WO2019084057A2 - COMPOSITIONS AND METHODS FOR DEPLOYING CD117 + CELLS - Google Patents
COMPOSITIONS AND METHODS FOR DEPLOYING CD117 + CELLSInfo
- Publication number
- WO2019084057A2 WO2019084057A2 PCT/US2018/057172 US2018057172W WO2019084057A2 WO 2019084057 A2 WO2019084057 A2 WO 2019084057A2 US 2018057172 W US2018057172 W US 2018057172W WO 2019084057 A2 WO2019084057 A2 WO 2019084057A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- amino acid
- set forth
- acid sequence
- antibody
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- 0 CC(C)C(C(*([C@@](C)C(*(C)=C)=O)=C)=O)*(C(CC*(C(CC1N*)=O)C1=O)=O)=C Chemical compound CC(C)C(C(*([C@@](C)C(*(C)=C)=O)=C)=O)*(C(CC*(C(CC1N*)=O)C1=O)=O)=C 0.000 description 4
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2896—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/48—Reproductive organs
- A61K35/54—Ovaries; Ova; Ovules; Embryos; Foetal cells; Germ cells
- A61K35/545—Embryonic stem cells; Pluripotent stem cells; Induced pluripotent stem cells; Uncharacterised stem cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/6811—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
- A61K47/6817—Toxins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/6811—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
- A61K47/6817—Toxins
- A61K47/6831—Fungal toxins, e.g. alpha sarcine, mitogillin, zinniol or restrictocin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/64—Cyclic peptides containing only normal peptide links
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K2035/124—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells the cells being hematopoietic, bone marrow derived or blood cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/77—Internalization into the cell
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- the invention relates to anti-CD1 17 antibodies and antibody drug conjugates (ADCs) thereof, as well as the treatment of patients suffering from various pathologies, such as blood diseases, metabolic disorders, cancers, and autoimmune diseases, among others, by
- an antibody or ADC capable of binding CD1 17 expressed by a hematopoietic cell such as a hematopoietic stem cell.
- hematopoietic stem cells have significant therapeutic potential, a limitation that has hindered their use in the clinic has been the difficulty associated with ensuring engraftment of hematopoietic stem cell transplants in a host.
- compositions that target specific endogenous stem cells that can be used as conditioning agents to promote the engraftment of exogenous hematopoietic stem cell grafts such that the multi-potency and hematopoietic functionality of these cells is preserved in the patient following transplantation.
- CD1 17 (also referred to as c-kit or Stem Cell Factor Receptor (SCRF)) is a single transmembrane, receptor tyrosine kinase that binds the ligand Stem Cell Factor (SCF) . SCF induces homodimerization of cKIT which activates its tyrosine kinase activity and signals through both the PI3-AKT and MAPK pathways (Kindblom et al., Am J. Path. 1998 152(5):1259).
- SCF Stem Cell Factor Receptor
- CD1 17 was initially discovered as an oncogene and has been studied in the field of oncology (see, for example, Stankov et al. (2014) Curr Pharm Des. 20(17):2849-80).
- An antibody drug conjugate (KTN0158) directed to CD1 17 is currently under investigation for the treatment of refractory gastrointestinal stromal tumors (GIST) (e.g., "KTN0158, a humanized anti-KIT monoclonal antibody, demonstrates biologic activity against both normal and malignant canine mast cells" London et al. (2016) Clin Cancer Res DOI: 10.1 158/1078-0432.CCR-16-2152).
- GIST refractory gastrointestinal stromal tumors
- CD1 17 is highly expressed on hematopoietic stem cells (HSCs). This expression pattern makes CD1 17 a potential target for conditioning across a broad range of diseases. There remains, however, a need for anti-CD1 17 based therapy that is effective for conditioning a patient for transplantation, such as a bone marrow transplantation.
- HSCs hematopoietic stem cells
- Described herein are antibodies, and antigen binding portions thereof, that specifically bind human CD1 17 (also known as c-kit), as well as compositions and methods of using said antibodies.
- the antibodies and fragments described herein can be used in anti-CD1 17 antibody drug conjugates (ADCs).
- an anti-CD1 17 antibody, or antigen-binding portion thereof comprises a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 10, and a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 9.
- an anti-CD1 17 antibody or antigen-binding portion thereof, comprises a light chain variable region comprising a CDR1 domain as set forth in SEQ ID NO: 14, a CDR2 domain as set forth in SEQ ID NO: 15, and a CDR3 domain as set forth in SEQ ID NO: 16, and comprises a heavy chain variable region comprising a CDR1 domain as set forth in SEQ ID NO: 1 1 , a CDR2 domain as set forth in SEQ ID NO: 12, and a CDR3 domain as set forth in SEQ ID NO: 13.
- an anti-CD1 17 antibody, or antigen-binding portion thereof comprises a heavy chain variable region comprising a CDR1 domain comprising the amino acid sequence as set forth in SEQ ID NO: 31 , a CDR2 domain comprising the amino acid sequence as set forth in SEQ ID NO:32, and a CDR3 domain comprising the amino acid sequence as set forth in SEQ ID NO: 33; and comprising a light chain variable region comprising a CDR1 domain comprising the amino acid sequence as set forth in SEQ ID NO: 34, a CDR2 domain comprising the amino acid sequence as set forth in SEQ ID NO:35, and a CDR3 domain comprising the amino acid sequence as set forth in SEQ ID NO: 36.
- an anti-CD1 17 antibody, or antigen-binding portion thereof comprises a heavy chain variable region comprising a CDR1 domain comprising the amino acid sequence as set forth in SEQ ID NO: 21 , a CDR2 domain comprising the amino acid sequence as set forth in SEQ ID NO:22, and a CDR3 domain comprising the amino acid sequence as set forth in SEQ ID NO: 23; and comprising a light chain variable region comprising a CDR1 domain comprising the amino acid sequence as set forth in SEQ ID NO: 24, a CDR2 domain comprising the amino acid sequence as set forth in SEQ ID NO:25, and a CDR3 domain comprising the amino acid sequence as set forth in SEQ ID NO: 26.
- an anti-CD1 17 antibody comprises a heavy chain variable region comprising a CDR1 domain comprising the amino acid sequence as set forth in SEQ ID NO: 41 , a CDR2 domain comprising the amino acid sequence as set forth in SEQ ID NO:42, and a CDR3 domain comprising the amino acid sequence as set forth in SEQ ID NO: 43; and comprising a light chain variable region comprising a CDR1 domain comprising the amino acid sequence as set forth in SEQ ID NO: 44, a CDR2 domain comprising the amino acid sequence as set forth in SEQ ID NO:45, and a CDR3 domain comprising the amino acid sequence as set forth in SEQ ID NO: 46.
- an anti-CD1 17 antibody, or antigen-binding portion thereof comprises a heavy chain variable region comprising a CDR1 domain comprising the amino acid sequence as set forth in SEQ ID NO: 51 , a CDR2 domain comprising the amino acid sequence as set forth in SEQ ID NO:52, and a CDR3 domain comprising the amino acid sequence as set forth in SEQ ID NO: 53; and comprising a light chain variable region comprising a CDR1 domain comprising the amino acid sequence as set forth in SEQ ID NO: 54, a CDR2 domain comprising the amino acid sequence as set forth in SEQ ID NO:55, and a CDR3 domain comprising the amino acid sequence as set forth in SEQ ID NO: 56.
- an anti-CD1 17 antibody comprises a heavy chain variable region comprising a CDR1 domain comprising the amino acid sequence as set forth in SEQ ID NO: 61 , a CDR2 domain comprising the amino acid sequence as set forth in SEQ ID NO:62, and a CDR3 domain comprising the amino acid sequence as set forth in SEQ ID NO: 63; and comprising a light chain variable region comprising a CDR1 domain comprising the amino acid sequence as set forth in SEQ ID NO: 64, a CDR2 domain comprising the amino acid sequence as set forth in SEQ ID NO:65, and a CDR3 domain comprising the amino acid sequence as set forth in SEQ ID NO: 66.
- an anti-CD1 17 antibody, or antigen-binding portion thereof comprises a heavy chain variable region comprising a CDR1 domain comprising the amino acid sequence as set forth in SEQ ID NO: 71 , a CDR2 domain comprising the amino acid sequence as set forth in SEQ ID NO:72, and a CDR3 domain comprising the amino acid sequence as set forth in SEQ ID NO: 73; and comprising a light chain variable region comprising a CDR1 domain comprising the amino acid sequence as set forth in SEQ ID NO: 74, a CDR2 domain comprising the amino acid sequence as set forth in SEQ ID NO:75, and a CDR3 domain comprising the amino acid sequence as set forth in SEQ ID NO: 76.
- an anti-CD1 17 antibody, or antigen-binding portion thereof comprises a heavy chain variable region comprising a CDR1 domain comprising the amino acid sequence as set forth in SEQ ID NO: 81 , a CDR2 domain comprising the amino acid sequence as set forth in SEQ ID NO:82, and a CDR3 domain comprising the amino acid sequence as set forth in SEQ ID NO: 83; and comprising a light chain variable region comprising a CDR1 domain comprising the amino acid sequence as set forth in SEQ ID NO: 84, a CDR2 domain comprising the amino acid sequence as set forth in SEQ ID NO:85, and a CDR3 domain comprising the amino acid sequence as set forth in SEQ ID NO: 86.
- an anti-CD1 17 antibody comprises a heavy chain variable region comprising a CDR1 domain comprising the amino acid sequence as set forth in SEQ ID NO: 1 1 , a CDR2 domain comprising the amino acid sequence as set forth in SEQ ID NO:12, and a CDR3 domain comprising the amino acid sequence as set forth in SEQ ID NO: 13; and comprising a light chain variable region comprising a CDR1 domain comprising the amino acid sequence as set forth in SEQ ID NO: 14, a CDR2 domain comprising the amino acid sequence as set forth in SEQ ID NO:15, and a CDR3 domain comprising the amino acid sequence as set forth in SEQ ID NO: 16.
- an anti-CD1 17 antibody comprises a heavy chain variable region comprising a CDR1 domain comprising the amino acid sequence as set forth in SEQ ID NO: 91 , a CDR2 domain comprising the amino acid sequence as set forth in SEQ ID NO:92, and a CDR3 domain comprising the amino acid sequence as set forth in SEQ ID NO: 93; and comprising a light chain variable region comprising a CDR1 domain comprising the amino acid sequence as set forth in SEQ ID NO: 94, a CDR2 domain comprising the amino acid sequence as set forth in SEQ ID NO:95, and a CDR3 domain comprising the amino acid sequence as set forth in SEQ ID NO: 96.
- an anti-CD1 17 antibody comprises a heavy chain variable region comprising a CDR1 domain comprising the amino acid sequence as set forth in SEQ ID NO: 101 , a CDR2 domain comprising the amino acid sequence as set forth in SEQ ID NO:102, and a CDR3 domain comprising the amino acid sequence as set forth in SEQ ID NO: 103; and comprising a light chain variable region comprising a CDR1 domain comprising the amino acid sequence as set forth in SEQ ID NO: 104, a CDR2 domain comprising the amino acid sequence as set forth in SEQ ID NO:105, and a CDR3 domain comprising the amino acid sequence as set forth in SEQ ID NO: 106.
- an anti-CD1 17 antibody comprises a heavy chain variable region comprising a CDR1 domain comprising the amino acid sequence as set forth in SEQ ID NO: 127, a CDR2 domain comprising the amino acid sequence as set forth in SEQ ID NO:128, and a CDR3 domain comprising the amino acid sequence as set forth in SEQ ID NO: 129; and comprising a light chain variable region comprising a CDR1 domain comprising the amino acid sequence as set forth in SEQ ID NO: 130, a CDR2 domain comprising the amino acid sequence as set forth in SEQ ID NO:131 , and a CDR3 domain comprising the amino acid sequence as set forth in SEQ ID NO: 132.
- an anti-CD1 17 antibody, or antigen-binding portion thereof comprises a heavy chain variable region comprising a CDR1 domain comprising the amino acid sequence as set forth in SEQ ID NO: 133, a CDR2 domain comprising the amino acid sequence as set forth in SEQ ID NO:134, and a CDR3 domain comprising the amino acid sequence as set forth in SEQ ID NO: 135; and comprising a light chain variable region comprising a CDR1 domain comprising the amino acid sequence as set forth in SEQ ID NO: 136, a CDR2 domain comprising the amino acid sequence as set forth in SEQ ID NO:137, and a CDR3 domain comprising the amino acid sequence as set forth in SEQ ID NO: 138.
- an anti-CD1 17 antibody comprises a heavy chain variable region comprising a CDR1 domain comprising the amino acid sequence as set forth in SEQ ID NO: 139, a CDR2 domain comprising the amino acid sequence as set forth in SEQ ID NO:140, and a CDR3 domain comprising the amino acid sequence as set forth in SEQ ID NO: 141 ; and comprising a light chain variable region comprising a CDR1 domain comprising the amino acid sequence as set forth in SEQ ID NO: 142, a CDR2 domain comprising the amino acid sequence as set forth in SEQ ID NO:143, and a CDR3 domain comprising the amino acid sequence as set forth in SEQ ID NO: 144.
- an anti-CD1 17 antibody, or antigen-binding portion thereof comprises a heavy chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 29, and a light chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 30.
- an anti-CD1 17 antibody, or antigen-binding portion thereof comprises a heavy chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 19, and a light chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 20.
- an anti-CD1 17 antibody, or antigen-binding portion thereof comprises a heavy chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 39, and a light chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 40.
- an anti-CD1 17 antibody, or antigen-binding portion thereof comprises a heavy chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 49, and a light chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 50.
- an anti-CD1 17 antibody, or antigen-binding portion thereof comprises a heavy chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 59, and a light chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 60.
- an anti-CD1 17 antibody, or antigen-binding portion thereof comprises a heavy chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 69, and a light chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 70.
- an anti-CD1 17 antibody, or antigen-binding portion thereof comprises a heavy chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 79, and a light chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 80.
- an anti-CD1 17 antibody, or antigen-binding portion thereof comprises a heavy chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 9, and a light chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 10.
- an anti-CD1 17 antibody, or antigen-binding portion thereof comprises a heavy chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 89, and a light chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 90.
- an anti-CD1 17 antibody, or antigen-binding portion thereof comprises a heavy chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 99, and a light chain variable region comprising the amino acid sequence as set forth in SEQ ID NO: 100.
- an anti-CD1 17 antibody or antigen-binding fragment thereof comprises an Fc region comprising amino acid substitution D265C (numbering according to EU index).
- an anti-CD1 17 antibody or antigen-binding fragment thereof comprises an Fc region comprising amino acid substitutions D265C, L234A, and L2345A
- an anti-CD1 17 antibody or antigen-binding fragment thereof comprises an Fc region comprising amino acid substitutions D265C and H435A (numbering according to EU index). In some embodiments, the anti-CD1 17 antibody or antigen-binding fragment thereof comprises an Fc region comprising amino acid substitutions D265C, L234A, L2345A, and H435A (numbering according to EU index).
- an anti-CD1 17 antibody or antigen-binding fragment thereof comprises a (i) light chain constant region comprising the amino acid sequence as set forth in SEQ ID NO: 121 , and (ii) a heavy chain constant region comprising the amino acid sequence as set forth in SEQ ID NO: 122.
- the anti-CD1 17 antibody or antigen-binding fragment thereof comprises (i) a light chain constant region comprising the amino acid sequence as set forth in SEQ ID NO: 121 , and (ii) a heavy chain constant region comprising the amino acid sequence as set forth in SEQ ID NO: 123.
- the anti-CD1 17 antibody or antigen-binding fragment thereof comprises (i) a light chain constant region comprising the amino acid sequence as set forth in SEQ ID NO: 121 , and (ii) a heavy chain constant region comprising the amino acid sequence as set forth in SEQ ID NO: 124.
- the anti-CD1 17 antibody or antigen-binding fragment thereof comprises (i) a light chain constant region comprising the amino acid sequence as set forth in SEQ ID NO: 121 , and (ii) a heavy chain constant region comprising the amino acid sequence as set forth in SEQ ID NO: 125.
- the anti-CD1 17 antibody or antigen-binding fragment thereof comprises (i) a light chain constant region comprising the amino acid sequence as set forth in SEQ ID NO: 121 , and (ii) a heavy chain constant region comprising the amino acid sequence as set forth in SEQ ID NO: 126.
- the anti-CD1 17 antibody or antigen-binding fragment thereof is internalized by a CD1 17+ cell.
- the anti-CD1 17 antibody or antigen-binding fragment thereof binds CD1 17 with a K d of about 0.1 pM to about 1 ⁇ as determined by BLI.
- the antibody or antigen binding fragment thereof binds CD1 17 with a K D of about 100 nM or less, about 90nM or less, about 80 nM or less, about 70 nM or less, about 60 nM or less, about 50 nM or less, about 40 nM or less, about 30 nM or less, about 20 nM or less, about 10 nM or less, about 8 nM or less, about 6 nM or less, about 4 nM or less, about 2 nM or less, about 1 nM or less as determined by a Bio-Layer Interferometry (BLI) assay.
- BLI Bio-Layer Interferometry
- the antibody or antigen-binding fragment thereof binds CD1 17 with a k 0F F of about 1 x 10 ⁇ 3 s "1 to about 1 x 10 6 s "1 as determined by BLI.
- the antibody or antigen-binding fragment thereof binds CD1 17 with a k 0FF of 1 x 10 "2 to 1 x 10 "3 , 1 x 10 3 to 1 x 10 "4 , 1 x 10 "5 to 1 x 10 "6 , 1 x 10 ⁇ 6 to 1 x 10 "7 or 1 x 10 ⁇ 7 to 1 x 10 ⁇ 8 as measured by bio-layer interferometry (BLI).
- the anti-CD1 17 antibody, or antigen-binding fragment thereof is human.
- the anti-CD1 17 antibody is an intact antibody.
- the anti-CD1 17 antibody, or antigen-binding fragment thereof is an IgG, e.g., an lgG1 or an lgG4.
- the anti-CD1 17 antibody, or antigen-binding fragment thereof is the antibody or antigen-binding fragment thereof is a monoclonal antibody.
- the anti-CD1 17 antibody, or antigen-binding fragment thereof comprises a heavy chain constant region having an amino acid sequence as set forth as SEQ ID NO: 122. and/or a light chain constant region comprising an amino acid sequence as set forth in SEQ ID NO: 121 .
- the anti-CD1 17 antibody, or antigen-binding fragment thereof comprises a light chain comprising an amino acid sequence as set forth in SEQ ID NO: 109, and a heavy chain comprising an amino acid sequence selected from the group consisting of SEQ ID NO 1 10, SEQ ID NO: 1 1 1 , SEQ ID NO: 1 12, SEQ ID NO: 1 13, and SEQ ID NO: 1 14.
- the antibodies, fragments, and ADCs described herein, including Antibody 54 (Ab54), Antibody 55 (Ab55), Antibody 56 (Ab56), Antibody 57 (Ab57), Antibody 58 (Ab58), Antibody 61 (Ab61 ), Antibody 66 (Ab66), Antibody 67 (Ab67), Antibody 68 (Ab68), or Antibody 69 (Ab69) may be used in compositions and methods for the treatment of various disorders of the hematopoietic system, metabolic disorders, cancers, and autoimmune diseases, among others.
- the invention additionally features methods for conditioning a patient, such as a human patient, prior to receiving hematopoietic stem cell transplant therapy so as to promote the engraftment of hematopoietic stem cell grafts.
- the patient may be one that is suffering from one or more blood disorders, such as a hemoglobinopathy or other hematopoietic pathology, and is thus in need of hematopoietic stem cell transplantation.
- hematopoietic stem cells are capable of differentiating into a multitude of cell types in the hematopoietic lineage, and can be administered to a patient in order to populate or re-populate a cell type that is deficient in the patient.
- the invention features methods of treating a patient with antibodies and ADCs capable of binding proteins expressed by hematopoietic cells, such as CD1 17 (including, for example, GNNK+ CD1 17), so as to (i) directly treat a disease such as a blood disorder, metabolic disease, cancer, or autoimmune disease, among others described herein, by selectively depleting a population of cells that express CD1 17, such as an aberrant blood cell, cancer cell, or autoimmune cell, and/or (ii) deplete a population of endogenous hematopoietic stem cells within the patient.
- a disease such as a blood disorder, metabolic disease, cancer, or autoimmune disease, among others described herein
- CD1 17 including, for example, GNNK+ CD1 17
- the former activity enables the direct treatment of a wide range of disorders associated with a cell of the hematopoietic lineage, as CD1 17 may be expressed by a cancerous cell, such as a leukemic cell, an autoimmune lymphocyte, such as a T-cell that expresses a T-cell receptor that cross-reacts with a self-antigen, among other cell types.
- a cancerous cell such as a leukemic cell
- an autoimmune lymphocyte such as a T-cell that expresses a T-cell receptor that cross-reacts with a self-antigen, among other cell types.
- the latter activity the selective depletion of hematopoietic stem cells, in turn creates a vacancy that can subsequently be filled by transplantation of an exogenous (for instance, an autologous, allogeneic, or syngeneic) hematopoietic stem cell graft.
- the invention thus provides methods of treating a variety of hematopoietic conditions, such as sickle cell anemia, thalassemia, Fanconi anemia, Wiskott- Aldrich syndrome, adenosine deaminase deficiency-severe combined immunodeficiency, metachromatic leukodystrophy, Diamond-Blackfan anemia and Schwachman-Diamond syndrome, human immunodeficiency virus infection, and acquired immune deficiency syndrome, as well as cancers and autoimmune diseases, among others.
- hematopoietic conditions such as sickle cell anemia, thalassemia, Fanconi anemia, Wiskott- Aldrich syndrome, adenosine deaminase deficiency-severe combined immunodeficiency, metachromatic leukodystrophy, Diamond-Blackfan anemia and Schwachman-Diamond syndrome, human immunodeficiency virus infection, and acquired immune deficiency syndrome, as well as cancers and autoimmune diseases, among
- the invention provides a method of depleting a population of CD1 17+ cells in a human patient by administering an effective amount of an antibody or antigen-binding fragment thereof capable of binding CD1 17, wherein the antibody or antigen-binding fragment is conjugated to a cytotoxin.
- the invention provides a method of depleting a population of CD1 17+ cells in a human patient in need of a hematopoietic stem cell transplant by administering, prior to the patient receiving a transplant including hematopoietic stem cells, an effective amount of an antibody or antigen-binding fragment thereof capable of binding CD1 17, wherein the antibody or antigen-binding fragment is conjugated to a cytotoxin.
- the invention features a method, for example, of treating a human patient in need of a hematopoietic stem cell transplant, including administering to a human patient a transplant including hematopoietic stem cells, wherein the patient has been previously administered an antibody or antigen-binding fragment thereof capable of binding CD1 17, wherein the antibody or antigen-binding fragment is conjugated to a cytotoxin and was administered in an amount sufficient to deplete a population of CD1 17+ cells in the patient.
- the invention features a method, for example, of treating a human patient in need of a hematopoietic stem cell transplant, including: administering to a human patient an antibody or antigen-binding fragment thereof capable of binding CD1 17, wherein the antibody or antigen-binding fragment is conjugated to a cytotoxin and administered in an amount sufficient to deplete a population of CD1 17+ cells in the patient, and subsequently administering to the patient a transplant including hematopoietic stem cells.
- the antibody or antigen-binding fragment thereof is conjugated to a cytotoxin.
- an anti-CD1 17 conjugate is represented by the formula Ab-Z-L-Am, wherein Ab is an antibody or antigen-binding fragment thereof that specifically binds to CD1 17, L is a linker, Z is a chemical moiety, and Am is an amatoxin, wherein the antibody, or antigen- binding fragment thereof, is a neutral antibody that internalizes when bound to a CD1 17 expressing cell, and has a human CD1 17 dissociation rate (K 0F F) of 1 X 10 ⁇ 3 to 1 X 10 "6 S "1 as determined by biolayer interferometry (BLI).
- K 0F F human CD1 17 dissociation rate
- the cytotoxin may be, for example, pseudomonas exotoxin A, deBouganin, diphtheria toxin, an amatoxin, such as a-amanitin, saporin, maytansine, a
- auristatin an anthracycline, a calicheamicin, irinotecan, SN-38, a duocarmycin, a pyrrolobenzodiazepine, a pyrrolobenzodiazepine dimer, an indolinobenzodiazepine, or an indolinobenzodiazepine dimer, or a variant thereof.
- the CD1 17 is GNNK+ CD1 17.
- the invention provides a method of depleting a population of CD1 17+ cells in a human patient in need of a hematopoietic stem cell transplant by administering, prior to the patient receiving a transplant including hematopoietic stem cells, an effective amount of an antibody or fragment thereof capable of binding CD1 17.
- the invention features a method, for example, of treating a human patient in need of a hematopoietic stem cell transplant, including administering to a human patient a transplant including hematopoietic stem cells, wherein the patient has been previously administered an antibody or fragment thereof capable of binding CD1 17 in an amount sufficient to deplete a population of CD1 17+ cells in the patient.
- the invention features a method, for example, of treating a human patient in need of a hematopoietic stem cell transplant, including: administering to a human patient an antibody or fragment thereof capable of binding CD1 17 in an amount sufficient to deplete a population of CD1 17+ cells in the patient, and subsequently administering to the patient a transplant including hematopoietic stem cells.
- the antibody or fragment thereof that binds CD1 17 is covalently bound to an Fc domain, such as a dimeric Fc domain isolated from a human antibody (for example, isolated from an lgG1 , lgG2, lgG3, or lgG4 isotype human antibody).
- the Fc domain is a monomeric Fc domain containing a single polypeptide strand.
- the N-terminus of the antibody or fragment thereof is bound to the Fc domain.
- the C-terminus of the antibody or fragment thereof is bound to the Fc domain.
- the Fc domain may be conjugated to one or more copies of the antibody or fragment thereof.
- conjugates that may be used with the methods described herein include dimeric Fc domains in which each polypeptide strand of the Fc domain is conjugated to the antibody or fragment thereof.
