodies against TIM3 and uses thereof | |
| EP3377532B1 (en) | Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof | |
| EP3610924B1 (en) | Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof | |
| US20250115664A1 (en) | Antibodies against tim3 and uses thereof | |
| EA044112B1 (ru) | Антитела к tim3 и их применение | |
| HK1235726B (en) | Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof | |
| HK1235726A1 (en) | Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 19702762 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2020538616 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 20207022936 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2019702762 Country of ref document: EP Effective date: 20200812 |
|
| WWG | Wipo information: grant in national office |
Ref document number: 201980018622.8 Country of ref document: CN |
|
| WWP | Wipo information: published in national office |
Ref document number: 1020257017108 Country of ref document: KR |