- the Fc domain may in turn be conjugated to a cytotoxin, such as a cytotoxin described herein (for example, pseudomonas exotoxin A, deBouganin, diphtheria toxin, an amatoxin, such as ⁇ -amanitin, saporin, maytansine, a maytansinoid, an auristatin, an anthracycline, a calicheamicin, irinotecan, SN-38, a duocarmycin, a pyrrolobenzodiazepine, a pyrrolobenzodiazepine dimer, an indolinobenzodiazepine, and an indolinobenzodiazepine dimer, or a variant thereof).
- a cytotoxin described herein for example, pseudomonas exotoxin A, deBouganin, diphtheria toxin, an amatoxin, such as ⁇ -amanitin, saporin, may
- the antibody or fragment thereof is covalently bound to a cytotoxin (forming an ADC), such as a cytotoxin described herein (for example, pseudomonas exotoxin A, deBouganin, diphtheria toxin, an amatoxin, such as a- amanitin, saporin, maytansine, a maytansinoid, an auristatin, an anthracycline, a calicheamicin, irinotecan, SN-38, a duocarmycin, a pyrrolobenzodiazepine, a pyrrolobenzodiazepine dimer, an indolinobenzodiazepine, and an indolinobenzodiazepine dimer, or a variant thereof).
- a cytotoxin described herein for example, pseudomonas exotoxin A, deBouganin, diphtheria toxin, an amatoxin, such as a- amanit
- the N-terminus of the antibody or fragment thereof is bound to the cytotoxin. In some embodiments, the C-terminus of the antibody or fragment thereof is bound to the cytotoxin.
- the cytotoxin may in turn be conjugated to an Fc domain of the anti-CD1 17 antibody.
- the antibody or fragment thereof is covalently bound to the cytotoxin at one site on the antibody or fragment thereof (for example, the N- or C-terminus of the antibody or fragment thereof) and is covalently bound to an Fc domain at another site on the antibody or fragment thereof (for example, the opposite terminus of the antibody or fragment thereof).
- the Fc domain is a human lgG1 isotype Fc domain. In some embodiments, the Fc domain is a human lgG2 isotype Fc domain. In some embodiments, the Fc domain is a human lgG3 isotype Fc domain. In some embodiments, the Fc domain is a human lgG4 isotype Fc domain.
- the cytotoxin is an amatoxin or derivative thereof, such as a-amanitin, ⁇ -amanitin, ⁇ -amanitin, ⁇ -amanitin, amanin, amaninamide, amanullin, amanullinic acid, and proamanullin.
- the cytotoxin is an amatoxin
- the antibody, or antigen-binding fragment thereof, conjugated to the cytotoxin is represented by the formula Ab-Z-L-Am, wherein Ab is the antibody, or antigen- binding fragment thereof, L is a linker, Z is a chemical moiety, and Am is the amatoxin.
- the amatoxin is conjugated to a linker.
- Am-L-Z is
- R is H, OH, OR A , or OR c ;
- R 2 is H, OH, OR B , or OR c ;
- R A and R B when present, together with the oxygen atoms to which they are bound, combine to form an optionally substituted 5-membered heterocycloalkyi group;
- R 4 s H, OH, ORc, OR D , Rc, or R D ;
- R 6 s H, OH, ORc, OR D , Rc, or R D ;
- R 7 s H, OH, ORc, OR D , Rc, or R D ;
- R 8 s OH, NH 2 , ORc, OR D , NHR C , or NR C R D ;
- X is -S-, -S(O)-, or -SO 2 -;
- Rc is -L-Z
- R D is optionally substituted alkyl (e.g., C C 6 alkyl), optionally substituted heteroalkyl (e.g., Ci-C 6 heteroalkyl), optionally substituted alkenyl (e.g., C 2 -C 6 alkenyl), optionally substituted heteroalkenyl (e.g., C 2 -C 6 heteroalkenyl), optionally substituted alkynyl (e.g., C 2 -C 6 alkynyl), optionally substituted heteroalkynyl (e.g., C 2 -C 6 heteroalkynyl), optionally substituted cycloalkyl, optionally substituted heterocycloalkyi, optionally substituted aryl, optionally substituted heteroaryl;
- alkyl e.g., C C 6 alkyl
- optionally substituted heteroalkyl e.g., Ci-C 6 heteroalkyl
- optionally substituted alkenyl e.g., C 2 -C
- Z is a chemical moiety formed from a coupling reaction between a reactive substituent present on L and a reactive substituent present within an antibody, or antigen-binding fragment thereof, that binds CD1 17 (such as GNNK+ CD1 17).
- Am contains exactly one R c substituent.
- linker L and the chemical moiety Z, taken together as L-Z is
- S is a a sulfur atom which represents the reactive substituent present within an antibody,or antigen-binding fragment thereof, that binds CD1 17 (e.g., from the -SH group of a cysteine residue).
- Am-L-Z-Ab is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl
- Am-L-Z-Ab is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl
- Am-L-Z-Ab is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl
- Am-L-Z is represented by formula (IA)
- R A and R B when present, together with the oxygen atoms to which they are bound, combine to form an optionally substituted 5-membered heterocycloalkyl group;
- R 3 is H, R c , or R D ;
- R 4 is H, OH, ORc, OR D , R c , or R D ;
- R 5 is H, OH, ORc, OR D , R c , or R D ;
- R 6 is H, OH, ORc, OR D , R c , or R D ;
- R 7 is H, OH, ORc, OR D , R c , or R D ;
- R 8 is OH, NH 2 , ORc, OR D , NHR C , or NR C R D ;
- R 9 is H, OH, ORc, or OR D ;
- X is -S-, -S(O)-, or -S0 2 -;
- Rc is -L-Z
- R D is optionally substituted alkyl (e.g., C C 6 alkyl), optionally substituted heteroalkyl (e.g.,
- C C 6 heteroalkyl optionally substituted alkenyl (e.g., C 2 -C 6 alkenyl), optionally substituted heteroalkenyl (e.g., C 2 -C 6 heteroalkenyl), optionally substituted alkynyl (e.g., C 2 -C 6 alkynyl), optionally substituted heteroalkynyl (e.g., C 2 -C 6 heteroalkynyl), optionally substituted cycloalkyi, optionally substituted heterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl;
- Am-L-Z is represented by formula (IB)
- R A and R B when present, together with the oxygen atoms to which they are bound, combine to form an optionally substituted 5-membered heterocycloalkyi group;
- R 3 is H, R c , or R D ;
- R 4 is H, OH, ORc, OR D , R c , or R D ;
- R 5 is H, OH, ORc, OR D , R c , or R D ;
- R 6 is H, OH, ORc, OR D , R c , or R D ;
- R 7 is H, OH, ORc, OR D , Rc, or R D ;
- R 8 is OH, NH 2 , ORc, OR D , NHR C , or NR C R D ;
- R 9 is H, OH, ORc, or OR D ;
- X is -S-, -S(O)-, or -SO 2 -;
- Rc is -L-Z
- R D is optionally substituted alkyl (e.g., C C 6 alkyl), optionally substituted heteroalkyl (e.g., C C 6 heteroalkyl), optionally substituted alkenyl (e.g., C 2 -C 6 alkenyl), optionally substituted heteroalkenyl (e.g., C 2 -C 6 heteroalkenyl), optionally substituted alkynyl (e.g., C 2 -C 6 alkynyl), optionally substituted heteroalkynyl (e.g., C 2 -C 6 heteroalkynyl), optionally substituted cycloalkyl, optionally substituted heterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl;
- alkyl e.g., C C 6 alkyl
- optionally substituted heteroalkyl e.g., C C 6 heteroalkyl
- optionally substituted alkenyl e.g., C 2 -C 6
- optionally substituted alkylene e.g., Ci-C 6 alkylene
- optionally substituted heteroalkylene
- Z is a chemical moiety formed from a coupling reaction between a reactive substituent present on L and a reactive substituent present within an antibody, or antigen-binding fragment thereof, that binds CD1 17 (such as GNNK+ CD1 17);
- R E ' are each independently optionally substituted Ci-C 6 alkylene-R c , optionally substituted Ci-C 6 heteroalkylene-R c , optionally substituted C 2 -C 6 alkenylene-R c , optionally substituted C 2 -C 6 heteroalkenylene-R c , optionally substituted C 2 -C 6 alkynylene-R c , optionally substituted C 2 -C 6 heteroalkynylene-R c , optionally substituted cycloalkylene-R c , optionally substituted heterocycloalkylene-R c , optionally substituted arylene-R c , or optionally substituted heteroarylene-Ro
- Am-L-Z is represented by formula (IA) or formula (IB), wherein H, OH, OR A , or OR c ;
- R 2 is H, OH, OR B , or OR c ;
- R A and R B when present, together with the oxygen atoms to which they are bound, combine to form:
- R 3 is H or R c ;
- R 4 is H, OH, ORc, OR D , R c , or R D ;
- R 5 is H, OH, ORc, OR D , R c , or R D ;
- R 6 is H, OH, ORc, OR D , R c , or R D ;
- R 7 is H, OH, ORc, OR D , R c , or R D ;
- R 8 is OH, NH 2 , ORc, or NHR C ;
- R 9 is H or OH
- R c and R D are each as defined above.
- Am is represented by formula (IA) or formula (IB),
- R 2 is H, OH, OR B , or OR c ;
- R A and R B when present, together with the oxygen atoms to which they are bound, combine to form:
- R 3 is H or R c ;
- R 4 and R 5 are each independently H, OH, OR c , Rc, or OR D ;
- R 6 and R 7 are each H
- R 8 is OH, NH 2 , ORc, or NHR C ;
- R 9 is H or OH
- R c is as defined above.
- Am-L-Z is represented by formula (IA) or formula (IB), wherein R is H, OH, or OR A ;
- R 2 is H, OH, or OR B ;
- R A and R B when present, together with the oxygen atoms to which they are bound, combine to form: R 3 , R 4 , R 6 , and R 7 are each H;
- R 5 is 0R C ;
- R 8 is OH or NH 2 ;
- R 9 is H or OH
- R c is as defined above.
- Am-L-Z is represented by formula (IA) or formula (IB), wherein and R 2 are each independently H or OH;
- R 3 is R c ;
- R 4 , R 6 , and R 7 are each H;
- R 5 is H, OH, or OC C 6 alkyl
- R 8 is OH or NH 2 ;
- R 9 is H or OH
- R c is as defined above.
- Am-L-Z is represented by formula (IA) or formula (IB), wherein R and R 2 are each independently H or OH;
- R 3 , R 6 , and R 7 are each H;
- R 4 and R 5 are each independently H, OH, OR c , or R c ;
- R 8 is OH or NH 2 ;
- R 9 is H or OH
- R c is as defined above.
- Am-L-Z is represented by formula (IA) or formula (IB), wherein R and R 2 are each independently H or OH;
- R 3 , R 6 , and R 7 are each H;
- R 4 and R 5 are each independently H or OH
- R 8 is OH, NH 2 , ORc, or NHR C ;
- R c is as defined above.
- linker L and the chemical moiety Z, taken together as L-Z is
- Am-L-Z is represented by formula (II), formula (HA), or formula MB)
- X is S, SO, or S0 2 ;
- Ri is H or a linker covalently bound to the antibody or antigen-binding fragment thereof through a chemical moeity Z, formed from a coupling reaction between a reactive substituent present on the linker and a reactive substituent present within an antibody, or antigen- binding fragment thereof;
- R 2 is H or a linker covalently bound to the antibody or antigen- binding fragment thereof through a chemical moeity Z, formed from a coupling reaction between a reactive substituent present on the linker and a reactive substituent present within an antibody, or antigen-binding fragment thereof; wherein when is H, R 2 is the linker, and when R 2 is H, is the linker.
- X is SO
- Ri is the linker
- R 2 is H.
- Ri is the linker and R 2 is H, and the linker and chemical moiety, together as L-Z, is
- Am-L-Z-Ab is:
- the conjugate is represented by formula (IV). In some embodiments, the conjugate is represented by formula (IVA). In some embodiments, the conjugate is represented by formula (IVB).
- maleimide reacts with a thiol group found on a cysteine in the antibody.
- maleimide reacts with a thiol group found on a cysteine in the antibody.
- the cytotoxin is a maytansinoid selected from the group consisting of DM1 and DM4.
- the cytotoxin is an auristatin selected from the group consisting of monomethyl auristatin E and monomethyl auristatin F.
- the cytotoxin is an anthracycline selected from the group consisting of daunorubicin, doxorubicin, epirubicin, and idarubicin.
- the invention features a method of depleting a population of CD1 17+ cells in a human patient by administering an effective amount of an antibody, or antigen-binding fragment thereof, or ADC capable of binding GNNK+ CD1 1 7.
- the invention features a method of depleting a population of CD1 1 7+ cells in a human patient in need of a hematopoietic stem cell transplant by administering, prior to the patient receiving a transplant containing hematopoietic stem cells, an effective amount of an antibody, or antigen-binding fragment thereof, or ADC capable of binding GNNK+ CD1 17.
- the invention features a method, for example, of treating a human patient in need of a hematopoietic stem cell transplant, including administering to a human patient a transplant containing hematopoietic stem cells, wherein the patient has been previously administered an antibody, or antigen-binding fragment thereof, or ADC capable of binding GNNK+ CD1 17 in an amount sufficient to deplete a population of CD1 17+ cells in the patient.
- the invention features a method, for example, of treating a human patient in need of a hematopoietic stem cell transplant, including: administering to a human patient an antibody, or antigen-binding fragment thereof, or ADC capable of binding GNNK+ CD1 17 in an amount sufficient to deplete a population of CD1 17+ cells in the patient, and subsequently administering to the patient a transplant including hematopoietic stem cells.
- the antibody or antigen-binding fragment thereof is selected from the group consisting of a monoclonal antibody or antigen-binding fragment thereof, a polyclonal antibody or antigen-binding fragment thereof, a humanized antibody or antigen-binding fragment thereof, a bispecific antibody or antigen-binding fragment thereof, a dual-variable immunoglobulin domain, a single-chain Fv molecule (scFv), a diabody, a triabody, a nanobody, an antibody-like protein scaffold, a Fv fragment, a Fab fragment, a F(ab') 2 molecule, and a tandem di-scFv.
- the antibody has an isotype selected from the group consisting of IgG, IgA, IgM, IgD, and IgE.
- the antibody, or antigen-binding fragment thereof, or ADC is internalized by a hematopoietic cell, such as a hematopoietic stem cell, cancer cell, or autoimmune cell following administration to the patient.
- a hematopoietic cell such as a hematopoietic stem cell, cancer cell, or autoimmune cell following administration to the patient.
- the antibody, or antigen-binding fragment thereof, or ADC may be internalized by hematopoietic stem cells, cancer cells, or autoimmune cells by receptor-mediated endocytosis (e.g., upon binding to cell-surface CD1 17, such as GNNK+ CD1 17).
- a cytotoxin covalently bound to the antibody or antigen-binding fragment thereof may be released intracellular ⁇ by chemical cleavage (for instance, by enzymatic or non-specific cleavage of a linker described herein).
- the cytotoxin may then access its intracellular target (such as the mitotic spindle apparatus, nuclear DNA, ribosomal RNA, or topoisomerases, among others) so as to promote the death of an endogenous hematopoietic cell, such as an endogenous hematopoietic stem cell prior to transplantation therapy, an endogenous cancer cell, or an endogenous autoimmune cell, among others.
- the antibody, or antigen-binding fragment thereof, or ADC is capable of promoting necrosis of a hematopoietic cell, such as a hematopoietic stem cell, cancer cell, or autoimmune cell, among others.
- the antibody or antigen-binding fragment thereof may promote the death of an endogenous hematopoietic stem cell prior to transplantation therapy, an endogenous cancer cell, or an endogenous autoimmune cell, among others, by recruiting one or more complement proteins, natural killer (NK) cells, macrophages, neutrophils, and/or eosinophils to the cell, such as a hematopoietic stem cell upon administration to the patient.
- NK natural killer
- the transplant containing hematopoietic stem cells is administered to the patient after the concentration of the antibody, or antigen-binding fragment thereof, or ADC has substantially cleared from the blood of the patient.
- the hematopoietic stem cells or progeny thereof maintain hematopoietic stem cell functional potential after two or more days (for example, from about 2 to about 5 days, from about 2 to about 7 days, from about 2 to about 20 days, from about 2 to about 30 days, such as 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 1 1 days, 12 days, 13 days, 14 days, 15 days, 16 days, 17 days, 18 days, 19 days, 20 days, 21 days, 22 days, 23 days, 24 days, 25 days, 26 days, 27 days, 28 days, 29 days, 30 days, or more) following transplantation of the hematopoietic stem cells into the patient.
- days for example, from about 2 to about 5 days, from about 2 to about 7 days, from about 2 to about 20 days, from about 2 to about 30 days, such as 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 1 1 days, 12 days, 13
- the hematopoietic stem cells or progeny thereof are capable of localizing to hematopoietic tissue, such as the bone marrow, and/or reestablishing hematopoiesis following transplantation of the hematopoietic stem cells into the patient.
- the hematopoietic stem cells upon transplantation into the patient, give rise to recovery of a population of cells selected from the group consisting of megakaryocytes, thrombocytes, platelets, erythrocytes, mast cells, myeloblasts, basophils, neutrophils, eosinophils, microglia, granulocytes, monocytes, osteoclasts, antigen- presenting cells, macrophages, dendritic cells, natural killer cells, T-lymphocytes, and B- lymphocytes.
- a population of cells selected from the group consisting of megakaryocytes, thrombocytes, platelets, erythrocytes, mast cells, myeloblasts, basophils, neutrophils, eosinophils, microglia, granulocytes, monocytes, osteoclasts, antigen- presenting cells, macrophages, dendritic cells, natural killer cells, T-lymphocytes, and B- lymphocytes.
- the method is used to treat one or more disorders, such as by depleting a population of hematopoietic stem cells in a patient prior to hematopoietic stem cell transplant therapy so as to provide a niche to which the transplanted hematopoietic stem cells may home.
- the hematopoietic stem cells may establish productive hematopoiesis, so as to replenish a deficient cell type in the patient or a cell type that is being actively killed or has been killed, for instance, by chemotherapeutic methods.
- the patient may be one that is suffering from a stem cell disorder.
- the patient is suffering from a hemoglobinopathy disorder, such as sickle cell anemia, thalassemia, Fanconi anemia, aplastic anemia, and Wiskott-Aldrich syndrome.
- a hemoglobinopathy disorder such as sickle cell anemia, thalassemia, Fanconi anemia, aplastic anemia, and Wiskott-Aldrich syndrome.
- the patient may be suffering from an immunodeficiency disorder, such as a congenital
- immunodeficiency disorder or an acquired immunodeficiency disorder (e.g., human
- the patient is suffering from a metabolic disorder, such as glycogen storage diseases,
- the patient is suffering from a disorder selected from the group consisting of adenosine deaminase deficiency and severe combined immunodeficiency, hyper immunoglobulin M syndrome, Chediak-Higashi disease, hereditary lymphohistiocytosis, osteopetrosis, osteogenesis imperfecta, storage diseases, thalassemia major, systemic sclerosis, systemic lupus erythematosus, and juvenile rheumatoid arthritis.
- the patient is suffering from an autoimmune disease, such as scleroderma, multiple sclerosis, ulcerative colitis, Crohn's disease, ant Type 1 diabetes.
- the patient is suffering from cancer or myeloproliferative disease, such as a hematological cancer.
- the patient is suffering from acute myeloid leukemia, acute lymphoid leukemia, chronic myeloid leukemia, chronic lymphoid leukemia, multiple myeloma, diffuse large B-cell lymphoma, or non-Hodgkin's lymphoma.
- the patient is suffering from a myelodysplastic disease, such as myelodysplastic syndrome.
- the method is used to directly treat a cancer, such as a cancer characterized by CD1 17+ cells (e.g., a leukemia characterized by CD1 17+ cells), by administration of an antibody, or antigen-binding fragment thereof, that depletes a population of CD1 17+ cancer cells in the patient and/or by administration of an antibody, or antigen-binding fragment thereof, so as to deplete a population of endogenous hematopoietic stem cells prior to hematopoietic stem cell transplantation.
- the transplantation may in turn re-constitute, for example, a population of cells depleted during the process of eradicating cancer cells.
- the cancer may be a hematological cancer, such as acute myeloid leukemia, acute lymphoid leukemia, chronic myeloid leukemia, chronic lymphoid leukemia, multiple myeloma, diffuse large B-cell lymphoma, or non-Hodgkin's lymphoma.
- the method is used to treat an autoimmune disease, such as by administration of an antibody, or antigen-binding fragment thereof, or ADC so as to deplete a population of CD1 17+ autoimmune cells and/or by
- the transplantation may in turn re-constitute, for example, a population of cells depleted during the process of eradicating autoimmune cells.
- the autoimmune disease may be, for example, scleroderma, multiple sclerosis (MS), human systemic lupus (SLE), rheumatoid arthritis (RA), inflammatory bowel disease (IBD), treating psoriasis, Type 1 diabetes mellitus (Type 1 diabetes), acute disseminated encephalomyelitis (ADEM), Addison's disease, alopecia universalis, ankylosing spondylitisis, antiphospholipid antibody syndrome (APS), aplastic anemia, autoimmune hemolytic anemia, autoimmune hepatitis, autoimmune inner ear disease (AIED), autoimmune lymphoproliferative syndrome (ALPS), autoimmune oophoritis, Balo disease, Behcet's disease, bullous pemphigoid, cardiomyopathy, Chagas' disease, chronic fatigue immune dysfunction syndrome (CFIDS), chronic inflammatory demyelinating polyneuropathy, Crohn's disease, cicatrical pemphigoid, coeliac
- the invention features a method of treating a hemoglobinopathy disorder, such as sickle cell anemia, thalassemia, Fanconi anemia, aplastic anemia, and Wiskott-Aldrich syndrome.
- a hemoglobinopathy disorder such as sickle cell anemia, thalassemia, Fanconi anemia, aplastic anemia, and Wiskott-Aldrich syndrome.
- an immunodeficiency disorder such as a congenital immunodeficiency disorder or an acquired immunodeficiency disorder (e.g., human immunodeficiency virus or acquired immune deficiency syndrome).
- the invention features a method of treating a metabolic disorder, such as glycogen storage diseases, mucopolysaccharidoses, Gaucher's Disease, Hurlers Disease, sphingolipidoses, and metachromatic leukodystrophy.
- a metabolic disorder such as glycogen storage diseases, mucopolysaccharidoses, Gaucher's Disease, Hurlers Disease, sphingolipidoses, and metachromatic leukodystrophy.
- the invention features a method of treating a disorder selected from the group consisting of adenosine deaminase deficiency and severe combined immunodeficiency, hyper immunoglobulin M syndrome, Chediak-Higashi disease, hereditary lymphohistiocytosis, osteopetrosis, osteogenesis imperfecta, storage diseases, thalassemia major, systemic sclerosis, systemic lupus erythematosus, and juvenile rheumatoid arthritis
- the invention features a method of treating an autoimmune disease, such as scleroderma, multiple sclerosis, ulcerative colitis, Crohn's disease, or Type 1 diabetes.
- the invention features a method of treating a cancer or myeloproliferative disease, such as a hematological cancer.
- the invention features a method of treating acute myeloid leukemia, acute lymphoid leukemia, chronic myeloid leukemia, chronic lymphoid leukemia, multiple myeloma, diffuse large B-cell lymphoma, or non-Hodgkin's lymphoma.
- the patient is suffering from a myelodysplastic disease, such as myelodysplastic syndrome.
- the method may include the steps of administering an antibody, or antigen-binding fragment thereof, or ADC that binds CD1 17 (e.g., GNNK+ CD1 17) and/or a hematopoietic stem cell transplant according to the method of any of the above-described aspects and embodiments of the invention.
- the invention provides a method of treating cancer directly, such as a cancer characterized by CD1 17+ cells (e.g., a leukemia characterized by CD1 17+ cells).
- the method includes
- the cancer may be a hematological cancer, such as acute myeloid leukemia, acute lymphoid leukemia, chronic myeloid leukemia, chronic lymphoid leukemia, multiple myeloma, diffuse large B-cell lymphoma, or non-Hodgkin's lymphoma.
- the invention provides a method of treating an autoimmune disease, such as multiple sclerosis (MS), human systemic lupus (SLE), rheumatoid arthritis (RA), inflammatory bowel disease (IBD), treating psoriasis, Type 1 diabetes mellitus (Type 1 diabetes) acute disseminated encephalomyelitis (ADEM), Addison's disease, alopecia universalis, ankylosing spondylitisis, antiphospholipid antibody syndrome (APS), aplastic anemia, autoimmune hemolytic anemia, autoimmune hepatitis, autoimmune inner ear disease (AIED), autoimmune lymphoproliferative syndrome (ALPS), autoimmune oophoritis, Balo disease, Behcet's disease, bullous pemphigoid, cardiomyopathy, Chagas' disease, chronic fatigue immune dysfunction syndrome (CFIDS), chronic inflammatory demyelinating polyneuropathy, Crohn's disease, cicatrical pebstructive fibrosis, atopic
- the method includes administering an antibody, or antigen-binding fragment thereof, that binds CD1 17 (e.g., GNNK+ CD1 17).
- the invention features a method of depleting a population of CD1 17+ (e.g., GNNK+ CD1 17+) cells by contacting the population with an effective amount of a conjugate (or ADC) represented by the formula Ab-Z-L-Am, wherein Ab is an antibody or antigen-binding fragment thereof that binds CD1 17, Z is a chemical moiety, L
- Am-L-Z may be represented by formula (IA)
- R 2 is H, OH, OR B , or OR c ;
- R A and R B when present, together with the oxygen atoms to which they are bound, combine to form an optionally substituted 5-membered heterocycloalkyl group;
- R 3 is H, R c , or R D ;
- R 4 , R 5 , R 6, and R 7 are each independently H, OH, OR c , OR D , R c , or R D ;
- R 8 is OH, NH 2 , ORc, OR D , NHR C , or NR C R D ;
- R 9 is H, OH, ORc, or OR D ;
- X is -S-, -S(O)-, or -S0 2 -;
- Rc is -L-Z
- R D is optionally substituted alkyl (e.g., C C 6 alkyl), optionally substituted heteroalkyl (e.g., C C 6 heteroalkyl), optionally substituted alkenyl (e.g., C 2 -C 6 alkenyl), optionally substituted heteroalkenyl (e.g., C 2 -C 6 heteroalkenyl), optionally substituted alkynyl (e.g., C 2 -C 6 alkynyl), optionally substituted heteroalkynyl (e.g., C 2 -C 6 heteroalkynyl), optionally substituted cycloalkyl, optionally substituted heterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl;
- alkyl e.g., C C 6 alkyl
- optionally substituted heteroalkyl e.g., C C 6 heteroalkyl
- optionally substituted alkenyl e.g., C 2 -C 6
- optionally substituted alkylene e.g., Ci-C 6 alkylene
- optionally substituted heteroalkylene
- Z is a chemical moiety formed from a coupling reaction between a reactive substituent present on L and a reactive substituent present within the antibody or antigen-binding fragment thereof,
- linker L and the chemical moiety Z, taken together as L-Z is
- Am-L-Z is represented by formula (IB)
- R is H, OH, OR A , or OR c ;
- R 2 is H, OH, OR B , or OR c ;
- R A and R B when present, together with the oxygen atoms to which they are bound, combine to form an optionally substituted 5-membered heterocycloalkyl group;
- R 4 is H, OH, ORc, OR D , R c , or R D ;
- R 5 is H, OH, ORc, OR D , R c , or R D ;
- R 6 is H, OH, ORc, OR D , R c , or R D ;
- R 7 is H, OH, ORc, OR D , R c , or R D ;
- R 8 is OH, NH 2 , ORc, OR D , NHR C , or NR C R D ;
- R 9 is H, OH, ORc, or OR D ;
- X is -S-, -S(O)-, or -SO 2 -;
- Rc is -L-Z
- R D is optionally substituted alkyl (e.g., Ci-C 6 alkyl), optionally substituted heteroalkyi (e.g.,
- Ci-C 6 heteroalkyi optionally substituted alkenyl (e.g., C 2 -C 6 alkenyl), optionally substituted heteroalkenyl (e.g., C 2 -C 6 heteroalkenyl), optionally substituted alkynyl (e.g., C 2 -C 6 alkynyl), optionally substituted heteroalkynyl (e.g., C 2 -C 6 heteroalkynyl), optionally substituted cycloalkyl, optionally substituted heterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl;
- alkenyl e.g., C 2 -C 6 alkenyl
- heteroalkenyl e.g., C 2 -C 6 heteroalkenyl
- alkynyl e.g., C 2 -C 6 alkynyl
- heteroalkynyl e.g., C 2 -C 6 heteroalkynyl
- Am-L-Z-Ab is one of
- the Ab-Z-L-Am is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-N-(2-aminoethyl)-2
- the Ab-Z-L-Am is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-N-(2-aminoethyl)-2
- the invention features a conjugate represented by the formula Ab-Z-L Am, wherein Ab is an antibody or antigen-binding fragment thereof that binds CD1 17 (e.g., GNNK+ CD1 17) and Am is an amatoxin.
- Ab-Z-L Am is represented by formula (I), (IA), (IB), (II), (MA), or (IIB) above.
- linker-chemical moiety-amatoxin portion (Am-L-Z) of the conjugate is represented by formula (IA)
- R 2 is H, OH, OR B , or OR c ;
- R A and R B when present, together with the oxygen atoms to which they are bound, combine to form an optionally substituted 5-membered heterocycloalkyl group;
- R 3 is H, R c , or R D ;
- R 4 , R 5 , R 6 , and R 7 are each independently H, OH, OR c , OR D , Rc, or R D ;
- R 8 is OH, NH 2 , ORc, OR D , NHR C , or NR C R D ;
- R 9 is H, OH, ORc, or OR D ;
- X is -S-, -S(O)-, or -SO2-;
- R c is -L-Z
- R D is optionally substituted Ci-C 6 alkyl, optionally substituted Ci-C 6 heteroalkyl, optionally substituted C 2 -C 6 alkenyl, optionally substituted C 2 -C 6 heteroalkenyl, optionally substituted C 2 -C 6 alkynyl, optionally substituted C 2 -C 6 heteroalkynyl, optionally substituted cycloalkyl, optionally substituted heterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl;
- Z is a chemical moiety formed from a coupling reaction between a reactive substituent present on L and a reactive substituent present within the antibody or antigen-binding fragment thereof,
- Am-L-Z is represented by formula (IB)
- R 2 is H, OH, OR B , or OR c ;
- R A and R B when present, together with the oxygen atoms to which they are bound, combine to form an optionally substituted 5-membered heterocycloalkyl group;
- R 3 is H, R c , or R D ;
- R 4 , R 5 , R 6, and R 7 are each independently H, OH, OR c , OR D , R c , or R D ;
- R 8 is OH, NH 2 , ORc, OR D , NHR C , or NR C R D ;
- R 9 is H, OH, ORc, or OR D ;
- X is -S-, -S(O)-, or -SO2-;
- Rc is -L-Z
- R D is optionally substituted Ci-C 6 alkyl, optionally substituted Ci-C 6 heteroalkyl, optionally substituted C 2 -C 6 alkenyl, optionally substituted C 2 -C 6 heteroalkenyl, optionally substituted C 2 -C 6 alkynyl, optionally substituted C 2 -C 6 heteroalkynyl, optionally substituted cycloalkyl, optionally substituted heterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl;
- Z is a chemical moiety formed from a coupling reaction between a reactive substituent present on L and a reactive substituent present within the antibody or antigen-binding fragment thereof,
- Am-L-Z is represented by formula (II), formula (HA), or formula
- X is S, SO, or S0 2 ;
- Ri is H or a linker covalently bound to the antibody or antigen-binding fragment thereof through a chemical moeity Z, formed from a coupling reaction between a reactive substituent present on the linker and a reactive substituent present within an antibody, or antigen-binding fragment thereof;
- R 2 is H or a linker covalently bound to the antibody or antigen-binding fragment thereof through a chemical moeity Z, formed from a coupling reaction between a reactive substituent present on the linker and a reactive substituent present within an antibody, or antigen-binding fragment thereof;
- R 2 is the linker, and when R 2 is H, is the linker.
- X is SO
- Ri is the linker
- R 2 is H.
- the antibody or antigen-binding fragment thereof is conjugated to the amatoxin by way of a cysteine residue in the Fc domain of the antibody or antigen-binding fragment thereof.
- the cysteine residue is introduced by way of a mutation in the Fc domain of the antibody or antigen-binding fragment thereof.
- the cysteine residue may be selected from the group consisting of Cys1 18, Cys239, and Cys265 (e.g., D265C).
- the cysteine residue is naturally occurring in the Fc domain of the antibody or antigen-binding fragment thereof.
- the Fc domain may be an IgG Fc domain, such as a human lgG1 Fc domain, and the cysteine residue may be selected from the group consisting of Cys261 , Csy321 , Cys367, and Cys425.
- Ri is H, OH, or OR A ;
- R 2 is H, OH, or OR B ;
- R A and R B when present, together with the oxygen atoms to which they are bound, combine to form:
- R 3 , R 4 , R 6 , and R 7 are each H;
- R 5 is OR c ;
- R 8 is OH or NH 2 ;
- R 9 is H or OH
- X is -S-, -S(O)-, or -S0 2 -..
- R 2 are each independently H or OH
- R 3 is R c ;
- R 4 , R 6 , and R 7 are each H;
- R 5 is H, OH, or OC C 6 alkyl;
- R 8 is OH or NH 2 ;
- R 9 is H or OH
- X is -S-, -S(O)-, or -S0 2 -.ln some embodiments, R and R 2 are each independently H or
- R 3 , R 6 , and R 7 are each H;
- R 4 is ORc, or R c ;
- R 5 is H, OH, or OC C 6 alkyl
- R 8 is OH or NH 2 ;
- R 9 is H or OH
- Ri and R 2 are each independently H or
- R 3 , R 6 , and R 7 are each H;
- R 4 and R 5 are each independently H or OH
- R 8 is ORc or NHR C ;
- R 9 is H or OH
- X is -S-, -S(O)-, or -S0 2 -.ln some embodiments of these aspects, the antibody or antigen- binding fragment thereof is internalized by a CD1 17+ cell.
- Am-L-Z-Ab is:
- the antibody or antigen-binding fragment thereof binds CD1 17 with a K d of less than 1 ⁇ , less than 750 nM, less than 500 nM, less than 250 nM, less than 200 nM, less than 150 nM, less than 100 nM, less than 75 nM, less than 50 nM, less than 10 nM, less than 1 nM, less than 0.1 nM, less than 10 pM, less than 1 pM, or less than 0.1 pM.
- the K d is from about 0.1 pM to about 1 ⁇ .
- the antibody or antigen-binding fragment thereof binds CD1 17 with a k on of from about 9 x 10 "2 M “1 s “1 to about 1 x 10 2 M “1 s “1 .
- the antibody or antigen-binding fragment thereof competitively inhibits the binding of CD1 17 to a second antibody or antigen binding fragment thereof, or binds the same epitope as a second antibody, wherein the second antibody or antigen- binding fragment thereof has the following complementarity determining regions (CDRs): a CDR- H1 having the amino acid sequence SYWIG (SEQ ID NO: 1 ); a CDR-H2 having the amino acid sequence IIYPGDSDTRYSPSFQG (SEQ ID NO: 2); a CDR-H3 having the amino acid sequence HGRGYNGYEGAFDI (SEQ ID NO: 3); a CDR-L1 having the amino acid sequence
- CDRs complementarity determining regions
- RASQGISSALA SEQ ID NO: 4
- the antibody or antigen-binding fragment thereof competitively inhibits the binding of CD1 17 to a second antibody or antigen binding fragment thereof, or binds the same epitope as a second antibody, wherein the second antibody or antigen- binding fragment thereof has the following complementarity determining regions (CDRs): a CDR- H1 having the amino acid sequence set forth in SEQ ID NO: 1 1 ;a CDR-H2 having the amino acid sequence set forth in SEQ ID NO: 12;a CDR-H3 having the amino acid sequence set forth in SEQ ID NO: 13; a CDR-L1 having the amino acid sequence set forth in SEQ ID NO: 14;a CDR-L2 having the amino acid sequence set forth in SEQ ID NO: 15; anda CDR-L3 having the amino acid sequence set forth in SEQ ID NO: 16.
- CDRs complementarity determining regions
- compositions and methods disclosed herein include anti-CD1 17 antibody Ab67.
- compositions and methods disclosed herein include anti- CD1 17 antibody comprising a variable heavy chain amino acid sequence as set forth in SEQ ID NO: 9, and a light chain variable region comprising a light chain amino acid sequence as set forth in SEQ ID NO: 10.
- the antibody or antigen-binding fragment thereof is selected from the group consisting of a monoclonal antibody or antigen-binding fragment thereof, a polyclonal antibody or antigen-binding fragment thereof, a humanized antibody or antigen-binding fragment thereof, a bispecific antibody or antigen-binding fragment thereof, a dual-variable immunoglobulin domain, a single-chain Fv molecule (scFv), a diabody, a triabody, a nanobody, an antibody-like protein scaffold, a Fv fragment, a Fab fragment, a F(ab') 2 molecule, and a tandem di- scFV.
- scFv single-chain Fv molecule
- the invention features a conjugate represented by the formula Ab-Cy, wherein Ab is an antibody or antigen-binding fragment thereof that binds CD1 17 (e.g., GNNK+ CD1 17) and Cy is a cytotoxin.
- Ab is an antibody or antigen-binding fragment thereof that binds CD1 17 (e.g., GNNK+ CD1 17) and Cy is a cytotoxin.
- the cytotoxin is pseudomonas exotoxin A, deBouganin, diphtheria toxin, saporin, maytansine, a maytansinoid, an auristatin, an anthracycline, a calicheamicin, irinotecan, SN-38, a duocarmycin, a pyrrolobenzodiazepine, a pyrrolobenzodiazepine dimer, an indolinobenzodiazepine, or an indolinobenzodiazepine dimer, or a variant of any of the foregoing cytotoxins.
- the antibody or antigen-binding fragment thereof is selected from the group consisting of a monoclonal antibody or antigen-binding fragment thereof, a polyclonal antibody or antigen-binding fragment thereof, a humanized antibody or antigen-binding fragment thereof, a bispecific antibody or antigen-binding fragment thereof, a dual-variable immunoglobulin domain, a single-chain Fv molecule (scFv), a diabody, a triabody, a nanobody, an antibody-like protein scaffold, a Fv fragment, a Fab fragment, a F(ab') 2 molecule, and a tandem di- scFv.
- the antibody has an isotype selected from the group consisting of IgG, IgA, IgM, IgD, and IgE.
- the invention features an antibody or fragment thereof that binds CD1 17
- an Fc domain such as a dimeric Fc domain isolated from a human antibody (for example, isolated from an lgG1 , lgG2, lgG3, or lgG4 isotype human antibody).
- the Fc domain is a monomeric Fc domain containing a single polypeptide strand.
- the N-terminus of the antibody or fragment thereof is bound to the Fc domain.
- the C-terminus of the antibody or fragment thereof is bound to the Fc domain.
- the Fc domain may be conjugated to one or more copies of the antibody or fragment thereof.
- conjugates described herein include dimeric Fc domains in which each polypeptide strand of the Fc domain is conjugated to the antibody or fragment thereof.
- the Fc domain may in turn be conjugated to a cytotoxin, such as a cytotoxin described herein (for example, pseudomonas exotoxin A, deBouganin, diphtheria toxin, an amatoxin, such as a-amanitin, saporin, maytansine, a cytotoxin described herein (for example, pseudomonas exotoxin A, deBouganin, diphtheria toxin, an amatoxin, such as a-amanitin, saporin, maytansine, a
- cytotoxin such as a cytotoxin described herein (for example, pseudomonas exotoxin A, deBouganin, diphtheria toxin, an amatoxin, such as a-amanitin, sapor
- auristatin an anthracycline, a calicheamicin, irinotecan, SN-38, a duocarmycin, a pyrrolobenzodiazepine, a pyrrolobenzodiazepine dimer, an indolinobenzodiazepine, and an indolinobenzodiazepine dimer, or a variant thereof).
- the antibody or fragment thereof is covalently bound to a cytotoxin, such as a cytotoxin described herein (for example, pseudomonas exotoxin A, deBouganin, diphtheria toxin, an amatoxin, such as a-amanitin, saporin, maytansine, a cytotoxin described herein (for example, pseudomonas exotoxin A, deBouganin, diphtheria toxin, an amatoxin, such as a-amanitin, saporin, maytansine, a cytotoxin described herein (for example, pseudomonas exotoxin A, deBouganin, diphtheria toxin, an amatoxin, such as a-amanitin, saporin, maytansine, a cytotoxin described herein (for example, pseudomonas exotoxin A, deBouganin, diphtheria toxin, an am
- the N- terminus of the antibody or fragment thereof is bound to the cytotoxin.
- the C-terminus of the antibody or fragment thereof is bound to the cytotoxin.
- the cytotoxin may in turn be conjugated to an Fc domain.
- the antibody or fragment thereof is covalently bound to the cytotoxin at one site on the antibody or fragment thereof (for example, the N- or C-terminus of the antibody or fragment thereof) and is covalently bound to an Fc domain at another site on the antibody or fragment thereof (for example, the opposite terminus of the antibody or fragment thereof).
- the Fc domain is a human lgG1 isotype Fc domain. In some embodiments of this aspect, the Fc domain is a human lgG2 isotype Fc domain. In some embodiments of this aspect, the Fc domain is a human lgG3 isotype Fc domain. In some embodiments of this aspect, the Fc domain is a human lgG4 isotype Fc domain.
- the foregoing methods and compositions include an anti-CD1 17 antibody or antigen-binding fragment thereof comprising the CDRs set forth in the heavy and light chain amino acid sequences set forth in Table 10 for any one of Ab54, Ab55, Ab56, Ab57, Ab58, Ab61 , Ab66, Ab67, Ab68, or Ab69.
- the foregoing methods and compositions include an anti-CD1 17 antibody or antigen-binding fragment thereof comprising the variable regions set forth in the heavy and light chain amino acid sequences set forth in Table 10 for any one of Ab54, Ab55, Ab56, Ab57, Ab58, Ab61 , Ab66, Ab67, Ab68, or Ab69.
- the foregoing methods and compositions include an lgG1 anti-CD1 17 antibody or antigen-binding fragment thereof comprising the variable regions set forth in the heavy and light chain amino acid sequences set forth in Table 10 for any one of Ab54, Ab55, Ab56, Ab57, Ab58, Ab61 , Ab66, Ab67, Ab68, or Ab69.
- Fig. 1 demonstrates the measurement of binding by Bio-Layer Interferometry (BLI) of the indicated purified IgG (sensor-associated) to purified human CD1 17 ectodomain (R&D Systems #332-SR) at concentrations of 33.3 nM and 1 1 nM as a function of time.
- BLI Bio-Layer Interferometry
- Figs. 2A and 2B graphically depict the results of in vitro cell proliferation assays that show the dose-dependent effect of each indicated antibody on the Stem Cell Factor (SCF)-dependent proliferation of human CD34+ bone marrow cells.
- SCF Stem Cell Factor
- Figs. 3A and 3B graphically depict the results of in vitro cell killing assays that show the dose-dependent effect of each indicated ADC on the viability of human CD34+ bone marrow cells.
- Total live cell counts (Fig. 3A) or viable CD34+CD90+ cell counts (Fig. 3B) (y-axis) in the presence of the HC-67/LC-67 ADC (i.e., the Ab67 ADC) or control as a function of HC-67/LC-67 ADC (i.e., the Ab67 ADC) or control concentration (x-axis) are depicted.
- Fig. 4 demonstrates the measurement of binding by Bio-Layer Interferometry (BLI) of the indicated purified IgG (sensor-associated) to purified human CD1 17 ectodomain (R&D Systems #332-SR) at concentrations of 33.3 nM and 1 1 nM as a function of time.
- BLI Bio-Layer Interferometry
- Figs. 5A and 5B graphically depict the results of in vitro cell proliferation assays that show the dose-dependent effect of each indicated antibody on the Stem Cell Factor (SCF)-dependent proliferation of human CD34+ bone marrow cells.
- Total live cell counts (Fig. 5A) or viable CD34+ CD90+ cell counts as determined by flow cytometry (Fig. 5B) (y-axis) in the presence of the 3100 mAb, HC-55/LC-55 IgG (Ab55 IgG) or control as a function of 3100 mAb, HC-55/LC-55 IgG (Ab55 IgG) or control concentration (x-axis) are depicted.
- Figs. 5A Total live cell counts
- Fig. 5B y-axis in the presence of the 3100 mAb, HC-55/LC-55 IgG (Ab55 IgG) or control as a function of 3100 mAb, HC-55/LC-55 IgG (Ab55
- FIG. 6A and 6B graphically depict the results of in vitro cell killing assays that show the dose-dependent effect of each indicated ADC on the viability of human CD34+ bone marrow cells.
- Total live cell counts (Fig. 6A) or viable CD34+CD90+ cell counts (Fig. 6B) (y-axis) in the presence of the HC-55/LC-55 ADC (Ab55 ADC) or control as a function of HC-55/LC-55 ADC (Ab55 ADC) or control concentration (x-axis) are depicted.
- Figs. 7A and 7B demonstrate the measurement of binding by Bio-Layer Interferometry (BLI) of the indicated purified IgG (sensor-associated) to purified human CD1 17 ectodomain (R&D Systems #332-SR) at concentrations of 33.3 nM and 1 1 nM as a function of time.
- the results for Ab54, Ab55, Ab56, Ab57, Ab68, and Ab61 are shown in Fig. 7A.
- the results for Ab66, Ab67, Ab68, and Ab69 are shown in Fig. 7B.
- Figs. 8A and 8B graphically depict the results of in vitro cell killing assays that show Kasumi-1 cell viability as measured in luminescence (RLU) by Celltiter Glo as a function of the indicated anti-CD1 17 ADC or control concentration.
- the results for Ab54, Ab55, Ab56, Ab57, Ab58, and Ab61 are shown in Fig. 8A.
- the results for Ab66, Ab67, Ab68, and Ab69 are shown in Fig. 8B.
- Fig. 9 graphically depicts a quantification of the area under the killing curve in the in vitro cell killing assays depicted in Figs. 8A and 8B.
- Figs. 10A and 10B graphically depict the results of in vitro cell proliferation assays that show the effect of each indicated antibody on the Stem Cell Factor (SCF)-dependent proliferation of human CD34+ bone marrow cells.
- SCF Stem Cell Factor
- Total live cell counts as determined by flow cytometry (y- axis) in the presence of the indicated antibody or control (CK6) as a function of antibody concentration (x-axis) are depicted.
- the results for Ab54, Ab55, Ab56, Ab57, Ab58, and Ab61 are shown in Fig. 10A.
- the results for Ab66, Ab67, Ab68, and Ab69 are shown in Fig. 10B.
- Figs. 11 A and 11 B graphically depict the results of in vitro cell proliferation assays that show the effect of each indicated antibody on the Stem Cell Factor (SCF)-dependent proliferation of human CD34+ bone marrow cells.
- SCF Stem Cell Factor
- Viable CD34+ CD90+ cell counts as determined by flow cytometry (y-axis) in the presence of the indicated antibody or control (CK6) as a function of antibody concentration (x-axis) are depicted.
- the results for Ab54, Ab55, Ab56, Ab57, Ab58, and Ab61 are shown in Fig. 1 1 A.
- the results for Ab66, Ab67, Ab68, and Ab69 are shown in Fig. 1 1 B.
- Fig. 12 graphically depicts the results of an in vitro cross-blocking assay in which the binding of CK6 or human SCF (y-axis) to Ab55 or Ab67 associated -CD1 17 was assessed as a function of time (x-axis).
- Fig. 13A demonstrates the binding of human or murine SCF to human CD1 17 ectodomain (y-axis) as a function of time (x-axis) as determined by BLI.
- an in vitro cross-blocking assay demonstrated the binding of human or murine SCF (y-axis) to Ab67 associated-CD1 17 as a function of time (x-axis).
- Figs. 14A and 14B graphically depict the results of an in vitro internalization assay.
- the percent of surface CD1 17 was assessed on human bone marrow CD34+ cells following 24 hours of incubation with hlgG1 , an antagonist antibody, a neutral antibody, or SCF (Fig. 14A).
- the corresponding percent of surface IgG was also assessed as a function of time (Fig. 14B).
- Figs. 15A-15C graphically depict the results of in vitro cell killing assays in both Kasumi-1 cells (Fig. 15A) or primary human stem cells (Figs. 15B and 15C) for Ab67 and Ab55 ADCs.
- Fig. 15A graphically depict the results of in vitro cell killing assays that show Kasumi-1 cell viability as measured in luminescence (RLU) by Celltiter Glo as a function of HC-55/LC-55 ADC (Ab55 ADC), HC-67/LC-67 ADC (Ab67 ADC), or control concentration.
- Figs. 15A-15C graphically depict the results of in vitro cell killing assays in both Kasumi-1 cells (Fig. 15A) or primary human stem cells (Figs. 15B and 15C) for Ab67 and Ab55 ADCs.
- Fig. 15A graphically depict the results of in vitro cell killing assays that show Kasumi-1 cell viability as measured in luminescence (RLU) by Celltiter
- FIG. 15B and 15C graphically depict the results of in vitro cell killing assays that show the dose-dependent effect of each indicated ADC on the viability of human CD34+ bone marrow cells based on total live cell counts (Fig. 15B) or viable CD34+CD90+ cell counts (Fig. 15C) (y-axis) in the presence of the HC-55/LC-55 ADC (Ab55 ADC), HC-67/LC-67 ADC (Ab67 ADC), or control as a function of antibody concentration (x- axis).
- Figs. 16A-16F depict chromatograms demonstrating the elution profile of the indicated antibody after 7 days (CK6 control (Fig. 16A), HC-55/LC-55 (Ab55; Fig. 16B), or HC-67/LC-67 (Ab67; Fig. 16C) or 15 days (CK6 control (Fig. 16D), HC-55/LC-55 (Ab55; Fig. 16E), or HC-67/LC- 67 (Ab67; Fig. 16F) under the indication incubation conditions after analysis by hydrophobic interaction chromatography.
- Figs. 17A and 17B graphically depict the results of in vitro cell killing assays that show viable CD34+ CD90+ cell count as a function of Ab67(WT)-ADC (i.e., WT half-life) or
- Fig. 18 graphically depicts electropherograms showing the charge heterogeneity profile of acidic variants present in the indicated antibody under the indicated incubation conditions (x-axis) as determined by capillary electrophoresis.
- Figs. 19A and 19B graphically depict the results of an in vivo cell depletion assay that shows a 0.1 mg/kg dose of Ab67(H435A)-ADC (i.e., fast half-life) or Ab67(WT)-ADC (i.e., WT half- life) selectively depletes human HSCs in humanized NSG mice.
- the absolute number of CD34+ cells in the bone marrow of Ab67(H435A)-ADC, Ab67(WT)-ADC, or control treated mice 21 days after a single administration of 0.03 mg/kg, 0.1 mg/kg, or 0.3 mg/kg of the ADC is shown in Fig. 19A.
- Fig. 20 graphically depicts the results of an in vivo cell depletion assay that shows a 0.3 mg/kg single dose or a fractionated dose of 0.2 mg/kg Q3Dx2 of Ab67(H435A)-ADC (i.e. fast half- life) selectively depletes cynomolgus HSCs in cynomolgus monkeys.
- the absolute number of CD34+ CD90+ CD45RA- (phenotypic HSCs) isolated from the bone marrow of male cynomolgus monkeys dosed with the indicated dosing schema are shown (mean +/- SEM).
- Figs. 21 A and 21 B depict multiple sequence alignments of the heavy chain variable regions (VH; Fig. 21 A) and the light chain variable regions (LH; Fig. 21 B) of antagonist antibodies Ab54, Ab55, Ab66, and Ab67. The CDRs of each variable region are indicated.
- Figs. 22A and 22B depict multiple sequence alignments of the heavy chain variable regions (VH; Fig. 22A) and the light chain variable regions (LH; Fig. 22B) of neutral antibodies Ab58 and Ab61 .
- the CDRs of each variable region are indicated.
- Figs. 23A and 23B depict multiple sequence alignments of the heavy chain variable regions (VH; Fig. 23A) and the light chain variable regions (LH; Fig. 23B) of neutral antibodies Ab66, Ab67, Ab68, and Ab69. The CDRs of each variable region are indicated.
- Described herein are isolated anti-CD1 17 human antibodies that bind to human CD1 17.
- the antibodies provided herein have many characteristics making them advantageous for therapy, including methods of conditioning human patients for stem cell transplantation.
- antibodies disclosed herein cross react with rhesus CD1 17 and are able to internalize. Both of these features also make them advantageous for use in conjugates for delivering cytotoxins to CD1 17 expressing cells.
- the antibodies described herein include both antagonist antibodies and neutral antibodies.
- anti-CD1 17 antibodies Antibody 54 (Ab54), Antibody 55 (Ab55), Antibody 56 (Ab56), Antibody 57 (Ab57), Antibody 58 (Ab58), Antibody 61 (Ab61 ), Antibody 66 (Ab66), Antibody 67 (Ab67), Antibody 68 (Ab68), and Antibody 69 (Ab69) which are each human anti-CD1 17 antibodies that specifically bind to the ectodomain of human CD1 17.
- the binding regions of Ab54, Ab55, Ab56, Ab57, Ab58, Ab61 , Ab66, Ab67, Ab68, and Ab69 are described below, including in Table 10.
- the anti-CD1 17 antibodies disclosed herein can be included in anti- CD1 17 antibody drug conjugates (ADCs; also referred to herein as conjugates).
- ADCs anti- CD1 17 antibody drug conjugates
- anti-CD1 17 antibodies and conjugates described herein can be used to in methods to treat a variety of disorders, such as diseases of a cell type in the hematopoietic lineage, cancers, autoimmune diseases, metabolic disorders, and stem cell disorders, among others.
- compositions and methods described herein may (i) directly deplete a population of cells that give rise to a pathology, such as a population of cancer cells (e.g., leukemia cells) and autoimmune cells (e.g., autoreactive T-cells), and/or (ii) deplete a population of endogenous hematopoietic stem cells so as to promote the engraftment of transplanted hematopoietic stem cells by providing a niche to which the transplanted cells may home.
- a pathology such as a population of cancer cells (e.g., leukemia cells) and autoimmune cells (e.g., autoreactive T-cells)
- a population of endogenous hematopoietic stem cells so as to promote the engraftment of transplanted hematopoietic stem cells by providing a niche to which the transplanted cells may home.
- the foregoing activities can be achieved by administration of an ADC, antibody, or antigen-binding fragment thereof
- this administration can cause a reduction in the quantity of the cells that give rise to the pathology of interest.
- this administration can cause the selective depletion of a population of endogenous hematopoietic stem cells, thereby creating a vacancy in the hematopoietic tissue, such as the bone marrow, that can subsequently be filled by transplanted, exogenous hematopoietic stem cells. This selective depletion is also referred to as conditioning.
- the invention is based in part on the discovery that ADCs, antibodies, or antigen-binding fragments thereof, capable of binding CD1 17 (such as GNNK+ D1 17) can be administered to a patient to effect both of the above activities or as a conditioning agent.
- ADCs, antibodies, or antigen-binding fragments thereof, that bind CD1 17 can be administered to a patient suffering from a cancer, such as leukemia, or autoimmune disease to directly deplete a population of cancerous cells or autoimmune cells, and can also be administered to a patient in need of hematopoietic stem cell transplant therapy in order to promote the survival and engraftment potential of transplanted hematopoietic stem cells.
- Engraftment of hematopoietic stem cell transplants due to the administration of anti-CD1 17 antibodies, or antigen-binding fragments thereof, can manifest in a variety of empirical
- engraftment of transplanted hematopoietic stem cells can be evaluated by assessing the quantity of competitive repopulating units (CRU) present within the bone marrow of a patient following administration of an antibody or antigen-binding fragment thereof capable of binding CD1 17 and subsequent administration of a hematopoietic stem cell transplant.
- CRU competitive repopulating units
- a reporter gene such as an enzyme that catalyzes a chemical reaction yielding a fluorescent, chromophoric, or luminescent product
- hematopoietic stem cells have been transfected and subsequently monitoring the corresponding signal in a tissue into which the hematopoietic stem cells have homed, such as the bone marrow.
- a tissue into which the hematopoietic stem cells have homed such as the bone marrow.
- Engraftment can also be determined by measuring white blood cell counts in peripheral blood during a post-transplant period, and/or by measuring recovery of marrow cells by donor cells in a bone marrow aspirate sample.
- the sections that follow provide a description of conjugates, antibodies, or antigen-binding fragments thereof, that can be administered to a patient, such as a patient suffering from a cancer or autoimmune disease, or a patient in need of hematopoietic stem cell transplant therapy in order to promote engraftment of hematopoietic stem cell grafts, as well as methods of administering such therapeutics to a patient (e.g., prior to hematopoietic stem cell transplantation).
- a patient such as a patient suffering from a cancer or autoimmune disease, or a patient in need of hematopoietic stem cell transplant therapy in order to promote engraftment of hematopoietic stem cell grafts, as well as methods of administering such therapeutics to a patient (e.g., prior to hematopoietic stem cell transplantation).
- the term “about” refers to a value that is within 10% above or below the value being described.
- the term “about 5 nM” indicates a range of from 4.5 nM to 5.5 nM.
- amatoxin refers to a member of the amatoxin family of peptides produced by Amanita phalloides mushrooms, or a variant or derivative thereof, such as a variant or derivative thereof capable of inhibiting RNA polymerase II activity.
- Amatoxins useful in conjunction with the compositions and methods described herein include compounds according to, but not limited to, formula (III), including a-amanitin, ⁇ -amanitin, ⁇ -amanitin, ⁇ -amanitin, amanin, amaninamide, amanullin, amanullinic acid, or proamanullin.
- amatoxins may be conjugated to an antibody, or antigen-binding fragment thereof, for instance, by way of a linker moiety (L) (thus forming a conjugate (i.e.,ADC)).
- L linker moiety
- ADC thus forming a conjugate
- compositions and methods are also described herein.
- R 2 is H, OH, or OR B ;
- R A and R B when present, together with the oxygen atoms to which they are bound, combine to form an optionally substituted 5-membered heterocycloalkyl group;
- R 3 is H or R D ;
- R 4 is H, OH, OR D , or R D ;
- R 5 is H, OH, OR D , or R D ;
- R 6 is H, OH, OR D , or R D ;
- R 7 is H, OH, OR D , or R D ;
- R 8 is OH, NH 2 , or OR D ;
- R 9 is H, OH, or OR D ;
- X is -S-, -S(O)-, or -SO 2 -;
- R D is optionally substituted alkyl (e.g., C C 6 alkyl), optionally substituted heteroalkyi (e.g.,
- Ci-C 6 heteroalkyi optionally substituted alkenyl (e.g., C 2 -C 6 alkenyl), optionally substituted heteroalkenyl (e.g., C 2 -C 6 heteroalkenyl), optionally substituted alkynyl (e.g., C 2 -C 6 alkynyl), optionally substituted heteroalkynyl (e.g., C 2 -C 6 heteroalkynyl), optionally substituted cycloalkyi, optionally substituted heterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl.
- alkenyl e.g., C 2 -C 6 alkenyl
- heteroalkenyl e.g., C 2 -C 6 heteroalkenyl
- alkynyl e.g., C 2 -C 6 alkynyl
- heteroalkynyl e.g., C 2 -C 6 heteroalkynyl
- amatoxins useful in conjunction with the compositions and methods described herein include com ounds according to formula (III A), below:
- R 2 is H, OH, or OR B ;
- R A and R B when present, together with the oxygen atoms to which they are bound, combine to form an optionally substituted 5-membered heterocycloalkyl group;
- R 3 is H or R D ;
- R 4 is H, OH, OR D , or R D ;
- R 5 is H, OH, OR D , or R D ;
- R 6 is H, OH, OR D , or R D ;
- R 7 is H, OH, OR D , or R D ;
- R 8 is OH, NH 2 , or OR D ;
- R 9 is H, OH, or OR D ;
- R D is optionally substituted alkyl (e.g., C C 6 alkyl), optionally substituted heteroalkyi (e.g., C C 6 heteroalkyi), optionally substituted alkenyl (e.g., C 2 -C 6 alkenyl), optionally substituted heteroalkenyl (e.g., C 2 -C 6 heteroalkenyl), optionally substituted alkynyl (e.g., C 2 -C 6 alkynyl), optionally substituted heteroalkynyl (e.g., C 2 -C 6 heteroalkynyl), optionally substituted cycloalkyi, optionally substituted heterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl.
- alkyl e.g., C C 6 alkyl
- optionally substituted heteroalkyi e.g., C C C 6 heteroalkyi
- optionally substituted alkenyl e.g., C 2 -C
- NRB amino acids useful in conjunction with the compositions and methods described herein also include compounds according to formula (NIB), below:
- R 2 is H, OH, or OR B ;
- R A and R B when present, together with the oxygen atoms to which they are bound, combine to form an optionally substituted 5-membered heterocycloalkyl group;
- R 3 is H or R D ;
- R 4 is H, OH, OR D , or R D ;
- R 5 is H, OH, OR D , or R D ;
- R 6 is H, OH, OR D , or R D ;
- R 7 is H, OH, OR D , or R D ;
- R 8 is OH, NH 2 , or OR D ;
- R 9 is H, OH, or OR D ;
- X is -S-, -S(O)-, or -S0 2 -;
- R D is optionally substituted alkyl (e.g., C C 6 alkyl), optionally substituted heteroalkyi (e.g. Ci-C 6 heteroalkyi), optionally substituted alkenyl (e.g., C 2 -C 6 alkenyl), optionally substituted heteroalkenyl (e.g., C 2 -C 6 heteroalkenyl), optionally substituted alkynyl (e.g., C 2 -C 6 alkynyl), optionally substituted heteroalkynyl (e.g., C 2 -C 6 heteroalkynyl), optionally substituted cycloalkyi, optionally substituted heterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl.
- alkyl e.g., C C 6 alkyl
- optionally substituted heteroalkyi e.g. Ci-C 6 heteroalkyi
- optionally substituted alkenyl e.g., C 2 -C 6
- amatoxins may be conjugated to an antibody, or antigen-binding fragment thereof, for instance, by way of a linker moiety (thus forming a conjugate).
- linker moiety thus forming a conjugate.
- Exemplary methods of amatoxin conjugation and linkers useful for such processes are described in the section entitled "Linkers for chemical conjugation," as well as in Table 1 , below.
- Exemplary linker- containing amatoxins useful for conjugation to an antibody, or antigen-binding fragment, in accordance with the compositions and methods described herein are shown in structural formulas (I), (IA), (IB), (II), (IIA), and (MB) recited herein.
- antibody refers to an immunoglobulin molecule that specifically binds to, or is immunologically reactive with, a particular antigen, and includes monoclonal, genetically engineered, and otherwise modified forms of antibodies, including but not limited to chimeric antibodies, humanized antibodies, heteroconjugate antibodies (e.g., bi- tri- and quad- specific antibodies, diabodies, triabodies, and tetrabodies), and antigen binding fragments of antibodies, including, for example, Fab', F(ab') 2 , Fab, Fv, rlgG, and scFv fragments.
- mAb monoclonal antibody
- mAb monoclonal antibody
- Fab and F(ab') 2 fragments refer to antibody fragments that lack the Fc fragment of an intact antibody. Examples of these antibody fragments are described herein.
- the antibodies of the present invention are generally isolated or recombinant.
- isolated when used herein refers to a polypeptide, e.g., an antibody, that has been identified and separated and/or recovered from a cell or cell culture from which it was expressed. Ordinarily, an isolated antibody will be prepared by at least one purification step. Thus, an “isolated antibody,” refers to an antibody which is substantially free of other antibodies having different antigenic specificities. For instance, an isolated antibody that specifically binds to CD1 17 is substantially free of antibodies that specifically bind antigens other than CD1 17.
- antigen-binding fragment refers to one or more fragments of an antibody that retain the ability to specifically bind to a target antigen.
- the antigen-binding function of an antibody can be performed by fragments of a full-length antibody.
- the antibody fragments can be, for example, a Fab, F(ab') 2 , scFv, diabody, a triabody, an affibody, a nanobody, an aptamer, or a domain antibody. Examples of binding fragments encompassed of the term
- antigen-binding fragment of an antibody include, but are not limited to: (i) a Fab fragment, a monovalent fragment consisting of the V L , V H , C L , and C H 1 domains; (ii) a F(ab') 2 fragment, a bivalent fragment containing two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the V H and C H 1 domains; (iv) a Fv fragment consisting of the V L and V H domains of a single arm of an antibody, (v) a dAb including V H and V L domains; (vi) a dAb fragment that consists of a V H domain (see, e.g., Ward et al., Nature 341 :544-546, 1989); (vii) a dAb which consists of a V H or a V L domain; (viii) an isolated complementarity determining region (CDR); and (ix)
- the two domains of the Fv fragment, V L and V H are coded for by separate genes, they can be joined, using recombinant methods, by a linker that enables them to be made as a single protein chain in which the V
- scFv single chain Fv
- These antibody fragments can be obtained using conventional techniques known to those of skill in the art, and the fragments can be screened for utility in the same manner as intact antibodies.
- Antigen-binding fragments can be produced by recombinant DNA
- anti-CD1 17 antibody or “an antibody that binds to CD1 17” refers to an antibody that is capable of binding CD1 17 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting CD1 17.
- the amino acid sequences of the two main isoforms of human CD1 17 are provided in SEQ ID NO: 145 (isoform 1 ) and SEQ ID NO: 146 (isoform 2).
- bispecific antibody refers to, for example, a monoclonal, often a human or humanized antibody that is capable of binding at least two different antigens.
- hematopoietic stem cell surface antigen or another cell surface protein such as a receptor or receptor subunit involved in a signal transduction pathway that potentiates cell growth, among others.
- CDR complementarity determining region
- FRs framework regions
- the amino acid positions that delineate a hypervariable region of an antibody can vary, depending on the context and the various definitions known in the art. Some positions within a variable domain may be viewed as hybrid hypervariable positions in that these positions can be deemed to be within a hypervariable region under one set of criteria while being deemed to be outside a hypervariable region under a different set of criteria. One or more of these positions can also be found in extended hypervariable regions.
- variable domains of native heavy and light chains each contain four framework regions that primarily adopt a ⁇ -sheet configuration, connected by three CDRs, which form loops that connect, and in some cases form part of, the ⁇ - sheet structure.
- the CDRs in each chain are held together in close proximity by the framework regions in the order FR1 -CDR1 -FR2-CDR2-FR3-CDR3-FR4 and, with the CDRs from the other antibody chains, contribute to the formation of the target binding site of antibodies (see Kabat et al., Sequences of Proteins of Immunological Interest, National Institute of Health, Bethesda, MD., 1987).
- numbering of immunoglobulin amino acid residues is performed according to the immunoglobulin amino acid residue numbering system of Kabat et al., unless otherwise indicated (although any antibody numbering scheme, including, but not limited to IMGT and Chothia, can be utilized).
- condition refers to processes by which a patient is prepared for receipt of a transplant containing hematopoietic stem cells.
- a patient may be a hematopoietic stem cell transplant (for instance, as inferred from a sustained increase in the quantity of viable hematopoietic stem cells within a blood sample isolated from a patient following a conditioning procedure and subsequent hematopoietic stem cell transplantation.
- a patient may be a hematopoietic stem cell transplant
- hematopoietic stem cell transplant therapy by administration to the patient of an ADC, antibody or antigen-binding fragment thereof capable of binding an antigen expressed by hematopoietic stem cells, such as CD1 17 (e.g., GNNK+ CD1 17).
- an ADC antibody or antigen-binding fragment thereof capable of binding an antigen expressed by hematopoietic stem cells, such as CD1 17 (e.g., GNNK+ CD1 17).
- antibody may be covalently conjugated to a cytotoxin so as to form a drug-antibody conjugate.
- Administration of an ADC, antibody, antigen-binding fragment thereof, or drug-antibody conjugate capable of binding one or more of the foregoing antigens to a patient in need of hematopoietic stem cell transplant therapy can promote the engraftment of a hematopoietic stem cell graft, for example, by selectively depleting endogenous hematopoietic stem cells, thereby creating a
- conjugate refers to a compound formed by the chemical bonding of a reactive functional group of one molecule, such as an antibody or antigen-binding fragment thereof, with an appropriately reactive functional group of another molecule, such as a cytotoxin described herein.
- Conjugates may include a linker between the two molecules bound to one another.
- linkers that can be used for the formation of a conjugate include peptide-containing linkers, such as those that contain naturally occurring or non-naturally occurring amino acids, such as D-amino acids. Linkers can be prepared using a variety of strategies described herein and known in the art.
- a linker may be cleaved, for example, by enzymatic hydrolysis, photolysis, hydrolysis under acidic conditions, hydrolysis under basic conditions, oxidation, disulfide reduction, nucleophilic cleavage, or organometallic cleavage (see, for example, Leriche et al., Bioorg. Med. Chem., 20:571 -582, 2012).
- conjugate when referring to a compound) is also referred to interchangeably herein as a "drug conjugate", “antibody drug conjugate” or "ADC”.
- the term "coupling reaction” refers to a chemical reaction in which two or more substituents suitable for reaction with one another react so as to form a chemical moiety that joins (e.g., covalently) the molecular fragments bound to each substituent.
- Coupling reactions include those in which a reactive substituent bound to a fragment that is a cytotoxin, such as a cytotoxin known in the art or described herein, reacts with a suitably reactive substituent bound to a fragment that is an antibody, or antigen-binding fragment thereof, such as an antibody, antigen-binding fragment thereof, or specific anti-CD1 17 antibody that binds CD1 17 (such as GNNK+ CD1 17) known in the art or described herein.
- suitably reactive substituents include a nucleophile/electrophile pair (e.g., a thiol/haloalkyl pair, an amine/carbonyl pair, or a thiol/a ⁇ -unsatu rated carbonyl pair, among others), a diene/dienophile pair (e.g., an azide/alkyne pair, among others), and the like.
- a nucleophile/electrophile pair e.g., a thiol/haloalkyl pair, an amine/carbonyl pair, or a thiol/a ⁇ -unsatu rated carbonyl pair, among others
- diene/dienophile pair e.g., an azide/alkyne pair, among others
- Coupling reactions include, without limitation, thiol alkylation, hydroxyl alkylation, amine alkylation, amine condensation, amidation, esterification, disulfide formation, cycloaddition (e.g., [4+2] Diels-Alder cycloaddition, [3+2] Huisgen cycloaddition, among others), nucleophilic aromatic substitution, electrophilic aromatic substitution, and other reactive modalities known in the art or described herein.
- cycloaddition e.g., [4+2] Diels-Alder cycloaddition, [3+2] Huisgen cycloaddition, among others
- nucleophilic aromatic substitution e.g., [4+2] Diels-Alder cycloaddition, [3+2] Huisgen cycloaddition, among others
- nucleophilic aromatic substitution e.g., [4+2] Diels-Alder cycloa
- CRU competitive repopulating unit
- the term "donor” refers to a human or animal from which one or more cells are isolated prior to administration of the cells, or progeny thereof, into a recipient.
- the one or more cells may be, for example, a population of hematopoietic stem cells.
- the term "diabody” refers to a bivalent antibody containing two polypeptide chains, in which each polypeptide chain includes V H and V L domains joined by a linker that is too short (e.g., a linker composed of five amino acids) to allow for intramolecular association of V H and V L domains on the same peptide chain. This configuration forces each domain to pair with a linker that is too short (e.g., a linker composed of five amino acids) to allow for intramolecular association of V H and V L domains on the same peptide chain. This configuration forces each domain to pair with a linker that is too short (e.g., a linker composed of five amino acids) to allow for intramolecular association of V H and V L domains on the same peptide chain. This configuration forces each domain to pair with a linker that is too short (e.g., a linker composed of five amino acids) to allow for intramolecular association of V H and V L domains on the same peptid
- the term "triabody” refers to trivalent antibodies containing three peptide chains, each of which contains one V H domain and one V L domain joined by a linker that is exceedingly short (e.g., a linker composed of 1 -2 amino acids) to permit intramolecular association of V H and V L domains within the same peptide chain.
- a linker that is exceedingly short (e.g., a linker composed of 1 -2 amino acids) to permit intramolecular association of V H and V L domains within the same peptide chain.
- peptides configured in this way typically trimerize so as to position the V H and V L domains of neighboring peptide chains spatially proximal to one another (see, for example, Holliger et al., Proc. Natl. Acad. Sci. USA 90:6444-48, 1993).
- drug-to-antibody ratio refers to the number of drugs, e.g., amatoxin, attached to the antibody of a conjugate.
- the DAR of an ADC can range from 1 to 8, although higher loads are also possible depending on the number of linkage sites on an antibody.
- the conjugate has a DAR of 1 , 2, 3, 4, 5, 6, 7, or 8.
- DVD-lg dual variable domain immunoglobulin
- the term "endogenous” describes a substance, such as a molecule, cell, tissue, or organ (e.g., a hematopoietic stem cell or a cell of hematopoietic lineage, such as a megakaryocyte, thrombocyte, platelet, erythrocyte, mast cell, myeloblast, basophil, neutrophil, eosinophil, microglial cell, granulocyte, monocyte, osteoclast, antigen-presenting cell,
- a hematopoietic stem cell or a cell of hematopoietic lineage such as a megakaryocyte, thrombocyte, platelet, erythrocyte, mast cell, myeloblast, basophil, neutrophil, eosinophil, microglial cell, granulocyte, monocyte, osteoclast, antigen-presenting cell,
- hematopoietic stem and progenitor cells to repopulate a tissue, whether such cells are naturally circulating or are provided by transplantation.
- the term encompasses all events surrounding or leading up to engraftment, such as tissue homing of cells and colonization of cells within the tissue of interest.
- the engraftment efficiency or rate of engraftment can be evaluated or quantified using any clinically acceptable parameter as known to those of skill in the art and can include, for example, assessment of competitive repopulating units (CRU); incorporation or expression of a marker in tissue(s) into which stem cells have homed, colonized, or become engrafted; or by evaluation of the progress of a subject through disease progression, survival of hematopoietic stem and progenitor cells, or survival of a recipient.
- Engraftment can also be determined by measuring white blood cell counts in peripheral blood during a post-transplant period. Engraftment can also be assessed by measuring recovery of marrow cells by donor cells in a bone marrow aspirate sample.
- exogenous describes a substance, such as a molecule, cell, tissue, or organ (e.g., a hematopoietic stem cell or a cell of hematopoietic lineage, such as a megakaryocyte, thrombocyte, platelet, erythrocyte, mast cell, myeloblast, basophil, neutrophil, eosinophil, microglial cell, granulocyte, monocyte, osteoclast, antigen-presenting cell,
- a hematopoietic stem cell or a cell of hematopoietic lineage such as a megakaryocyte, thrombocyte, platelet, erythrocyte, mast cell, myeloblast, basophil, neutrophil, eosinophil, microglial cell, granulocyte, monocyte, osteoclast, antigen-presenting cell,
- Exogenous substances include those that are provided from an external source to an organism or to cultured matter extracted therefrom.
- Fc refers to the portion of an IgG antibody that correlates to a crystallizable fragment obtained by papain digestion of an IgG molecule.
- the Fc region comprises the C-terminal half of two heavy chains of an IgG molecule that are linked by disulfide bonds. It has no antigen binding activity but contains the carbohydrate moiety and binding sites for complement and Fc receptors, including the FcRn receptor.
- An Fc region contains the second constant domain CH2 (e.g., residues at EU positions 231 -340 of lgG1 ) and the third constant domain CH3 (e.g., residues at EU positions 341 -447 of human lgG1 ).
- the Fc region includes the "lower hinge region” (e.g., residues at EU positions 233- 239 of lgG1 ).
- Fc can refer to this region in isolation, or this region in the context of an antibody, antibody fragment, or Fc fusion protein. Polymorphisms have been observed at a number of positions in Fc domains, including but not limited to EU positions 270, 272, 312, 315, 356, and 358, and thus slight differences between the sequences presented in the instant application and sequences known in the art can exist.
- a "wild type IgG Fc domain” or "WT IgG Fc domain” refers to any naturally occurring IgG Fc region (i.e., any allele).
- sequences of the heavy chains of human lgG1 , lgG2, lgG3 and lgG4 can be found in a number of sequence databases, for example, at the Uniprot database (www.uniprot.org) under accession numbers P01857
- modified Fc region or “variant Fc region” as used herein refers to an IgG Fc domain comprising one or more amino acid substitutions, deletions, insertions or modifications introduced at any position within the Fc region.
- an intact antibody comprises two heavy chains each comprising a variable region, a constant region and an Fc region, and two light chains each comprising a variable region and a constant region. More specifically, an intact IgG comprises two light chains each comprising a light chain variable region (VL) and a light chain constant region (CL), and comprises two heavy chains each comprising a heavy chain variable region (VH) and three heavy chain constant regions (CH1 , CH2, and CH3). CH2 and CH3 represent the Fc region of the heavy chain.
- frame region includes amino acid residues that are adjacent to the CDRs of an antibody or antigen-binding fragment thereof.
- FW region residues may be present in, for example, human antibodies, humanized antibodies, monoclonal antibodies, antibody fragments, Fab fragments, single chain antibody fragments, scFv fragments, antibody domains, and bispecific antibodies, among others.
- HSCs hematopoietic stem cells
- granulocytes e.g., promyelocytes, neutrophils, eosinophils, basophils
- erythrocytes e.g., reticulocytes, erythrocytes
- thrombocytes e.g., megakaryoblasts, platelet producing megakaryocytes, platelets
- monocytes e.g., monocytes, macrophages
- dendritic cells e.g., NK cells, B-cells and T-cells.
- Such cells may include CD34 + cells.
- CD34 + cells are immature cells that express the CD34 cell surface marker.
- CD34+ cells are believed to include a subpopulation of cells with the stem cell properties defined above, whereas in mice, HSCs are CD34-.
- HSCs also refer to long term repopulating HSCs (LT-HSC) and short term repopulating HSCs (ST- HSC).
- LT-HSCs and ST-HSCs are differentiated, based on functional potential and on cell surface marker expression.
- human HSCs are CD34+, CD38-, CD45RA-, CD90+, CD49F+, and lin- (negative for mature lineage markers including CD2, CD3, CD4, CD7, CD8, CD10, CD1 1 B, CD19, CD20, CD56, CD235A).
- bone marrow LT-HSCs are CD34-, SCA-1 +, C- kit+, CD135-, Slamfl/CD150+, CD48-, and lin- (negative for mature lineage markers including Ter1 19, CD1 1 b, Gr1 , CD3, CD4, CD8, B220, IL7ra), whereas ST-HSCs are CD34+, SCA-1 +, C- kit+, CD135-, Slamfl/CD150+, and lin- (negative for mature lineage markers including Ter1 19, CD1 1 b, Gr1 , CD3, CD4, CD8, B220, IL7ra).
- ST-HSCs are less quiescent and more proliferative than LT-HSCs under homeostatic conditions.
- LT-HSC have greater self- renewal potential (i.e., they survive throughout adulthood, and can be serially transplanted through successive recipients), whereas ST-HSCs have limited self-renewal (i.e., they survive for only a limited period of time, and do not possess serial transplantation potential). Any of these HSCs can be used in the methods described herein.
- ST-HSCs are particularly useful because they are highly proliferative and thus, can more quickly give rise to differentiated progeny.
- hematopoietic stem cell functional potential refers to the functional properties of hematopoietic stem cells which include 1 ) multi-potency (which refers to the ability to differentiate into multiple different blood lineages including, but not limited to, granulocytes (e.g., promyelocytes, neutrophils, eosinophils, basophils), erythrocytes (e.g., reticulocytes, erythrocytes), thrombocytes (e.g., megakaryoblasts, platelet producing
- multi-potency which refers to the ability to differentiate into multiple different blood lineages including, but not limited to, granulocytes (e.g., promyelocytes, neutrophils, eosinophils, basophils), erythrocytes (e.g., reticulocytes, erythrocytes), thrombocytes (e.g., megakaryoblasts, platelet producing
- monocytes e.g., monocytes, macrophages
- dendritic cells e.g., microglia, osteoclasts
- lymphocytes e.g., NK cells, B-cells and T-cells
- human antibody is intended to include antibodies having variable and constant regions derived from human germline immunoglobulin sequences.
- a human antibody may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or during gene rearrangement or by somatic mutation in vivo).
- human antibody as used herein, is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
- a human antibody can be produced in a human cell (for example, by recombinant expression) or by a non-human animal or a prokaryotic or eukaryotic cell that is capable of expressing functionally rearranged human immunoglobulin (such as heavy chain and/or light chain) genes.
- a human antibody when a human antibody is a single chain antibody, it can include a linker peptide that is not found in native human antibodies.
- an Fv can contain a linker peptide, such as two to about eight glycine or other amino acid residues, which connects the variable region of the heavy chain and the variable region of the light chain. Such linker peptides are considered to be of human origin.
- Human antibodies can be made by a variety of methods known in the art including phage display methods using antibody libraries derived from human immunoglobulin sequences. Human antibodies can also be produced using transgenic mice that are incapable of expressing functional endogenous immunoglobulins, but which can express human immunoglobulin genes (see, for example, PCT Publication Nos. WO 1998/24893; WO 1992/01047; WO 1996/34096; WO 1996/33735; U.S. Patent Nos. 5,413,923; 5,625,126;
- a “humanized” antibody refers to an antibody that contains minimal sequences derived from non-human immunoglobulin.
- "humanized” forms of non-human (e.g., murine) antibodies are chimeric antibodies that contain minimal sequence derived from the non-human antibody. All or substantially all of the FW regions may also be those of a human immunoglobulin sequence.
- the humanized antibody can also contain at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin consensus sequence.
- Fc immunoglobulin constant region
- patients that are "in need of" a hematopoietic stem cell transplant include patients that exhibit a defect or deficiency in one or more blood cell types, as well as patients having a stem cell disorder, autoimmune disease, cancer, or other pathology described herein.
- Hematopoietic stem cells generally exhibit 1 ) multi-potency, and can thus differentiate into multiple different blood lineages including, but not limited to, granulocytes (e.g., promyelocytes, neutrophils, eosinophils, basophils), erythrocytes (e.g., reticulocytes, erythrocytes), thrombocytes (e.g., megakaryoblasts, platelet producing megakaryocytes, platelets), monocytes (e.g., monocytes, macrophages), dendritic cells, microglia, osteoclasts, and lymphocytes (e.g., NK cells, B-cells and T-cells), 2) self-renewal, and can thus give rise to daughter cells that have equivalent potential as the mother cell, and 3) the ability to be reintroduced into a transplant recipient whereupon they home to the hematopoietic stem cell niche and re-establish productive and sustained hem
- Hematopoietic stem cells can thus be administered to a patient defective or deficient in one or more cell types of the hematopoietic lineage in order to reconstitute the defective or deficient population of cells in vivo.
- the patient may be suffering from cancer, and the deficiency may be caused by administration of a chemotherapeutic agent or other medicament that depletes, either selectively or non-specifically, the cancerous cell population.
- the patient may be suffering from a hemoglobinopathy (e.g., a non-malignant hemoglobinopathy), such as sickle cell anemia, thalassemia, Fanconi anemia, aplastic anemia, and Wiskott-Aldrich syndrome.
- a hemoglobinopathy e.g., a non-malignant hemoglobinopathy
- the subject may be one that is suffering from adenosine deaminase severe combined immunodeficiency (ADA SCID), HIV/AIDS, metachromatic leukodystrophy, Diamond-Blackfan anemia, and Schwachman-Diamond syndrome.
- ADA SCID adenosine deaminase severe combined immunodeficiency
- the subject may have or be affected by an inherited blood disorder (e.g., sickle cell anemia) or an autoimmune disorder.
- the subject may have or be affected by a malignancy, such as neuroblastoma or a hematologic cancer.
- the subject may have a leukemia, lymphoma, or myeloma.
- the subject has acute myeloid leukemia, acute lymphoid leukemia, chronic myeloid leukemia, chronic lymphoid leukemia, multiple myeloma, diffuse large B-cell lymphoma, or non-Hodgkin's lymphoma.
- the subject has myelodysplastic syndrome.
- the subject has an autoimmune disease, such as scleroderma, multiple sclerosis, ulcerative colitis, Crohn's disease, Type 1 diabetes, or another autoimmune pathology described herein.
- the subject is in need of chimeric antigen receptor T-cell (CART) therapy.
- the subject has or is otherwise affected by a metabolic storage disorder.
- the subject may suffer or otherwise be affected by a metabolic disorder selected from the group consisting of glycogen storage diseases, mucopolysaccharidoses, Gaucher's Disease, Hurlers Disease, sphingolipidoses, metachromatic leukodystrophy, or any other diseases or disorders which may benefit from the treatments and therapies disclosed herein and including, without limitation, severe combined immunodeficiency, Wiscott-Aldrich syndrome, hyper immunoglobulin M (IgM) syndrome, Chediak-Higashi disease, hereditary lymphohistiocytosis, osteopetrosis, osteogenesis imperfecta, storage diseases, thalassemia major, sickle cell disease, systemic sclerosis, systemic lupus erythematosus, multiple sclerosis, juvenile rheumatoid arthritis and those diseases, or disorders described in "Bone M
- a patient "in need of" a hematopoietic stem cell transplant may one that is or is not suffering from one of the foregoing pathologies, but nonetheless exhibits a reduced level (e.g., as compared to that of an otherwise healthy subject) of one or more endogenous cell types within the hematopoietic lineage, such as megakaryocytes, thrombocytes, platelets, erythrocytes, mast cells, myeloblasts, basophils, neutrophils, eosinophils, microglia, granulocytes, monocytes, osteoclasts, antigen-presenting cells, macrophages, dendritic cells, natural killer cells, T- lymphocytes, and B- lymphocytes.
- endogenous cell types within the hematopoietic lineage such as megakaryocytes, thrombocytes, platelets, erythrocytes, mast cells, myeloblasts, basophils, neutrophils, eosinophil
- the term "monoclonal antibody” refers to an antibody that is derived from a single clone, including any eukaryotic, prokaryotic, or phage clone, and not the method by which it is produced.
- neutral antibody refers to an antibody, or an antigen binding fragment thereof, that is not capable of significantly neutralizing, blocking, inhibiting, abrogating, reducing or interfering with the activities of a particular or specified target (e.g., CD1 17), including the binding of receptors to ligands or the interactions of enzymes with substrates.
- a neutral anti-CD1 17 antibody, or fragment thereof is an anti-CD1 17 antibody that does not substantially inhibit SCF-dependent cell proliferation and does not cross block SCF binding to CD1 17.
- An example of a neutral antibody is Ab67 (or an antibody having the binding regions of Ab67).
- an "antagonist" anti-CD1 17 antibody inhibits SCF-dependent proliferation and is able to cross block SCF binding to CD1 17.
- An example of an antagonist antibody is Ab55 (or an antibody having the binding regions of Ab55).
- the term "recipient” refers to a patient that receives a transplant, such as a transplant containing a population of hematopoietic stem cells.
- a transplant such as a transplant containing a population of hematopoietic stem cells.
- administered to a recipient may be, e.g., autologous, syngeneic, or allogeneic cells.
- sample refers to a specimen (e.g., blood, blood component (e.g., serum or plasma), urine, saliva, amniotic fluid, cerebrospinal fluid, tissue (e.g., placental or dermal), pancreatic fluid, chorionic villus sample, and cells) taken from a subject.
- a specimen e.g., blood, blood component (e.g., serum or plasma), urine, saliva, amniotic fluid, cerebrospinal fluid, tissue (e.g., placental or dermal), pancreatic fluid, chorionic villus sample, and cells
- scFv refers to a single chain Fv antibody in which the variable domains of the heavy chain and the light chain from an antibody have been joined to form one chain.
- scFv fragments contain a single polypeptide chain that includes the variable region of an antibody light chain (V L ) (e.g., CDR-L1 , CDR-L2, and/or CDR-L3) and the variable region of an antibody heavy chain (V H ) (e.g., CDR-H1 , CDR-H2, and/or CDR-H3) separated by a linker.
- V L variable region of an antibody light chain
- V H variable region of an antibody heavy chain
- the linker that joins the V L and V H regions of a scFv fragment can be a peptide linker composed of proteinogenic amino acids.
- linkers can be used to so as to increase the resistance of the scFv fragment to proteolytic degradation (for example, linkers containing D-amino acids), in order to enhance the solubility of the scFv fragment (for example, hydrophilic linkers such as polyethylene glycol-containing linkers or polypeptides containing repeating glycine and serine residues), to improve the biophysical stability of the molecule (for example, a linker containing cysteine residues that form intramolecular or intermolecular disulfide bonds), or to attenuate the immunogenicity of the scFv fragment (for example, linkers containing glycosylation sites).
- linkers containing D-amino acids for example, hydrophilic linkers such as polyethylene glycol-containing linkers or polypeptides containing repeating glycine and serine residues
- hydrophilic linkers such as polyethylene glycol-containing linkers or polypeptides containing repeating glycine and serine residues
- variable regions of the scFv molecules described herein can be modified such that they vary in amino acid sequence from the antibody molecule from which they were derived.
- nucleotide or amino acid substitutions leading to conservative substitutions or changes at amino acid residues can be made (e.g., in CDR and/or framework residues) so as to preserve or enhance the ability of the scFv to bind to the antigen recognized by the corresponding antibody.
- telomere binding refers to the ability of an antibody to recognize and bind to a specific protein structure (epitope) rather than to proteins generally. If an antibody is specific for epitope "A", the presence of a molecule containing epitope A (or free, unlabeled A), in a reaction containing labeled "A” and the antibody, will reduce the amount of labeled A bound to the antibody. By way of example, an antibody “binds specifically" to a target if the antibody, when labeled, can be competed away from its target by the corresponding non-labeled antibody.
- an antibody specifically binds to a target, e.g., CD1 17, if the antibody has a K D for the target of at least about 10 "4 M, 10 "5 M, 10 “6 M, 10 “7 M, 10 “8 M, 10 “9 M, 10 "10 M, 10 "11 M, 10 "12 M, or less (less meaning a number that is less than 10 "12 , e.g. 10 "13 ).
- K D (M) is determined according to standard bio-layer interferometery (BLI).
- K off (1 /s) is determined according to standard bio-layer interferometery (BLI).
- the antibody may be capable of specifically binding to two or more antigens which are related in sequence.
- an antibody can specifically bind to both human and a non-human (e.g., mouse or non-human primate) orthologs of CD1 17.
- the terms “subject” and “patient” refer to an organism, such as a human, that receives treatment for a particular disease or condition as described herein.
- a patient such as a human patient, may receive treatment prior to hematopoietic stem cell transplant therapy in order to promote the engraftment of exogenous hematopoietic stem cells.
- ELISA-based detection assays known in the art or described herein. Additional assays that can be used to detect antibodies, or antibody fragments, include immunoprecipitation techniques and immunoblot assays, among others known in the art.
- stem cell disorder broadly refers to any disease, disorder, or condition that may be treated or cured by conditioning a subject's target tissues, and/or by ablating an endogenous stem cell population in a target tissue (e.g., ablating an endogenous hematopoietic stem or progenitor cell population from a subject's bone marrow tissue) and/or by engrafting or transplanting stem cells in a subject's target tissues.
- a target tissue e.g., ablating an endogenous hematopoietic stem or progenitor cell population from a subject's bone marrow tissue
- stem cells in a subject's target tissues e.g., ablating an endogenous hematopoietic stem or progenitor cell population from a subject's bone marrow tissue
- Type I diabetes has been shown to be cured by hematopoietic stem cell transplant and may benefit from conditioning in accordance with the compositions and methods described herein.
- Additional disorders that can be treated using the compositions and methods described herein include, without limitation, sickle cell anemia, thalassemias, Fanconi anemia, aplastic anemia, Wiskott-Aldrich syndrome, ADA SCID, HIV/AIDS, metachromatic leukodystrophy, Diamond-Blackfan anemia, and Schwachman-Diamond syndrome.
- Additional diseases that may be treated using the patient conditioning and/or hematopoietic stem cell transplant methods described herein include inherited blood disorders (e.g., sickle cell anemia) and autoimmune disorders, such as scleroderma, multiple sclerosis, ulcerative colitis, and Crohn's disease.
- Additional diseases that may be treated using the conditioning and/or transplantation methods described herein include a malignancy, such as a neuroblastoma or a hematologic cancer, such as leukemia, lymphoma, and myeloma.
- the cancer may be acute myeloid leukemia, acute lymphoid leukemia, chronic myeloid leukemia, chronic lymphoid leukemia, multiple myeloma, diffuse large B-cell lymphoma, or non- Hodgkin's lymphoma.
- Additional diseases treatable using the conditioning and/or transplantation methods described herein include myelodysplastic syndrome.
- the subject has or is otherwise affected by a metabolic storage disorder.
- the subject may suffer or otherwise be affected by a metabolic disorder selected from the group consisting of glycogen storage diseases, mucopolysaccharidoses, Gaucher's Disease, Hurlers Disease,
- sphingolipidoses metachromatic leukodystrophy, or any other diseases or disorders which may benefit from the treatments and therapies disclosed herein and including, without limitation, severe combined immunodeficiency, Wiscott-Aldrich syndrome, hyper immunoglobulin M (IgM) syndrome, Chediak-Higashi disease, hereditary lymphohistiocytosis, osteopetrosis, osteogenesis imperfecta, storage diseases, thalassemia major, sickle cell disease, systemic sclerosis, systemic lupus erythematosus, multiple sclerosis, juvenile rheumatoid arthritis and those diseases, or disorders described in "Bone Marrow Transplantation for Non-Malignant Disease," ASH Education Book, 1 :319-338 (2000), the disclosure of which is incorporated herein by reference in its entirety as it pertains to pathologies that may be treated by administration of hematopoietic stem cell transplant therapy.
- IgM hyper immunoglobulin M
- transfection refers to any of a wide variety of techniques commonly used for the introduction of exogenous DNA into a prokaryotic or eukaryotic host cell, such as electroporation, lipofection, calcium- phosphate precipitation, DEAE- dextran transfection and the like.
- the terms “treat” or “treatment” refers to reducing the severity and/or frequency of disease symptoms, eliminating disease symptoms and/or the underlying cause of said symptoms, reducing the frequency or likelihood of disease symptoms and/or their underlying cause, and improving or remediating damage caused, directly or indirectly, by disease.
- Beneficial or desired clinical results include, but are not limited to, promoting the engraftment of exogenous hematopoietic cells in a patient following antibody conditioning therapy as described herein and subsequent hematopoietic stem cell transplant therapy. Additional beneficial results include an increase in the cell count or relative concentration of hematopoietic stem cells in a patient in need of a hematopoietic stem cell transplant following conditioning therapy and subsequent
- Beneficial results of therapy described herein may also include an increase in the cell count or relative concentration of one or more cells of hematopoietic lineage, such as a megakaryocyte, thrombocyte, platelet, erythrocyte, mast cell, myeloblast, basophil, neutrophil, eosinophil, microglial cell, granulocyte, monocyte, osteoclast, antigen-presenting cell, macrophage, dendritic cell, natural killer cell, T- lymphocyte, or B-lymphocyte, following conditioning therapy and subsequent hematopoietic stem cell transplant therapy.
- hematopoietic lineage such as a megakaryocyte, thrombocyte, platelet, erythrocyte, mast cell, myeloblast, basophil, neutrophil, eosinophil, microglial cell, granulocyte, monocyte, osteoclast, antigen-presenting cell, macrophage, dendritic cell, natural killer cell, T- lymphocyte, or B-lymphocyte, following conditioning
- Additional beneficial results may include the reduction in quantity of a disease-causing cell population, such as a population of cancer cells (e.g., CD1 17+ leukemic cells) or autoimmune cells (e.g., CD1 17+ autoimmune lymphocytes, such as a CD1 17+ T-cell that expresses a T-cell receptor that cross-reacts with a self-antigen).
- a disease-causing cell population such as a population of cancer cells (e.g., CD1 17+ leukemic cells) or autoimmune cells (e.g., CD1 17+ autoimmune lymphocytes, such as a CD1 17+ T-cell that expresses a T-cell receptor that cross-reacts with a self-antigen).
- cancer cells e.g., CD1 17+ leukemic cells
- autoimmune cells e.g., CD1 17+ autoimmune lymphocytes, such as a CD1 17+ T-cell that expresses a T-cell receptor that cross-reacts with
- the term preventing refers to the ability of the skilled artisan to identify a population that is susceptible to disorders, such that administration of the compounds of the present invention may occur prior to onset of a disease. The term does not imply that the disease state is completely avoided.
- variants and “derivative” are used interchangeably and refer to naturally-occurring, synthetic, and semi-synthetic analogues of a compound, peptide, protein, or other substance described herein.
- a variant or derivative of a compound, peptide, protein, or other substance described herein may retain or improve upon the biological activity of the original material.
- vector includes a nucleic acid vector, such as a plasrnid, a DNA vector, a plasrnid, a RNA vector, virus, or other suitable replicon.
- Expression vectors described herein may contain a polynucleotide sequence as well as, for example, additional sequence elements used for the expression of proteins and/or the integration of these polynucleotide sequences into the genome of a mammalian cell.
- Certain vectors that can be used for the expression of antibodies and antibody fragments of the invention include plasmids that contain regulatory sequences, such as promoter and enhancer regions, which direct gene transcription.
- kits for expression of antibodies and antibody fragments contain polynucleotide sequences that enhance the rate of translation of these genes or improve the stability or nuclear export of the mRNA that results from gene transcription. These sequence elements may include, for example, 5' and 3' untranslated regions and a polyadenylation signal site in order to direct efficient transcription of the gene carried on the expression vector.
- the expression vectors described herein may also contain a polynucleotide encoding a marker for selection of cells that contain such a vector. Examples of a suitable marker include genes that encode resistance to antibiotics, such as ampicillin, chloramphenicol, kanamycin, and nourseothricin.
- R is hydrogen (“aldehyde”), alkyl, alkenyl, alkynyl, carbocyclyl, aryl, heteroaryl, or heterocyclyl, as defined herein.
- Non-limiting examples include formyl, acetyl, propanoyl, benzoyl, and acryloyl.
- alkyl refers to a straight- or branched-chain alkyl group having, for example, from 1 to 20 carbon atoms in the chain.
- alkyl groups include methyl, ethyl, n-propyl, isopropyl, butyl, isobutyl, sec-butyl, tert-butyl, pentyl, isopentyl, tert-pentyl, hexyl, isohexyl, and the like.
- alkylene refers to a straight- or branched-chain divalent alkyl group.
- the divalent positions may be on the same or different atoms within the alkyl chain.
- alkylene examples include methylene, ethylene, propylene, isopropylene, and the like.
- heteroalkyl refers to a straight or branched-chain alkyl group having, for example, from 1 to 20 carbon atoms in the chain, and further containing one or more heteroatoms (e.g., oxygen, nitrogen, or sulfur, among others) in the chain.
- heteroalkylene refers to a straight- or branched-chain divalent heteroalkyl group.
- the divalent positions may be on the same or different atoms within the heteroalkyl chain.
- the divalent positions may be one or more heteroatoms.
- alkenyl refers to a straight- or branched-chain alkenyl group having, for example, from 2 to 20 carbon atoms in the chain.
- alkenyl groups include vinyl, propenyl, isopropenyl, butenyl, tert-butylenyl, hexenyl, and the like.
- alkenylene refers to a straight- or branched-chain divalent alkenyl group. The divalent positions may be on the same or different atoms within the alkenyl chain. Examples of alkenylene include ethenylene, propenylene, isopropenylene, butenylene, and the like.
- heteroalkenyl refers to a straight- or branched-chain alkenyl group having, for example, from 2 to 20 carbon atoms in the chain, and further containing one or more heteroatoms (e.g., oxygen, nitrogen, or sulfur, among others) in the chain.
- heteroalkenylene refers to a straight- or branched-chain divalent heteroalkenyl group.
- the divalent positions may be on the same or different atoms within the heteroalkenyl chain.
- the divalent positions may be one or more heteroatoms.
- alkynyl refers to a straight- or branched-chain alkynyl group having, for example, from 2 to 20 carbon atoms in the chain.
- alkynyl groups include propargyl, butynyl, pentynyl, hexynyl, and the like.
- alkynylene refers to a straight- or branched-chain divalent alkynyl group. The divalent positions may be on the same or different atoms within the alkynyl chain.
- heteroalkynyl refers to a straight- or branched-chain alkynyl group having, for example, from 2 to 20 carbon atoms in the chain, and further containing one or more heteroatoms (e.g., oxygen, nitrogen, or sulfur, among others) in the chain.
- heteroalkynylene refers to a straight- or branched-chain divalent heteroalkynyl group.
- the divalent positions may be on the same or different atoms within the heteroalkynyl chain.
- the divalent positions may be one or more heteroatoms.
- cycloalkyi refers to a monocyclic, or fused, bridged, or spiro polycyclic ring structure that is saturated and has, for example, from 3 to 12 carbon ring atoms.
- cycloalkyi groups include cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, cyclooctyl, bicyclo[3.1 .0]hexane, and the like.
- cycloalkylene refers to a divalent cycloalkyi group.
- the divalent positions may be on the same or different atoms within the ring structure. Examples of
- cycloalkylene include cyclopropylene, cyclobutylene, cyclopentylene, cyclohexylene, and the like.
- heterocyloalkyl refers to a monocyclic, or fused, bridged, or spiro polycyclic ring structure that is saturated and has, for example, from 3 to 12 ring atoms per ring structure selected from carbon atoms and heteroatoms selected from, e.g., nitrogen, oxygen, and sulfur, among others.
- the ring structure may contain, for example, one or more oxo groups on carbon, nitrogen, or sulfur ring members.
- heterocycloalkyls include by way of example and not limitation dihydroypyridyl, tetrahydropyridyl (piperidyl), tetrahydrothiophenyl, piperidinyl, 4-piperidonyl, pyrrolidinyl, 2-pyrrolidonyl, tetrahydrofuranyl, tetrahydropyranyl, bis- tetrahydropyranyl, tetrahydroquinolinyl, tetrahydroisoquinolinyl, decahydroquinolinyl,
- heterocycloalkylene refers to a divalent heterocyclolalkyl group.
- the divalent positions may be on the same or different atoms within the ring structure.
- aryl refers to a monocyclic or multicyclic aromatic ring system containing, for example, from 6 to 19 carbon atoms.
- Aryl groups include, but are not limited to, phenyl, fluorenyl, naphthyl, and the like. The divalent positions may be one or more heteroatoms.
- arylene refers to a divalent aryl group.
- the divalent positions may be on the same or different atoms.
- heteroaryl refers to a monocyclic heteroaromatic, or a bicyclic or a tricyclic fused-ring heteroaromatic group in which one or more ring atoms is a heteroatom, e.g. nitrogen, oxygen, or sulfur.
- Heteroaryl groups include pyridyl, pyrrolyl, furyl, thienyl, imidazolyl, oxazolyl, isoxazolyl, thiazolyl, isothiazolyl, pyrazolyl, 1 ,2,3-triazolyl, 1 ,2,4-triazolyl, 1 ,2,3- oxadiazolyl, 1 ,2,4-oxadia-zolyl, 1 ,2,5-oxadiazolyl, 1 ,3,4-oxadiazolyl, 1 ,3,4-triazinyl, 1 ,2,3-triazinyl, benzofuryl, [2,3-dihydro]benzofuryl, isobenzofuryl, benzothienyl, benzotriazolyl, isobenzothienyl, indolyl, isoindolyl, 3H-indolyl, benzimidazolyl, imidazo[1
- heteroarylene refers to a divalent heteroaryl group.
- the divalent positions may be on the same or different atoms.
- the divalent positions may be one or more heteroatoms.
- alkenylene "heteroalkenyl”, “heteroalkenylene”, “alkynyl”, “alkynylene”, “heteroalkynyl”,
- heteroalkynylene can optionally be substituted with, for example, from 1 to 5 substituents selected from the group consisting of alkyl, alkenyl, alkynyl, cycloalkyl, heterocycloalkyl, alkyl aryl, alkyl heteroaryl, alkyl cycloalkyl, alkyl heterocycloalkyl, amino, ammonium, acyl, acyloxy, acylamino, aminocarbonyl, alkoxycarbonyl, ureido, carbamate, aryl, heteroaryl, sulfinyl, sulfonyl, alkoxy, sulfanyl, halogen, carboxy, trihalomethyl, cyano, hydroxy, mercapto
- substitution may include situations in which neighboring substituents have undergone ring closure, such as ring closure of vicinal functional substituents, to form, for instance, lactams, lactones, cyclic
- anhydrides acetals, hemiacetals, thioacetals, aminals, and hemiaminals, formed by ring closure, for example, to furnish a protecting group.
- radical naming conventions can include either a mono- radical or a di-radical, depending on the context.
- a substituent requires two points of attachment to the rest of the molecule, it is understood that the substituent is a di-radical.
- a substituent identified as alkyl that requires two points of attachment includes di- radicals such as -CH 2 -, -CH 2 CH 2 -, -CH 2 CH(CI-l3)CI-l2-, and the like.
- Other radical naming conventions clearly indicate that the radical is a di-radical such as "alkylene,” “alkenylene,” “arylene,” “heterocycloalkylene,” and the like.
- the present invention is based in part on the discovery that antibodies, or antigen-binding fragments thereof, capable of binding CD1 17, such as GNNK+ CD1 17, can be used as therapeutic agents alone or as conjugates (ADCs) to, for example, (i) treat cancers and autoimmune diseases characterized by CD1 17+ cells and (ii) promote the engraftment of transplanted hematopoietic stem cells in a patient in need of transplant therapy.
- ADCs conjugates
- These therapeutic activities can be caused, for instance, by the binding of isolated anti-CD1 17 antibodies, antigen-binding fragments thereof, that bind to CD1 17 (e.g., GNNK+ CD1 17) expressed on the surface of a cell, such as a cancer cell, autoimmune cell, or hematopoietic stem cell and subsequently inducing cell death.
- CD1 17 e.g., GNNK+ CD1 17
- the depletion of endogenous hematopoietic stem cells can provide a niche toward which transplanted hematopoietic stem cells can home, and subsequently establish productive hematopoiesis. In this way, transplanted hematopoietic stem cells may successfully engraft in a patient, such as human patient suffering from a stem cell disorder described herein.
- Antibodies and antigen-binding fragments capable of binding human CD1 17 can be used in conjunction with the compositions and methods described herein in order to condition a patient for
- CD1 17 Polymorphisms affecting the coding region or extracellular domain of CD1 17 in a significant percentage of the population are not currently well- known in non-oncology indications.
- Two of the CD1 17 isoforms are located on the intracellular domain of the protein, and two are present in the external juxtamembrane region.
- the two extracellular isoforms, GNNK+ and GNNK- differ in the presence (GNNK+) or absence (GNNK-) of a 4 amino acid sequence.
- the GNNK+ isoform can be used as an immunogen in order to generate antibodies capable of binding CD1 17, as antibodies generated against this isoform will be inclusive of the GNNK+ and GNNK- proteins.
- the amino acid sequences of human CD1 17 isoforms 1 and 2 are described in SEQ ID Nos: 145 and 146, respectively.
- anti-human CD1 17 (hCD1 17) antibodies disclosed herein are able to bind to both isoform 1 and isoform 2 of human CD1 17.
- yeast library screen of human antibodies was performed to identify novel anti-CD1 17 antibodies, and fragments thereof, having diagnostic and therapeutic use.
- Antibody 54 (Ab54), Antibody 55 (Ab55), Antibody 56 (Ab56), Antibody 57 (Ab57), Antibody 58 (Ab58), Antibody 61 (Ab61 ), Antibody 66 (Ab66), Antibody 67 (Ab67), Antibody 68 (Ab68), and Antibody 69 (Ab69) were human antibodies that were identified in this screen. These antibodies cross react with human CD1 17 and rhesus CD1 17. Further, these antibodies disclosed herein are able to bind to both isoforms of human CD1 17, i.e., isoform 1 (SEQ ID NO: 145) and isoform 2 (SEQ ID NO: 146).
- anti-CD1 17 antibodies Ab54, Ab55, Ab56, Ab57, Ab58, Ab61 , Ab66, Ab67, Ab68, and Ab69 are described in Table 10. Included in the invention are human anti-CD1 17 antibodies comprising the CDRs as set forth in Table 10, as well as human anti-CD1 17 antibodies comprising the variable regions set forth in Table 10.
- the invention provides an anti-CD1 17 antibody, or antigen-binding fragment thereof, comprising binding regions, e.g., CDRs, variable regions, corresponding to those of Antibody 55.
- the heavy chain variable region (VH) amino acid sequence of Antibody 55 i.e., Ab55
- the VH CDR domain amino acid sequences of Antibody 55 are set forth in SEQ ID NO: 21 (VH CDR1 ); SEQ ID NO: 22 (VH CDR2), and SEQ ID NO: 23 (VH CDR3).
- the light chain variable region (VL) amino acid sequence of Antibody 55 is described in SEQ ID NO: 20 (see Table 10).
- an anti-CD1 17 antibody, or antigen-binding portion thereof comprises a variable heavy chain CDR set (CDR1 , CDR2, and CDR3) as set forth in SEQ ID Nos: 21 , 22, and 23, and a light chain variable region CDR set as set forth in SEQ ID Nos: 24, 25, and 26.
- an anti-CD1 17 antibody, or antigen-binding portion thereof comprises a variable light chain comprising the amino acid residues set forth in SEQ ID NO: 20, and a heavy chain variable region as set forth in SEQ ID NO: 19.
- the invention provides an anti-CD1 17 antibody, or antigen-binding fragment thereof, comprising binding regions, e.g., CDRs, variable regions, corresponding to those of Antibody 54.
- the heavy chain variable region (VH) amino acid sequence of Antibody 54 i.e., Ab54
- the VH CDR domain amino acid sequences of Antibody 54 are set forth in SEQ ID NO: 31 (VH CDR1 ); SEQ ID NO: 32 (VH CDR2), and SEQ ID NO: 33 (VH CDR3).
- the light chain variable region (VL) amino acid sequence of Antibody 54 is described in SEQ ID NO: 30 (see Table 10).
- VL CDR domain amino acid sequences of Antibody 54 are set forth in SEQ ID NO: 34 (VL CDR1 ); SEQ ID NO: 35 (VL CDR2), and SEQ ID NO: 36 (VL CDR3).
- the heavy chain constant region of Antibody 54 is set forth in SEQ ID NO: 122.
- the light chain constant region of Antibody 54 is set forth in SEQ ID NO: 121 .
- an anti-CD1 17 antibody, or antigen-binding portion thereof comprises a variable heavy chain CDR set (CDR1 , CDR2, and CDR3) as set forth in SEQ ID Nos: 31 , 32, and 33, and a light chain variable region CDR set as set forth in SEQ ID Nos: 34, 35, and 36.
- an anti-CD1 17 antibody, or antigen-binding portion thereof comprises a variable light chain comprising the amino acid residues set forth in SEQ ID NO: 30, and a heavy chain variable region as set forth in SEQ ID NO: 29.
- the invention provides an anti-CD1 17 antibody, or antigen-binding fragment thereof, comprising binding regions, e.g., CDRs, variable regions, corresponding to those of Antibody 56.
- the heavy chain variable region (VH) amino acid sequence of Antibody 56 i.e., Ab56
- the VH CDR domain amino acid sequences of Antibody 56 are set forth in SEQ ID NO: 41 (VH CDR1 ); SEQ ID NO: 42 (VH CDR2), and SEQ ID NO: 43 (VH CDR3).
- the light chain variable region (VL) amino acid sequence of Antibody 56 is described in SEQ ID NO: 40 (see Table 10).
- VL CDR domain amino acid sequences of Antibody 56 are set forth in SEQ ID NO: 44 (VL CDR1 ); SEQ ID NO: 45 (VL CDR2), and SEQ ID NO: 46 (VL CDR3).
- the heavy chain constant region of Antibody 56 is set forth in SEQ ID NO: 122.
- the light chain constant region of Antibody 56 is set forth in SEQ ID NO: 121 .
- an anti-CD1 17 antibody, or antigen-binding portion thereof comprises a variable heavy chain CDR set (CDR1 , CDR2, and CDR3) as set forth in SEQ ID Nos: 41 , 42, and 43, and a light chain variable region CDR set as set forth in SEQ ID Nos: 44, 45, and 46.
- an anti-CD1 17 antibody, or antigen-binding portion thereof comprises a variable light chain comprising the amino acid residues set forth in SEQ ID NO: 40, and a heavy chain variable region as set forth in SEQ ID NO: 39.
- the invention provides an anti-CD1 17 antibody, or antigen-binding fragment thereof, comprising binding regions, e.g., CDRs, variable regions, corresponding to those of Antibody 57.
- the heavy chain variable region (VH) amino acid sequence of Antibody 57 i.e., Ab57
- the VH CDR domain amino acid sequences of Antibody 57 are set forth in SEQ ID NO: 51 (VH CDR1 ); SEQ ID NO: 52 (VH CDR2), and SEQ ID NO: 53 (VH CDR3).
- the light chain variable region (VL) amino acid sequence of Antibody 57 is described in SEQ ID NO: 50 (see Table 10).
- VL CDR domain amino acid sequences of Antibody 57 are set forth in SEQ ID NO: 54 (VL CDR1 ); SEQ ID NO: 55 (VL CDR2), and SEQ ID NO: 56 (VL CDR3).
- the heavy chain constant region of Antibody 57 is set forth in SEQ ID NO: 122.
- the light chain constant region of Antibody 57 is set forth in SEQ ID NO: 121 .
- an anti-CD1 17 antibody, or antigen-binding portion thereof comprises a variable heavy chain CDR set (CDR1 , CDR2, and CDR3) as set forth in SEQ ID Nos: 51 , 52, and 53, and a light chain variable region CDR set as set forth in SEQ ID Nos: 54, 55, and 56.
- an anti-CD1 17 antibody, or antigen-binding portion thereof comprises a variable light chain comprising the amino acid residues set forth in SEQ ID NO: 50, and a heavy chain variable region as set forth in SEQ ID NO: 49.
- the invention provides an anti-CD1 17 antibody, or antigen-binding fragment thereof, comprising binding regions, e.g., CDRs, variable regions, corresponding to those of Antibody 58.
- the heavy chain variable region (VH) amino acid sequence of Antibody 58 i.e., Ab58
- SEQ ID NO: 59 see Table 10
- the VH CDR domain amino acid sequences of Antibody 58 are set forth in SEQ ID NO: 61 (VH CDR1 ); SEQ ID NO: 62 (VH CDR2), and SEQ ID NO: 63 (VH CDR3).
- the light chain variable region (VL) amino acid sequence of Antibody 58 is described in SEQ ID NO: 60 (see Table 10).
- VL CDR domain amino acid sequences of Antibody 58 are set forth in SEQ ID NO: 64 (VL CDR1 ); SEQ ID NO: 65 (VL CDR2), and SEQ ID NO: 66 (VL CDR3).
- the heavy chain constant region of Antibody 58 is set forth in SEQ ID NO: 122.
- the light chain constant region of Antibody 58 is set forth in SEQ ID NO: 121 .
- an anti-CD1 17 antibody, or antigen-binding portion thereof comprises a variable heavy chain CDR set (CDR1 , CDR2, and CDR3) as set forth in SEQ ID Nos: 61 , 62, and 63, and a light chain variable region CDR set as set forth in SEQ ID Nos: 64, 65, and 66.
- an anti-CD1 17 antibody, or antigen-binding portion thereof comprises a variable light chain comprising the amino acid residues set forth in SEQ ID NO: 60, and a heavy chain variable region as set forth in SEQ ID NO: 59.
- the invention provides an anti-CD1 17 antibody, or antigen-binding fragment thereof, comprising binding regions, e.g., CDRs, variable regions, corresponding to those of Antibody 61 .
- the heavy chain variable region (VH) amino acid sequence of Antibody 61 i.e., Ab61
- the VH CDR domain amino acid sequences of Antibody 61 are set forth in SEQ ID NO: 71 (VH CDR1 ); SEQ ID NO: 72 (VH CDR2), and SEQ ID NO: 73 (VH CDR3).
- the light chain variable region (VL) amino acid sequence of Antibody 61 is described in SEQ ID NO: 70 (see Table 10).
- VL CDR domain amino acid sequences of Antibody 61 are set forth in SEQ ID NO: 74 (VL CDR1 ); SEQ ID NO: 75 (VL CDR2), and SEQ ID NO: 76 (VL CDR3).
- the heavy chain constant region of Antibody 61 is set forth in SEQ ID NO: 122.
- the light chain constant region of Antibody 61 is set forth in SEQ ID NO: 121 .
- an anti-CD1 17 antibody, or antigen-binding portion thereof comprises a variable heavy chain CDR set (CDR1 , CDR2, and CDR3) as set forth in SEQ ID Nos: 71 , 72, and 73, and a light chain variable region CDR set as set forth in SEQ ID Nos: 74, 75, and 76.
- an anti-CD1 17 antibody, or antigen-binding portion thereof comprises a variable light chain comprising the amino acid residues set forth in SEQ ID NO: 70, and a heavy chain variable region as set forth in SEQ ID NO: 69.
- the invention provides an anti-CD1 17 antibody, or antigen-binding fragment thereof, comprising binding regions, e.g., CDRs, variable regions, corresponding to those of Antibody 66.
- the heavy chain variable region (VH) amino acid sequence of Antibody 66 i.e., Ab66
- the VH CDR domain amino acid sequences of Antibody 66 are set forth in SEQ ID NO: 81 (VH CDR1 ); SEQ ID NO: 82 (VH CDR2), and SEQ ID NO: 83 (VH CDR3).
- the light chain variable region (VL) amino acid sequence of Antibody 66 is described in SEQ ID NO: 80 (see Table 10).
- VL CDR domain amino acid sequences of Antibody 66 are set forth in SEQ ID NO: 84 (VL CDR1 ); SEQ ID NO: 85 (VL CDR2), and SEQ ID NO: 86 (VL CDR3).
- the heavy chain constant region of Antibody 66 is set forth in SEQ ID NO: 122.
- the light chain constant region of Antibody 66 is set forth in SEQ ID NO: 121 .
- an anti-CD1 17 antibody, or antigen-binding portion thereof comprises a variable heavy chain CDR set (CDR1 , CDR2, and CDR3) as set forth in SEQ ID Nos: 81 , 82, and 83, and a light chain variable region CDR set as set forth in SEQ ID Nos: 84, 85, and 86.
- an anti-CD1 17 antibody, or antigen-binding portion thereof comprises a variable light chain comprising the amino acid residues set forth in SEQ ID NO: 80, and a heavy chain variable region as set forth in SEQ ID NO: 79.
- the invention provides an anti-CD1 17 antibody, or antigen-binding fragment thereof, comprising binding regions, e.g., CDRs, variable regions, corresponding to those of Antibody 67.
- the heavy chain variable region (VH) amino acid sequence of Antibody 67 is set forth in SEQ ID NO: 9 (see Table 2).
- the VH CDR domain amino acid sequences of Antibody 67 are set forth in SEQ ID NO 1 1 (VH CDR1 ); SEQ ID NO: 12 (VH CDR2), and SEQ ID NO: 13 (VH CDR3).
- the light chain variable region (VL) amino acid sequence of Antibody 67 is described in SEQ ID NO: 10 (see Table 2).
- the VL CDR domain amino acid sequences of Antibody 67 are set forth in SEQ ID NO 14 (VL CDR1 ); SEQ ID NO: 15 (VL CDR2), and SEQ ID NO: 16 (VL CDR3).
- the full length heavy chain (HC) of Antibody 67 is set forth in SEQ ID NO: 1 10
- the full length heavy chain constant region of Antibody 67 is set forth in SEQ ID NO: 122.
- the light chain (LC) of Antibody 67 is set forth in SEQ ID NO: 109.
- the light chain constant region of Antibody 67 is set forth in SEQ ID NO: 121 .
- an anti-CD1 17 antibody, or antigen- binding portion thereof comprises a variable heavy chain CDR set (CDR1 , CDR2, and CDR3) as set forth in SEQ ID Nos: 1 1 , 12, and 13, and a light chain variable region CDR set as set forth in SEQ ID Nos: 14, 15, and 16.
- an anti-CD1 17 antibody, or antigen-binding portion thereof comprises a variable heavy chain comprising the amino acid residues set forth in SEQ ID NO: 9, and a heavy chain variable region as set forth in SEQ ID NO: 10.
- an anti-CD1 17 antibody comprises a heavy chain comprising SEQ ID NO: 1 10 and a light chain comprising SEQ ID NO: 109.
- the invention provides an anti-CD1 17 antibody, or antigen-binding fragment thereof, comprising binding regions, e.g., CDRs, variable regions, corresponding to those of Antibody 68.
- the heavy chain variable region (VH) amino acid sequence of Antibody 68 i.e., Ab68
- SEQ ID NO: 89 see Table 10
- the VH CDR domain amino acid sequences of Antibody 68 are set forth in SEQ ID NO: 91 (VH CDR1 ); SEQ ID NO: 92 (VH CDR2), and SEQ ID NO: 93 (VH CDR3).
- the light chain variable region (VL) amino acid sequence of Antibody 68 is described in SEQ ID NO: 90 (see Table 10).
- VL CDR domain amino acid sequences of Antibody 68 are set forth in SEQ ID NO: 94 (VL CDR1 ); SEQ ID NO: 95 (VL CDR2), and SEQ ID NO: 96 (VL CDR3).
- the heavy chain constant region of Antibody 68 is set forth in SEQ ID NO: 122.
- the light chain constant region of Antibody 68 is set forth in SEQ ID NO: 121 .
- an anti-CD1 17 antibody, or antigen-binding portion thereof comprises a variable heavy chain CDR set (CDR1 , CDR2, and CDR3) as set forth in SEQ ID Nos: 91 , 92, and 93, and a light chain variable region CDR set as set forth in SEQ ID Nos: 94, 95, and 96.
- an anti-CD1 17 antibody, or antigen-binding portion thereof comprises a variable light chain comprising the amino acid residues set forth in SEQ ID NO: 90, and a heavy chain variable region as set forth in SEQ ID NO: 89.
- the invention provides an anti-CD1 17 antibody, or antigen-binding fragment thereof, comprising binding regions, e.g., CDRs, variable regions, corresponding to those of Antibody 69.
- the heavy chain variable region (VH) amino acid sequence of Antibody 69 i.e., Ab69
- SEQ ID NO: 99 see Table 10
- the VH CDR domain amino acid sequences of Antibody 69 are set forth in SEQ ID NO: 101 (VH CDR1 ); SEQ ID NO: 102 (VH CDR2), and SEQ ID NO: 103 (VH CDR3).
- Antibody 69 is described in SEQ ID NO: 100 (see Table 10).
- the VL CDR domain amino acid sequences of Antibody 69 are set forth in SEQ ID NO: 104 (VL CDR1 ); SEQ ID NO: 105 (VL CDR2), and SEQ ID NO: 106 (VL CDR3).
- the heavy chain constant region of Antibody 69 is set forth in SEQ ID NO: 122.
- the light chain constant region of Antibody 69 is set forth in SEQ ID NO: 121 .
- an anti-CD1 17 antibody, or antigen-binding portion thereof comprises a variable heavy chain CDR set (CDR1 , CDR2, and CDR3) as set forth in SEQ ID Nos: 101 , 102, and 103, and a light chain variable region CDR set as set forth in SEQ ID Nos: 104, 105, and 106.
- an anti-CD1 17 antibody, or antigen-binding portion thereof comprises a variable light chain comprising the amino acid residues set forth in SEQ ID NO: 100, and a heavy chain variable region as set forth in SEQ ID NO: 99.
- anti-CD1 17 antibodies described herein are neutral antibodies, in that the antibodies do not substantially inhibit CD1 17 activity on a CD1 17 expressing cell.
- Neutral antibodies can be identified using, for example, an in in vitro stem cell factor (SCF)-dependent cell proliferation assay (see, e.g., Example 1 1 described herein).
- SCF stem cell factor
- a neutral CD1 17 antibody will not kill CD34+ cells that are dependent on SCF to divide, as a neutral antibody will not block SCF from binding to CD1 17 such as to inhibit CD1 17 activity.
- Neutral antibodies can be used for diagnostic purposes, given their ability to specifically bind to human CD1 17, but are also effective for killing CD1 17 expressing cells when conjugated to a cytotoxin, such as those described herein.
- antibodies used in conjugates have agonistic or antagonistic activity that is unique to the antibody. Described herein, however, is a unique approach to conjugates, especially in the context wherein the conjugate is being used as a conditioning agent prior to a stem cell transplantation.
- cytotoxin While antagonistic antibodies alone or in combination with a cytotoxin as a conjugate can be effective given the killing ability of the antibody alone in addition to the cytotoxin, conditioning with a conjugate comprising a neutral anti-CD1 17 antibody presents an alternative strategy where the activity of the antibody is secondary to the effect of the cytotoxin, but the internalizing and affinity characteristics, e.g., dissociation rate, of the antibody are important for effective delivery of the cytotoxin.
- neutral anti-CD1 17 antibodies examples include Ab58, Ab61 , Ab66, Ab67, Ab68, and Ab69.
- a comparison of the amino acid sequences of the CDRs of neutral, anti-CD1 17 antibody CDRs reveals consensus sequences among two groups of neutral antibodies identified.
- a comparison of the heavy and light chain variable regions of Ab58 and Ab61 is described in Figs. 22a and 22b, respectively.
- Ab58 and Ab61 share the same light chain CDRs and HC CDR3, with slight variations in the HC CDR1 and HC CDR2. Consensus sequences for the HC CDR1 and CDR2 are described in SEQ ID Nos: 133 and 134.
- Ab66, Ab67, Ab68, and Ab69 are also neutral antibodies.
- Fig. 23A and Fig. 23B The heavy and light chain variable regions of these antibodies are described in Fig. 23A and Fig. 23B, respectively. While Ab66, Ab67, Ab68, and Ab69 share the same light chain CDRs and the same HC CDR3, these antibodies have variability within their HC CDR1 and HC CDR2 regions. Consensus sequences for these antibodies in the HC CDR1 and HC CDR2 regions are provided in SEQ ID Nos: 139 and 140, respectively.
- Antagonist antibodies are also provided herein, including Ab54, Ab55, Ab56, and Ab57.
- a comparison of the variable heavy and light chain amino acid sequences for these antibodies is provided in Figs. 21 A and 22B, respectively. While Ab54, Ab55, Ab56, and Ab57 share the same light chain CDRs and the same HC CDR3, these antibodies have variability within their HC CDR1 and HC CDR2 regions. Consensus sequences for these antibodies in the HC CDR1 and HC CDR2 regions are provided in SEQ ID Nos: 127 and 128, respectively.
- the anti-CD1 17 antibodies described herein can be in the form of full-length antibodies, bispecific antibodies, dual variable domain antibodies, multiple chain or single chain antibodies, and/or binding fragments that specifically bind human CD1 17, including but not limited to Fab, Fab', (Fab')2, Fv), scFv (single chain Fv), surrobodies (including surrogate light chain construct), single domain antibodies, camelized antibodies and the like. They also can be of, or derived from, any isotype, including, for example, IgA (e.g., lgA1 or lgA2), IgD, IgE, IgG (e.g.
- the anti-CD1 17 antibody is an IgG (e.g. lgG1 , lgG2, lgG3 or lgG4).
- Antibodies for use in conjunction with the methods described herein include variants of those antibodies described above, such as antibody fragments that contain or lack an Fc domain, as well as humanized variants of non-human antibodies described herein and antibody-like protein scaffolds (e.g., 10 Fn3 domains) containing one or more, or all, of the CDRs or equivalent regions thereof of an antibody, or antibody fragment, described herein.
- Exemplary antigen-binding fragments of the foregoing antibodies include a dual-variable immunoglobulin domain, a single- chain Fv molecule (scFv), a diabody, a triabody, a nanobody, an antibody-like protein scaffold, a Fv fragment, a Fab fragment, a F(ab') 2 molecule, and a tandem di-scFv, among others.
- scFv single-chain Fv molecule
- anti-CD1 17 antibodies comprising one or more radiolabeled amino acids are provided.
- a radiolabeled anti-CD1 17 antibody may be used for both diagnostic and therapeutic purposes (conjugation to radiolabeled molecules is another possible feature).
- Nonlimiting examples of labels for polypeptides include, but are not limited to 3H, 14C, 15N, 35S, 90Y, 99Tc, and 1251, 131 1, and 186Re.
- Methods for preparing radiolabeled amino acids and related peptide derivatives are known in the art (see for instance Junghans et al., in Cancer Chemotherapy and Biotherapy 655-686 (2d edition, Chafner and Longo, eds., Lippincott Raven (1996)) and U.S. Pat. No. 4,681 ,581 , U.S. Pat. No. 4,735,210, U.S. Pat. No. 5,101 ,827, U.S. Pat. No. 5,102,990 (U.S. RE35,500), U.S. Pat. No. 5,648,471 and U.S. Pat. No. 5,697,902.
- a radioisotope may be conjugated by a chloramine T method.
- anti-CD1 17 antibodies or binding fragments described herein may also include modifications and/or mutations that alter the properties of the antibodies and/or fragments, such as those that increase half-life, increase or decrease ADCC, etc., as is known in the art.
- the anti-CD1 17 antibody, or binding fragment thereof comprises a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region, such that said molecule has an altered affinity for an FcgammaR.
- Certain amino acid positions within the Fc region are known through crystallography studies to make a direct contact with FcvR. Specifically amino acids 234-239 (hinge region), amino acids 265-269 (B/C loop), amino acids 297-299 (C'/E loop), and amino acids 327-332 (F/G) loop, (see Sondermann et al., 2000 Nature, 406: 267-273).
- the anti-CD1 17 antibodies described herein may comprise variant Fc regions comprising modification of at least one residue that makes a direct contact with an Fey R based on structural and crystallographic analysis.
- the Fc region of the anti-CD1 17 antibody (or fragment thereof) comprises an amino acid substitution at amino acid 265 according to the EU index as in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, NH1 , MD (1991 ), expressly incorporated herein by references.
- the "EU index as in Kabat” refers to the numbering of the human lgG1 EU antibody.
- the EU index or EU index as in Kabat or EU numbering scheme refers to the numbering of the EU antibody (Edelman et al., 1969, Proc Natl Acad Sci USA 63:78-85, hereby entirely incorporated by reference.)
- the Fc region comprises a D265A mutation.
- the Fc region comprises a D265C mutation.
- the Fc region of the anti-CD1 17 antibody (or fragment thereof) comprises an amino acid substitution at amino acid 234 according to the EU index as in Kabat.
- the Fc region comprises a L234A mutation.
- the Fc region of the anti- CD1 17 antibody comprises an amino acid substitution at amino acid 235 according to the EU index as in Kabat.
- the Fc region comprises a L235A mutation.
- the Fc region comprises a L234A and L235A mutation .
- the Fc region comprises a D265C, L234A, and L235A mutation.
- a variant IgG Fc domain comprises one or more amino acid substitutions resulting in decreased or ablated binding affinity for an Fc.gamma.R and/or C1 q as compared to the wild type Fc domain not comprising the one or more amino acid substitutions.
- Fc binding interactions are essential for a variety of effector functions and downstream signaling events including, but not limited to, antibody dependent cell-mediated cytotoxicity (ADCC) and
- an antibody comprising a modified Fc region (e.g., comprising a L234A, L235A, and a D265C mutation) has substantially reduced or abolished effector functions.
- Affinity to an Fc region can be determined using a variety of techniques known in the art, for example but not limited to, equilibrium methods (e.g., enzyme-linked immunoabsorbent assay (ELISA); KinExA, Rathanaswami et al. Analytical Biochemistry, Vol. 373:52-60, 2008; or radioimmunoassay (RIA)), or by a surface plasmon resonance assay or other mechanism of kinetics-based assay (e.g., BIACORETM. analysis or OctetTM analysis (forteBIO)), and other methods such as indirect binding assays, competitive binding assays fluorescence resonance energy transfer (FRET), gel electrophoresis and chromatography (e.g., gel filtration).
- equilibrium methods e.g., enzyme-linked immunoabsorbent assay (ELISA); KinExA, Rathanaswami et al. Analytical Biochemistry, Vol. 373:52-60, 2008; or radioimmunoassay
- binding affinities and kinetics can be found in Paul, W. E., ed., Fundamental Immunology, 4th Ed., Lippincott-Raven, Philadelphia (1999), which focuses on antibody-immunogen interactions.
- a competitive binding assay is a radioimmunoassay comprising the incubation of labeled antigen with the antibody of interest in the presence of increasing amounts of unlabeled antigen, and the detection of the antibody bound to the labeled antigen.
- the affinity of the antibody of interest for a particular antigen and the binding off-rates can be determined from the data by scatchard plot analysis. Competition with a second antibody can also be determined using radioimmunoassays. In this case, the antigen is incubated with antibody of interest conjugated to a labeled compound in the presence of increasing amounts of an unlabeled second antibody.
- the antibodies of the invention may be further engineered to further modulate antibody half-life by introducing additional Fc mutations, such as those described for example in (Dall'Acqua et al. (2006) J Biol Chem 281 : 23514-24), (Zalevsky et al. (2010) Nat Biotechnol 28: 157-9), (Hinton et al. (2004) J Biol Chem 279: 6213-6), (Hinton et al. (2006) J Immunol 176: 346-56), (Shields et al. (2001 ) J Biol Chem 276: 6591 -604), (Petkova et al. (2006) Int Immunol 18: 1759- 69), (Datta-Mannan et al.
- Exemplary mutations that may be made singularly or in combination are T250Q, M252Y, 1253A, S254T, T256E, P2571 , T307A, D376V, E380A, M428L, H433K, N434S, N434A, N434H, N434F, H435A and H435R mutations.
- the Fc region comprises a mutation resulting in a decrease in half life.
- An antibody having a short half life may be advantageous in certain instances where the antibody is expected to function as a short-lived therapeutic, e.g., the conditioning step described herein where the antibody is administered followed by HSCs. Ideally, the antibody would be substantially cleared prior to delivery of the HSCs, which also generally express CD1 17 but are not the target of the anti-CD1 17 antibody, unlike the endogenous stem cells.
- the Fc regions comprise a mutation at position 435 (EU index according to Kabat). In one
- the mutation is an H435A mutation.
- the anti-CD1 17 antibody described herein has a half life of equal to or less than 24 hours, a half life of equal to or less than 22 hours, a half life of equal to or less than 20 hours, a half life of equal to or less than 18 hours, a half life of equal to or less than 16 hours, a half life of equal to or less than 14 hours, equal to or less than 13 hours, equal to or less than 12 hours, or equal to or less than 1 1 hours.
- the half life of the antibody is 1 1 hours to 24 hours; 12 hours to 22 hours; 10 hours to 20 hours; 8 hours to 18 hours; or 14 hours to 24 hours.
- the Fc region comprises two or more mutations that confer reduced half- life and greatly diminish or completely abolish an effector function of the antibody.
- the Fc region comprises a mutation resulting in a decrease in half-life and a mutation of at least one residue that can make direct contact with an FcvR (e.g., as based on structural and crystallographic analysis).
- the Fc region comprises a H435A mutation, a L234A mutation, and a L235A mutation.
- the Fc region comprises a H435A mutation and a D265C mutation.
- the Fc region comprises a H435A mutation, a L234A mutation, a L235A mutation, and a D265C mutation.
- the antibody or antigen-binding fragment thereof is conjugated to a cytotoxin (e.g., amatoxin) by way of a cysteine residue in the Fc domain of the antibody or antigen- binding fragment thereof.
- the cysteine residue is introduced by way of a mutation in the Fc domain of the antibody or antigen-binding fragment thereof.
- the cysteine residue may be selected from the group consisting of Cys1 18, Cys239, and Cys265.
- the Fc region of the anti-CD1 17 antibody (or fragment thereof) comprises an amino acid substitution at amino acid 265 according to the EU index as in Kabat.
- the Fc region comprises a D265C mutation.
- the Fc region comprises a D265C and H435A mutation. In one embodiment, the Fc region comprises a D265C, a L234A, and a L235A mutation. In one embodiment, the Fc region comprises a D265C, a L234A, a L235A, and a H435A mutation.
- the cysteine residue is naturally occurring in the Fc domain of the antibody or antigen-binding fragment thereof.
- the Fc domain may be an IgG Fc domain, such as a human lgG1 Fc domain, and the cysteine residue may be selected from the group consisting of Cys261 , Csy321 , Cys367, and Cys425.
- the Fc region of Antibody 67 is modified to comprise a D265C mutation (e.g., SEQ ID NO: 1 1 1 ).
- the Fc region of Antibody 67 is modified to comprise a D265C, L234A, and L235A mutation (e.g., SEQ ID NO: 1 12).
- the Fc region of Antibody 67 is modified to comprise a D265C and H435A mutation (e.g., SEQ ID NO: 1 13).
- the Fc region of Antibody 67 is modified to comprise a D265C, L234A, L235A, and H435A mutation (e.g., SEQ ID NO: 1 14).
- the Fc region of Antibody 55 is modified to comprise a D265C mutation (e.g., SEQ ID NO: 1 17). In another embodiment, the Fc region of Antibody 55 is modified to comprise a D265C, L234A, and L235A mutation (e.g., SEQ ID NO: 1 18). In yet another embodiment, the Fc region of Antibody 55 is modified to comprise a D265C and H435A mutation (e.g., SEQ ID NO: 1 19). In a further embodiment, the Fc region of Antibody 55 is modified to comprise a D265C, L234A, L235A, and H435A mutation (e.g., SEQ ID NO: 120).
- a D265C mutation e.g., SEQ ID NO: 1 17
- the Fc region of Antibody 55 is modified to comprise a D265C, L234A, and L235A mutation (e.g., SEQ ID NO: 1 18).
- the Fc region of Antibody 55 is
- the Fc regions of any one of Antibody 54, Antibody 55, Antibody 56, Antibody 57, Antibody 58, Antibody 61 , Antibody 66, Antibody 67, Antibody 68, or Antibody 69 can be modified to comprise a D265C mutation (e.g., as in SEQ ID NO: 123); a D265C, L234A, and L235A mutation (e.g., as in SEQ ID NO: 124); a D265C and H435A mutation (e.g., as in SEQ ID NO: 125); or a D265C, L234A, L235A, and H435A mutation (e.g., as in SEQ ID NO: 126).
- a D265C mutation e.g., as in SEQ ID NO: 123
- a D265C, L234A, and L235A mutation e.g., as in SEQ ID NO: 124
- the variant Fc domains described herein are defined according to the amino acid modifications that compose them. For all amino acid substitutions discussed herein in regard to the Fc region, numbering is always according to the EU index.
- D265C is an Fc variant with the aspartic acid (D) at EU position 265 substituted with cysteine (C) relative to the parent Fc domain.
- D265C/L234A/L235A defines a variant Fc variant with substitutions at EU positions 265 (D to C), 234 (L to A), and 235 (L to A) relative to the parent Fc domain.
- a variant can also be designated according to its final amino acid composition in the mutated EU amino acid positions.
- the L234A/L235A mutant can be referred to as LALA. It is noted that the order in which substitutions are provided is arbitrary.
- the anti-CD1 17 antibody, or antigen binding fragment thereof comprises variable regions having an amino acid sequence that is at least 95%, 96%, 97% or 99% identical to the SEQ ID Nos disclosed herein.
- the anti-CD1 17 antibody, or antigen binding fragment thereof comprises CDRs comprising the SEQ ID Nos disclosed herein with framework regions of the variable regions described herein having an amino acid sequence that is at least 95%, 96%, 97% or 99% identical to the SEQ ID Nos disclosed herein.
- an anti-CD1 17 antibody, or antigen binding fragment thereof has a certain dissociation rate which is particularly advantageous when used as a part of a conjugate.
- an anti-CD1 17 antibody has, in certain embodiments, an off rate constant (Koff) for human CD1 17 and/or rhesus CD1 17 of 1 x 10 "2 to 1 x 10 "3 , 1 x 10 "3 to 1 x 10 “4 , 1 x 10 "5 to 1 x 10 "6 , 1 x 10 "6 to 1 x 10 "7 or 1 x 10 "7 to 1 x 10 “8 , as measured by bio-layer interferometry (BLI).
- Koff off rate constant
- the antibody or antigen-binding fragment thereof binds CD1 17 (e.g., human CD1 17 and/or rhesus CD1 17) with a K D of about 100 nM or less, about 90nM or less, about 80 nM or less, about 70 nM or less, about 60 nM or less, about 50 nM or less, about 40 nM or less, about 30 nM or less, about 20 nM or less, about 10 nM or less, about 8 nM or less, about 6 nM or less, about 4 nM or less, about 2 nM or less, about 1 nM or less as determined by a Bio-Layer Interferometry (BLI) assay.
- BBI Bio-Layer Interferometry
- antibodies, and binding fragments thereof, disclosed herein can be used in conjugates, as described in more detail below.
- Antibodies may be produced using recombinant methods and compositions, e.g., as described in U.S. Pat. No. 4,816,567.
- isolated nucleic acid encoding an anti-CD1 17 antibody described herein is provided.
- Such nucleic acid may encode an amino acid sequence comprising the VL and/or an amino acid sequence comprising the VH of the antibody (e.g., the light and/or heavy chains of the antibody).
- one or more vectors e.g., expression vectors
- a host cell comprising such nucleic acid is provided.
- a host cell comprises (e.g., has been transformed with): (1 ) a vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and an amino acid sequence comprising the VH of the antibody, or (2) a first vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and a second vector comprising a nucleic acid that encodes an amino acid sequence comprising the VH of the antibody.
- the host cell is eukaryotic, e.g. a Chinese Hamster Ovary (CHO) cell or lymphoid cell (e.g., Y0, NS0, Sp20 cell).
- a method of making an anti-CLL-1 antibody comprises culturing a host cell comprising a nucleic acid encoding the antibody, as provided above, under conditions suitable for expression of the antibody, and optionally recovering the antibody from the host cell (or host cell culture medium).
- nucleic acid encoding an antibody e.g., as described above, is isolated and inserted into one or more vectors for further cloning and/or expression in a host cell.
- nucleic acid may be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the antibody).
- Suitable host cells for cloning or expression of antibody-encoding vectors include prokaryotic or eukaryotic cells described herein.
- antibodies may be produced in bacteria, in particular when glycosylation and Fc effector function are not needed.
- For expression of antibody fragments and polypeptides in bacteria see, e.g., U.S. Pat. Nos. 5,648,237, 5,789,199, and 5,840,523. (See also Charlton, Methods in Molecular Biology, Vol. 248 (B.K.C. Lo, ed.,
- the antibody may be isolated from the bacterial cell paste in a soluble fraction and can be further purified.
- Vertebrate cells may also be used as hosts.
- mammalian cell lines that are adapted to grow in suspension may be useful.
- useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7); human embryonic kidney line (293 or 293 cells as described, e.g., in Graham et al., J. Gen Virol. 36:59 (1977)); baby hamster kidney cells (BHK); mouse Sertoli cells (TM4 cells as described, e.g., in Mather, Biol. Reprod. 23:243-251 (1980)); monkey kidney cells (CV1 ); African green monkey kidney cells (VERO-76); human cervical carcinoma cells (HELA); canine kidney cells (MDCK; buffalo rat liver cells (BRL 3A);
- human lung cells W138; human liver cells (Hep G2); mouse mammary tumor (MMT 060562); TRI cells, as described, e.g., in Mather et al., Annals N.Y. Acad. Sci. 383:44-68 (1982); MRC 5 cells; and FS4 cells.
- Other useful mammalian host cell lines include Chinese hamster ovary (CHO) cells, including DHFR- CHO cells (Urlaub et al., Proc. Natl. Acad. Sci. USA 77:4216 (1980)); and myeloma cell lines such as Y0, NS0 and Sp2/0.
- the anti-CD1 17 antibody, or antigen binding fragment thereof comprises variable regions having an amino acid sequence that is at least 95%, 96%, 97% or 99% identical to the SEQ ID Nos disclosed herein.
- the anti-CD1 17 antibody, or antigen binding fragment thereof comprises CDRs comprising the SEQ ID Nos disclosed herein with framework regions of the variable regions described herein having an amino acid sequence that is at least 95%, 96%, 97% or 99% identical to the SEQ ID Nos disclosed herein.
- the anti-CD1 17 antibody, or antigen binding fragment thereof comprises a heavy chain variable region and a heavy chain constant region having an amino acid sequence that is disclosed herein.
- the anti-CD1 17 antibody, or antigen binding fragment thereof comprises a light chain variable region and a light chain constant region having an amino acid sequence that is disclosed herein.
- the anti- CD1 17 antibody, or antigen binding fragment thereof comprises a heavy chain variable region, a light chain variable region, a heavy chain constant region and a light chain constant region having an amino acid sequence that is disclosed herein.
- novel anti-CD1 17 antibodies that may be used, for example, in conditioning methods for stem cell transplantation.
- other anti- CD1 17 antibodies e.g., neutral antibodies, can be identified.
- Methods for high throughput screening of antibody, or antibody fragment libraries for molecules capable of binding CD1 17 can be used to identify and affinity mature antibodies useful for treating cancers, autoimmune diseases, and conditioning a patient (e.g., a human patient) in need of hematopoietic stem cell therapy as described herein.
- Such methods include in vitro display techniques known in the art, such as phage display, bacterial display, yeast display, mammalian cell display, ribosome display, mRNA display, and cDNA display, among others.
- phage display to isolate ligands that bind biologically relevant molecules has been reviewed, for example, in Felici et al., Biotechnol. Annual Rev.
- Randomized combinatorial peptide libraries have been constructed to select for polypeptides that bind cell surface antigens as described in Kay, Perspect. Drug Discovery Des. 2:251 -268, 1995 and Kay et al., Mol. Divers. 1 :139-140, 1996, the disclosures of each of which are incorporated herein by reference as they pertain to the discovery of antigen-binding molecules.
- Proteins such as multimeric proteins have been successfully phage-displayed as functional molecules (see, for example, EP 0349578; EP 4527839; and EP 0589877, as well as Chiswell and McCafferty, Trends Biotechnol. 10:80-84 1992, the disclosures of each of which are incorporated herein by reference as they pertain to the use of in vitro display techniques for the discovery of antigen-binding molecules).
- functional antibody fragments such as Fab and scFv fragments, have been expressed in in vitro display formats (see, for example, McCafferty et al., Nature 348:552- 554, 1990; Barbas et al., Proc. Natl. Acad. Sci.
- computational modeling techniques can be used to design and identify antibodies, and antibody fragments, in silico that bind CD1 17 (e.g., GNNK+ CD1 17).
- CD1 17 e.g., GNNK+ CD1 17
- computational modeling techniques one of skill in the art can screen libraries of antibodies, and antibody fragments, in silico for molecules capable of binding specific epitopes, such as extracellular epitopes of this antigen.
- the antibodies, and antigen-binding fragments thereof, identified by these computational techniques can be used in conjunction with the therapeutic methods described herein, such as the cancer and autoimmune disease treatment methods described herein and the patient conditioning procedures described herein.
- Additional techniques can be used to identify antibodies, and antigen-binding fragments thereof, that bind CD1 17 (e.g., GNNK+ CD1 17) on the surface of a cell (e.g., a cancer cell, autoimmune cell, or hematopoietic stem cell) and that are internalized by the cell, for instance, by receptor-mediated endocytosis.
- a cell e.g., a cancer cell, autoimmune cell, or hematopoietic stem cell
- the in vitro display techniques described above can be adapted to screen for antibodies, and antigen-binding fragments thereof, that bind CD1 17 (e.g., GNNK+ CD1 17) on the surface of a cancer cell, autoimmune cell, or hematopoietic stem cell and that are subsequently internalized.
- Phage display represents one such technique that can be used in conjunction with this screening paradigm.
- CD1 17 e.g., GNNK+ CD1 17
- GNNK+ CD1 17 bind CD1 17
- autoimmune cells e.g., IL-12 17
- hematopoietic stem cells e.g., IL-12 17
- one of skill in the art can adapt the phage display techniques described, for example, in Williams et al., Leukemia 19:1432-1438, 2005, the disclosure of which is incorporated herein by reference in its entirety.
- recombinant phage libraries can be produced that encode antibodies, antibody fragments, such as scFv fragments, Fab fragments, diabodies, triabodies, and 10 Fn3 domains, among others, or ligands that contain randomized amino acid cassettes (e.g., in one or more, or all, of the CDRs or equivalent regions thereof or an antibody or antibody fragment).
- the framework regions, hinge, Fc domain, and other regions of the antibodies or antibody fragments may be designed such that they are non-immunogenic in humans, for instance, by virtue of having human germline antibody sequences or sequences that exhibit only minor variations relative to human germline antibodies.
- phage libraries containing randomized antibodies, or antibody fragments, covalently bound to the phage particles can be incubated with CD1 17 (e.g., GNNK+ CD1 17) antigen, for instance, by first incubating the phage library with blocking agents (such as, for instance, milk protein, bovine serum albumin, and/or IgG so as to remove phage encoding antibodies, or fragments thereof, that exhibit nonspecific protein binding and phage that encode antibodies or fragments thereof that bind Fc domains, and then incubating the phage library with a population of hematopoietic stem cells.
- blocking agents such as, for instance, milk protein, bovine serum albumin, and/or IgG
- the phage library can be incubated with the target cells, such as cancer cells, autoimmune cells, or hematopoietic stem cells for a time sufficient to allow CD1 17-specific antibodies, or antigen- binding fragments thereof, (e.g., GNNK+ CD1 17-specific antibodies, or antigen-binding fragments thereof) to bind cell-surface CD1 17 (e.g., sell-surface GNNK+ CD1 17) antigen and to the target cells, such as cancer cells, autoimmune cells, or hematopoietic stem cells for a time sufficient to allow CD1 17-specific antibodies, or antigen- binding fragments thereof, (e.g., GNNK+ CD1 17-specific antibodies, or antigen-binding fragments thereof) to bind cell-surface CD1 17 (e.g., sell-surface GNNK+ CD1 17) antigen and to
- hematopoietic stem cells e.g., from 30 minutes to 6 hours at 4° C, such as 1 hour at 4° C.
- Phage containing antibodies, or fragments thereof, that do not exhibit sufficient affinity for one or more of these antigens so as to permit binding to, and internalization by, cancer cells, autoimmune cells, or hematopoietic stem cells can subsequently be removed by washing the cells, for instance, with cold (4° C) 0.1 M glycine buffer at pH 2.8.
- Phage bound to antibodies, or fragments thereof, that have been internalized by the cancer cells, autoimmune cells, or hematopoietic stem cells can be identified, for instance, by lysing the cells and recovering internalized phage from the cell culture medium.
- the phage can then be amplified in bacterial cells, for example, by incubating bacterial cells with recovered phage in 2xYT medium using methods known in the art.
- Phage recovered from this medium can then be characterized, for instance, by determining the nucleic acid sequence of the gene(s) encoding the antibodies, or fragments thereof, inserted within the phage genome.
- the encoded antibodies, or fragments thereof can subsequently be prepared de novo by chemical synthesis (for instance, of antibody fragments, such as scFv fragments) or by recombinant expression (for instance, of full-length antibodies).
- Phage display libraries can be created by making a designed series of mutations or variations within a coding sequence for the CDRs of an antibody or the analogous regions of an antibody-like scaffold (e.g., the BC, CD, and DE loops of 10 Fn3 domains).
- the template antibody-encoding sequence into which these mutations are introduced may be, for example, a naive human germline sequence. These mutations can be performed using standard mutagenesis techniques known in the art. Each mutant sequence thus encodes an antibody corresponding to the template save for one or more amino acid variations.
- Retroviral and phage display vectors can be engineered using standard vector construction techniques known in the art. P3 phage display vectors along with compatible protein expression vectors can be used to generate phage display vectors for antibody diversification.
- the mutated DNA provides sequence diversity, and each transformant phage displays one variant of the initial template amino acid sequence encoded by the DNA, leading to a phage population (library) displaying a vast number of different but structurally related amino acid sequences. Due to the well-defined structure of antibody hypervariable regions, the amino acid variations introduced in a phage display screen are expected to alter the binding properties of the binding peptide or domain without significantly altering its overall molecular structure.
- a phage library may be contacted with and allowed to bind one of the foregoing antigens or an epitope thereof.
- Phage bearing a CD1 17-binding moiety can form a complex with the target on the solid support, whereas non-binding phage remain in solution and can be washed away with excess buffer.
- Bound phage can then liberated from the target by changing the buffer to an extreme pH (pH 2 or pH 10), changing the ionic strength of the buffer, adding denaturants, or other known means.
- the recovered phage can then be amplified through infection of bacterial cells, and the screening process can be repeated with the new pool that is now depleted in non-binding antibodies and enriched for antibodies that bind CD1 17 (e.g., GNNK+ CD1 17).
- the recovery of even a few binding phage is sufficient to amplify the phage for a subsequent iteration of screening.
- the gene sequences encoding the antibodies or antigen-binding fragments thereof derived from selected phage clones in the binding pool are determined by conventional methods, thus revealing the peptide sequence that imparts binding affinity of the phage to the target.
- sequence diversity of the population diminishes with each round of selection until desirable peptide-binding antibodies remain.
- the sequences may converge on a small number of related antibodies or antigen-binding fragments thereof.
- An increase in the number of phage recovered at each round of selection is an indication that convergence of the library has occurred in a screen.
- Another method for identifying anti-CD1 17 antibodies includes using humanizing non- human antibodies that bind CD1 17 (e.g., GNNK+ CD1 17), for instance, according to the following procedure.
- Consensus human antibody heavy chain and light chain sequences are known in the art (see e.g., the "VBASE" human germline sequence database; Kabat et al. Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91 -3242, 1991 ; Tomlinson et al., J. Mol. Biol. 227:776-798, 1992; and Cox et al.. Eur. J. Immunol. 24:827- 836, 1994, the disclosures of each of which are incorporated herein by reference as they pertain to consensus human antibody heavy chain and light chain
- variable domain framework residues and CDRs of a consensus antibody sequence e.g., by sequence alignment.
- This CDR exchange can be performed using gene editing techniques described herein or known in the art.
- consensus human antibody that may be used in the preparation of a humanized antibody comprises a heavy chain variable domain set forth in SEQ ID NO: 7:
- EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYAMSWVRQAPGKGLEWVAVISENGSDTYYADS VKGRFTISRDDSKNTLYLQMNSLRAEDTAVYYCARDRGGAVSYFDVWGQGTLVTVSS (SEQ ID NO: 7) and a light chain variable domain set forth in SEQ ID NO: 8: DIQMTQSPSSLSASVGDRVTITCRASQDVSSYLAWYQQKPGKAPKLLIYAASSLESGVPSRFSGS GSGTDFTLTISSLQPEDFATYYCQQYNSLPYTFGQGTKVEIKRT (SEQ ID NO: 8), identified in US Patent No. 6,054,297 (Genentech), the disclosure of which is incorporated herein by reference as it pertains to human antibody consensus sequences. The CDRs in the above sequences are shown in bold.
- variable region CDRs binds CD1 17 (e.g., GNNK+ CD1 17).
- GNNK+ CD1 17 a non-human antibody that binds CD1 17
- the affinity of the antibody for the hematopoietic stem cell antigen is determined primarily by the CDR sequences, the resulting humanized antibody is
- an antibody for a target antigen that is about the same as that of the non-human antibody from which the humanized antibody was derived.
- Methods of determining the affinity of an antibody for a target antigen include, for instance, ELISA-based techniques described herein and known in the art, as well as surface plasmon resonance,
- the internalizing capacity of the anti-CD1 17 antibodies, or fragments thereof can be assessed, for instance, using radionuclide internalization assays known in the art.
- antibodies, or fragments thereof, identified using in vitro display techniques described herein or known in the art can be functionalized by incorporation of a radioactive isotope, such as 18 F, 75 Br, 77 Br, 122 l, 123 l, 124 l, 125 l, 129 l, 131 l, 211 At, 67 Ga, 111 ln, "Tc, 169 Yb, 186 Re, 64 Cu, 67 Cu, 177 Lu, 77 As, 72 As, 86 Y, 90 Y, 89 Zr, 212 Bi, 213 Bi, or 225 Ac.
- a radioactive isotope such as 18 F, 75 Br, 77 Br, 122 l, 123 l, 124 l, 125 l, 129 l, 131 l, 211 At, 67
- radioactive halogens such as 18 F, 75 Br, 77 Br, 122 l, 123 l, 124 l, 125 l, 129 l, 131 1, 211 At, can be incorporated into antibodies, or fragments thereof, using beads, such as polystyrene beads, containing electrophilic halogen reagents (e.g., lodination Beads, Thermo Fisher Scientific, Inc., Cambridge, MA).
- Radiolabeled antibodies, or fragments thereof can be incubated with cancer cells, autoimmune cells, or hematopoietic stem cells for a time sufficient to permit internalization (e.g., from 30 minutes to 6 hours at 4° C, such as 1 hour at 4° C).
- the cells can then be washed to remove non-internalized antibodies, or fragments thereof, (e.g., using cold (4° C) 0.1 M glycine buffer at pH 2.8).
- Internalized antibodies, or fragments thereof can be identified by detecting the emitted radiation (e.g., ⁇ -radiation) of the resulting cancer cells, autoimmune cells, or hematopoietic stem cells in comparison with the emitted radiation (e.g., ⁇ -radiation) of the recovered wash buffer.
- ADCs Antibody Drug Conjugates
- Antibodies and antigen-binding fragments thereof described herein can be conjugated
- the cytotoxic molecule is conjugated to a cell internalizing antibody, or antigen-binding fragment thereof as disclosed herein such that following the cellular uptake of the antibody, or fragment thereof, the cytotoxin may access its intracellular target and mediate hematopoietic cell death.
- cytotoxins can be conjugated to the anti-CD1 17 antibody, e.g., 1 , 2, 3, 4, 5, 6, 7, or 8.
- Cytotoxins suitable for use with the compositions and methods described herein include DNA-intercalating agents, (e.g., anthracyclines), agents capable of disrupting the mitotic spindle apparatus (e.g., vinca alkaloids, maytansine, maytansinoids, and derivatives thereof), RNA polymerase inhibitors (e.g., an amatoxin, such as a-amanitin, and derivatives thereof), and agents capable of disrupting protein biosynthesis (e.g., agents that exhibit rRNA N-glycosidase activity, such as saporin and ricin A-chain), among others known in the art.
- DNA-intercalating agents e.g., anthracyclines
- agents capable of disrupting the mitotic spindle apparatus e.g., vinca alkaloids, maytansine, maytansinoids, and derivatives thereof
- RNA polymerase inhibitors e.g., an amatoxin, such as a-amanitin,
- the cytotoxin is a microtubule-binding agent (for instance, maytansine or a maytansinoid), an amatoxin, pseudomonas exotoxin A, deBouganin, diphtheria toxin, saporin, an auristatin, an anthracycline, a calicheamicin, irinotecan, SN-38, a duocarmycin, a pyrrolobenzodiazepine (PBD), a pyrrolobenzodiazepine dimer, an indolinobenzodiazepine, an indolinobenzodiazepine dimer, or a variant thereof, or another cytotoxic compound described herein or known in the art.
- a microtubule-binding agent for instance, maytansine or a maytansinoid
- an amatoxin for instance, maytansine or a maytansinoid
- an amatoxin for instance, pseudomonas exot
- Antibodies, or antigen-binding fragments thereof, described herein can be conjugated to a cytotoxin, such as pseudomonas exotoxin A, deBouganin, diphtheria toxin, an amatoxin, such as ⁇ -amanitin, saporin, maytansine, a maytansinoid, an auristatin, an cytotoxin, such as pseudomonas exotoxin A, deBouganin, diphtheria toxin, an amatoxin, such as ⁇ -amanitin, saporin, maytansine, a maytansinoid, an auristatin, an cytotoxin, such as pseudomonas exotoxin A, deBouganin, diphtheria toxin, an amatoxin, such as ⁇ -amanitin, saporin, maytansine, a maytansinoid, an auristatin, an cytotoxin
- anthracycline a calicheamicin, irinotecan, SN-38, a duocarmycin, a pyrrolobenzodiazepine, a pyrrolobenzodiazepine dimer, an indolinobenzodiazepine, and an indolinobenzodiazepine dimer, or a variant thereof, or another cytotoxic compound described herein or known in the art, for example, in order to treat a cancer or autoimmune disease described herein or to promote the depletion of endogenous hematopoietic stem cells upon administration to a patient (e.g., a human patient) in need of hematopoietic stem cell transplant therapy.
- a patient e.g., a human patient
- the cytotoxic molecule is conjugated to an internalizing antibody, or antigen-binding fragment thereof, such that following the cellular uptake of the antibody, or antigen-binding fragment, the cytotoxin may access its intracellular target and mediate endogenous hematopoietic cell death.
- Cytotoxins suitable for use with the compositions and methods described herein include DNA-intercalating agents, (e.g., anthracyclines), agents capable of disrupting the mitotic spindle apparatus (e.g., vinca alkaloids, maytansine, maytansinoids, and derivatives thereof), RNA polymerase inhibitors (e.g., an amatoxin, such as ⁇ -amanitin and derivatives thereof), agents capable of disrupting protein biosynthesis (e.g., agents that exhibit rRNA N-glycosidase activity, such as saporin and ricin A-chain), among others known in the art.
- DNA-intercalating agents e.g., anthracyclines
- agents capable of disrupting the mitotic spindle apparatus e.g., vinca alkaloids, maytansine, maytansinoids, and derivatives thereof
- RNA polymerase inhibitors e.g., an amatoxin, such as ⁇ -amanitin and derivatives
- cytotoxins suitable for use with the compositions and methods described herein include, without limitation, 5-ethynyluracil, abiraterone, acylfulvene, adecypenol, adozelesin, aldesleukin, altretamine, ambamustine, amidox, amifostine, aminolevulinic acid, amrubicin, amsacrine, anagrelide, anastrozole, andrographolide, angiogenesis inhibitors, antarelix, anti- dorsalizing morphogenetic protein-1 , antiandrogen, prostatic carcinoma, antiestrogen, antineoplaston, antisense oligonucleotides, aphidicolin glycinate, apoptosis gene modulators, apoptosis regulators, apurinic acid, asulacrine, atamestane, atrimustine, axinastatin 1 , axinastatin 2, axina
- bisaziridinylspermine bisnafide, bistratene A, bizelesin, breflate, bleomycin A2, bleomycin B2, bropirimine, budotitane, buthionine sulfoximine, calcipotriol, calphostin C, camptothecin derivatives (e.g., 10-hydroxy-camptothecin), capecitabine, carboxamide-amino-triazole, carboxyamidotriazole, carzelesin, casein kinase inhibitors, castanospermine, cecropin B, cetrorelix, chlorins,
- camptothecin derivatives e.g., 10-hydroxy-camptothecin
- capecitabine carboxamide-amino-triazole, carboxyamidotriazole, carzelesin, casein kinase inhibitors, castanospermine, cecropin B, cetrorelix, chlorins,
- Anti-CD1 17 antibodies, and antigen-binding fragments thereof, described herein can be conjugated to a cytotoxin that is a microtubule binding agent.
- cytotoxin that is a microtubule binding agent.
- microtubule-binding agent refers to a compound which acts by disrupting the microtubular network that is essential for mitotic and interphase cellular function in a cell.
- microtubule-binding agents include, but are not limited to, maytasine, maytansinoids, and derivatives thereof, such as those described herein or known in the art, vinca alkaloids, such as vinblastine, vinblastine sulfate, vincristine, vincristine sulfate, vindesine, and vinorelbine, taxanes, such as docetaxel and paclitaxel, macrolides, such as discodermolides, cochicine, and
- epothilones and derivatives thereof, such as epothilone B or a derivative thereof.
- the microtubule binding agent is a maytansine, a maytansinoid or a maytansinoid analog.
- Maytansinoids are mitototic inhibitors which bind microtubules and act by inhibiting tubulin polymerization. Maytansine was first isolated from the east African shrub
- Maytenus serrata (U.S. Pat. No. 3,896,1 1 1 ). Subsequently, it was discovered that certain microbes also produce maytansinoids, such as maytansinol and C-3 maytansinol esters (U.S. Pat. No. 4,151 ,042). Synthetic maytansinol and derivatives and analogues thereof are disclosed, for example, in U.S. Pat. Nos.
- Maytansinoid drug moieties are attractive drug moieties in antibody drug conjugates because they are: (i) relatively accessible to prepare by fermentation or chemical modification, derivatization of fermentation products, (ii) amenable to derivatization with functional groups suitable for conjugation through the non-disulfide linkers to antibodies, (iii) stable in plasma, and (iv) effective against a variety of tumor cell lines.
- suitable maytansinoids include esters of maytansinol, synthetic maytansinol, and maytansinol analogs and derivatives. Included herein are any cytotoxins that inhibit microtubule formation and that are highly toxic to mammalian cells, as are maytansinoids, maytansinol, and maytansinol analogs, and derivatives. Examples of suitable maytansinol esters include those having a modified aromatic ring and those having modifications at other positions. Such suitable maytansinoids are disclosed in U.S. Pat. Nos. 4,137,230; 4,151 ,042; 4,248,870; 4,256,746; 4,260,608; 4,265,814; 4,294,757;
- the immunoconjugates of the invention utilize the thiol-containing maytansinoid (DM1 ), formally termed N 2 '-deacetyl-N 2 '-(3-mercapto-1 -oxopropyl)-maytansine, as the cytotoxic agent.
- DM1 is represented by the structural formula (VII):
- the conjugates of the present invention utilize the thiol-containing maytansinoid N 2 '-deacetyl-N 2 '(4-methyl-4-mercapto-1 -oxopentyl)-maytansine (e.g., DM4) as the cytotoxic agent.
- DM4 is represented by the structural formula (V):
- N 2 '-deacetyl-N- 2 '(4-mercapto-1 -oxopentyl)-maytansine (termed DM3), represented by the structural formula (VI):
- maytansinoids can serve as the position to chemically link the linking moiety.
- the C-3 position having a hydroxyl group, the C-14 position modified with hydroxymethyl, the C-15 position modified with hydroxy and the C-20 position having a hydroxy group are all expected to be useful.
- the C-3 position serves as the position to chemically link the linking moiety
- the C-3 position of maytansinol serves as the position to chemically link the linking moiety.
- linking groups known in the art for making antibody-maytansinoid conjugates including, for example, those disclosed in U.S. Pat. Nos. 5,208,020, 6,441 ,163, and EP Patent No.
- the present disclosure also includes various isomers and mixtures of maytansinoids and conjugates.
- Certain compounds and conjugates of the present invention may exist in various stereoisomeric, enantiomeric, and diastereomeric forms.
- Several descriptions for producing such antibody-maytansinoid conjugates are provided in U.S. Pat. Nos. 5,208,020, 5,416,064 6,333,410, 6,441 ,163, 6,716,821 , and 7,368,565, each of which is incorporated herein in its entirety.
- a therapeutically effective number of maytansinoid molecules bound per antibody molecule can be determined by measuring spectrophotometrically the ratio of the absorbance at 252 nm and 280 nm.
- An average of 3 to 4 maytansinoid molecules conjugated per antibody molecule can enhancing cytotoxicity of target cells without negatively affecting the function or solubility of the antibody, although one molecule of toxin/antibody can enhance cytotoxicity over antibody alone.
- the average number of maytansinoid molecules/antibody or antigen binding fragment thereof can be, for example, 1 -10 or 2-5.
- the antibodies and antigen-binding fragments thereof described herein can be conjugated to a cytotoxin that is an anthracycline molecule.
- Anthracyclines are antibiotic compounds that exhibit cytotoxic activity. Studies have indicated that anthracyclines may operate to kill cells by a number of different mechanisms including: 1 ) intercalation of the drug molecules into the DNA of the cell thereby inhibiting DNA-dependent nucleic acid synthesis; 2) production by the drug of free radicals which then react with cellular macromolecules to cause damage to the cells or 3) interactions of the drug molecules with the cell membrane [see, e.g., C.
- anthracyclines have been used in the treatment of numerous cancers such as leukemia, breast carcinoma, lung carcinoma, ovarian adenocarcinoma and sarcomas [see e.g., P.H- Wiernik, in Anthracycline: Current Status And New Developments p 1 1 ].
- Commonly used anthracyclines include doxorubicin, epirubicin, idarubicin and daunomycin.
- doxorubicin The anthracycline analog, doxorubicin (ADRIAMYCINO) is thought to interact with DNA by intercalation and inhibition of the progression of the enzyme topoisomerase II, which unwinds DNA for transcription.
- Doxorubicin stabilizes the topoisomerase II complex after it has broken the DNA chain for replication, preventing the DNA double helix from being resealed and thereby stopping the process of replication.
- Doxorubicin and daunorubicin (DAUNOMYCIN) are prototype cytotoxic natural product anthracycline chemotherapeutics (Sessa et al., (2007) Cardiovasc. Toxicol. 7:75- 79).
- PBDs Pyrrolobenzodiazepines
- the anti-CD1 17 antibodies or antigen-binding fragments thereof described herein can be conjugated to a cytotoxin that is a pyrrolobenzodiazepine (PBD) or a cytotoxin that comprises a PBD.
- PBDs are natural products produced by certain actinomycetes and have been shown to be sequence selective DNA alkylating compounds.
- PBD cytotoxins include, but are not limited to, anthramycin, dimeric PBDs, and those disclosed in, for example, Hartley, J.A. (201 1 ). "The development of pyrrolobenzodiazepines as antitumour agents.” Expert Opin. Inv.
- the antibodies and antigen-binding fragments thereof described herein can be conjugated to a cytotoxin that is a calicheamicin molecule.
- the calicheamicin family of antibiotics are capable of producing double-stranded DNA breaks at sub-picomolar
- Anti-CD1 17 antibodies, and antigen-binding fragments thereof, described herein can be conjugated to a cytotoxin that is an auristatin (U.S. Pat. Nos. 5,635,483; 5,780,588).
- Auristatins are anti-mitotic agents that interfere with microtubule dynamics, GTP hydrolysis, and nuclear and cellular division (Woyke et al (2001 ) Antimicrob. Agents and Chemother. 45(12):3580-3584) and have anticancer (U.S. Pat. No. 5,663,149) and antifungal activity (Pettit et al (1998) Antimicrob. Agents Chemother. 42:2961 -2965). (U.S. Pat. Nos.
- the auristatin drug moiety may be attached to the antibody through the N- (amino) terminus or the C- (carboxyl) terminus of the peptidic drug moiety (WO 02/088172).
- Exemplary auristatin embodiments include the N-terminus linked monomethylauristatin drug moieties DE and DF, disclosed in Senter et al, Proceedings of the American Association for Cancer Research, Volume 45, Abstract Number 623, presented Mar. 28, 2004, the disclosure of which is expressly incorporated by reference in its entirety.
- An exemplary auristatin embodiment is MMAE, wherein the wavy line indicates the point of covalent attachment to the linker of an antibody-linker conjugate (-L-Z-Ab, as described herein).
- MMAF Another exemplary auristatin embodiment is MMAF, wherein the wavy line indicates the point of covalent attachment to the linker of an antibody-linker conjugate (-L-Z-Ab, as described
- Auristatins may be prepared according to the methods of: U.S. Pat. No. 5,635,483; U.S. Pat. No. 5,780,588; Pettit et al (1989) J. Am. Chem. Soc. 1 1 1 :5463-5465; Pettit et al (1998) Anti- Cancer Drug Design 13:243-277; Pettit, G. R., et al. Synthesis, 1996, 719-725; Pettit et al (1996) J. Chem. Soc. Perkin Trans. 15:859-863; and Doronina (2003) Nat. Biotechnol. 21 (7)778-784.
- the cytotoxin of the antibody-drug conjugate is an RNA polymerase inhibitor.
- the RNA polymerase inhibitor is an amatoxin or derivative thereof.
- the cytotoxin is an amatoxin or derivative thereof, such as a- amanitin, ⁇ -amanitin, ⁇ -amanitin, ⁇ -amanitin, amanin, amaninamide, amanullin, amanullinic acid, and proamanullin.
- Structures of the various naturally occurring amatoxins are represented by formula II and accompanying Table 1 , and are disclosed in, e.g., Zanotti et al., Int. J. Peptide Protein Res. 30, 1987, 450-459.
- the antibodies, and antigen-binding fragments, described herein may be bound to an amatoxin so as to form a conjugate represented by the formula Ab-Z-L-Am, wherein Ab is the antibody, or antigen-binding fragment thereof, L is a linker, Z is a chemical moiety and Am is an amatoxin.
- Ab is the antibody, or antigen-binding fragment thereof
- L is a linker
- Z is a chemical moiety
- Am is an amatoxin.
- Many positions on amatoxins or derivatives thereof can serve as the position
- Am-L-Z is represented by formula (I) wherein is H, OH, OR A , or OR c ;
- R 2 is H, OH, OR B , or OR c ;
- R A and R B when present, together with the oxygen atoms to which they are bound, combine to form an optionally substituted 5-membered heterocycloalkyl group;
- R 3 is H, R c , or R D ;
- R 4 is H, OH, ORc, OR D , R c , or R D ;
- R 5 is H, OH, ORc, OR D , R c , or R D ;
- R 6 is H, OH, ORc, OR D , R c , or R D ;
- R 7 is H, OH, ORc, OR D , R c , or R D ;
- R 8 is OH, NH 2 , ORc, OR D , NHR C , or NR C R D ;
- R 9 is H, OH, ORc, or OR D ;
- X is -S-, -S(O)-, or -SO 2 -;
- Rc is -L-Z
- R D is optionally substituted alkyl (e.g., C C 6 alkyl), optionally substituted heteroalkyl (e.g., C C 6 heteroalkyl), optionally substituted alkenyl (e.g., C 2 -C 6 alkenyl), optionally substituted heteroalkenyl (e.g., C 2 -C 6 heteroalkenyl), optionally substituted alkynyl (e.g., C 2 -C 6 alkynyl), optionally substituted heteroalkynyl (e.g., C 2 -C 6 heteroalkynyl), optionally substituted cycloalkyl, optionally substituted heterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl;
- alkyl e.g., C C 6 alkyl
- optionally substituted heteroalkyl e.g., C C 6 heteroalkyl
- optionally substituted alkenyl e.g., C 2 -C 6
- optionally substituted alkylene e.g., Ci-C 6 alkylene
- optionally substituted heteroalkylene
- Z is a chemical moiety formed from a coupling reaction between a reactive substituent present on L and a reactive substituent present within an antibody, or antigen-binding fragment thereof, that binds CD1 17 (such as GNNK+ CD1 1 7).
- Am contains exactly one R c substituent.
- S is a sulfur atom which represents the reactive substituent present within an antibody, or antigen-binding fragment thereof, that binds CD1 17 (e.g., from the -SH group of a cysteine residue).
- the conjugate is represented by one of formulas IV, IVA, or IVB:
- maleimide reacts with a thiol group found on a cysteine in the antibody.
- maleimide reacts with a thiol group found on a cysteine in the antibody.
- Am-L-Z is re resented by formula (IA)
- R 2 is H, OH, OR B , or OR c ;
- R A and R B when present, together with the oxygen atoms to which they are bound, combine to form an optionally substituted 5-membered heterocycloalkyl group;
- R 3 is H, R c , or R D ;
- R 4 is H, OH, ORc, OR D , R c , or R D ;
- R 5 is H, OH, ORc, OR D , R c , or R D ;
- R 6 is H, OH, ORc, OR D , R c , or R D ;
- R 7 is H, OH, ORc, OR D , R c , or R D ;
- R 8 is OH, NH 2 , ORc, OR D , NHR C , or NR C R D ;
- R 9 is H, OH, ORc, or OR D ;
- X is -S-, -S(O)-, or -S0 2 -;
- Rc is -L-Z
- R D is optionally substituted alkyl (e.g., C C 6 alkyl), optionally substituted heteroalkyl (e.g., C C 6 heteroalkyl), optionally substituted alkenyl (e.g., C 2 -C 6 alkenyl), optionally substituted heteroalkenyl (e.g., C 2 -C 6 heteroalkenyl), optionally substituted alkynyl (e.g., C 2 -C 6 alkynyl), optionally substituted heteroalkynyl (e.g., C 2 -C 6
- heteroalkynyl optionally substituted cycloalkyl, optionally substituted heterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl;
- optionally substituted alkylene e.g., Ci-C 6 alkylene
- optionally substituted heteroalkylene
- Z is a chemical moiety formed from a coupling reaction between a reactive substituent present on L and a reactive substituent present within an antibody, or antigen- binding fragment thereof, that binds CD1 17 (such as GNNK+ CD1 17);
- Am-L-Z is re resented b formula (IB)
- R 2 is H, OH, OR B , or OR c ;
- R A and R B when present, together with the oxygen atoms to which they are bound, combine to form an optionally substituted 5-membered heterocycloalkyi group;
- R 3 is H, R c , or R D ;
- R 4 is H, OH, ORc, OR D , R c , or R D ;
- R 5 is H, OH, ORc, OR D , Rc, or R D ;
- R 6 is H, OH, ORc, OR D , R c , or R D ;
- R 7 is H, OH, ORc, OR D , R c , or R D ;
- R 8 is OH, NH 2 , ORc, OR D , NHR C , or NR C R D ;
- R 9 is H, OH, ORc, or OR D ;
- X is -S-, -S(O)-, or -S0 2 -;
- Rc is -L-Z
- R D is optionally substituted alkyl (e.g., Ci-C 6 alkyl), optionally substituted heteroalkyi (e.g., Ci-C 6 heteroalkyi), optionally substituted alkenyl (e.g., C 2 -C 6 alkenyl), optionally substituted heteroalkenyl (e.g., C 2 -C 6 heteroalkenyl), optionally substituted alkynyl (e.g., C 2 -C 6 alkynyl), optionally substituted heteroalkynyl (e.g., C 2 -C 6
- heteroalkynyl optionally substituted cycloalkyi, optionally substituted heterocycloalkyi, optionally substituted aryl, or optionally substituted heteroaryl;
- Z is a chemical moiety formed from a coupling reaction between a reactive substituent present on L and a reactive substituent present within an antibody, or antigen- binding fragment thereof, that binds CD1 17 (such as GNNK+ CD1 17);
- R A and R B when present, together with the oxygen atoms to which they are bound, combine to form a 5-membered heterocycloalkyi group of
- R E and R E ' are each independently optionally substituted Ci-C 6 alkylene-R c , optionally substituted Ci-C 6 heteroalkylene-R c , optionally substituted C 2 -C 6 alkenylene- R c , optionally substituted C 2 -C 6 heteroalkenylene-R c , optionally substituted C 2 -C 6 alkynylene-Rc, optionally substituted C 2 -C 6 heteroalkynylene-R c , optionally substituted cycloalkylene-Rc, optionally substituted heterocycloalkylene-R c , optionally substituted arylene-Rc, or optionally substituted heteroarylene-R c .
- Am-L-Z is represented by formula (IA) or formula (IB), wherein is H, OH, OR A , or OR c ;
- R 2 is H, OH, OR B , or OR c ;
- R A and R B when present, together with the oxygen atoms to which they are bound, combine to form:
- R 3 is H or R c ;
- R 4 is H, OH, ORc, OR D , R c , or R D ;
- R 5 is H, OH, ORc, OR D , R c , or R D ;
- R 6 is H, OH, ORc, OR D , R c , or R D ;
- R 7 is H, OH, ORc, OR D , R c , or R D ;
- R 8 is OH, NH 2 , ORc, or NHR C ;
- R 9 is H or OH
- X is -S-, -S(O)-, or -S0 2 -;
- R c and R D are each as defined above.
- Am-L-Z is represented by formula (IA) or formula (IB), wherein is H, OH, OR A , or OR c ;
- R 2 is H, OH, OR B , or OR c ;
- R A and R B when present, together with the oxygen atoms to which they are bound, combine to form:
- R 3 is H or R c ;
- R 4 and R 5 are each independently H, OH, OR c , Rc, or OR D ;
- R 6 and R 7 are each H
- R 8 is OH, NH 2 , ORc, or NHR C ;
- R 9 is H or OH
- X is -S-, -S(O)-, or -SO2-;
- R c is as defined above.
- Am-L-Z is represented by formula (IA) or formula (IB), wherein R is H, OH, or OR A ;
- R 2 is H, OH, or OR B ;
- R A and R B when present, together with the oxygen atoms to which they are bound, combine to form:
- R 3 , R 4 , R 6 , and R 7 are each H;
- R 5 is OR c ;
- R 8 is OH or NH 2 ;
- R 9 is H or OH
- X is -S-, -S(O)-, or -SO2-;
- R c is as defined above.
- amatoxin conjugates are described, for example, in US Patent Application Publication No. 2016/0002298, the disclosure of which is incorporated herein by reference in its entirety.
- Am-L-Z is represented by formula (IA) or formula (IB), wherein and R 2 are each independently H or OH; R 3 is R c ;
- R 4 , R 6 , and R 7 are each H;
- R 5 is H, OH, or OCi-C 6 alkyl
- R 8 is OH or NH 2 ;
- R 9 is H or OH
- X is -S-, -S(O)-, or -SO 2 -;
- R c is as defined above.
- amatoxin conjugates are described, for example, in US Patent Application Publication No. 2014/0294865, the disclosure of which is incorporated herein by reference in its entirety.
- Am-L-Z is represented by formula (IA) or formula (IB), wherein R and R 2 are each independently H or OH;
- R 3 , R 6 , and R 7 are each H;
- R 4 and R 5 are each independently H, OH, OR c , or R c ;
- R 8 is OH or NH 2 ;
- R 9 is H or OH
- X is -S-, -S(O)-, or -SO 2 -;
- R c is as defined above.
- amatoxin conjugates are described, for example, in US Patent Application Publication No. 2015/0218220, the disclosure of which is incorporated herein by reference in its entirety.
- Am-L-Z is represented by formula (IA) or formula (IB), wherein and R 2 are each independently H or OH;
- R 3 , R 6 , and R 7 are each H;
- R 4 and R 5 are each independently H or OH
- R 8 is OH, NH 2 , ORc, or NHR C ;
- R 9 is H or OH
- X is -S-, -S(O)-, or -SO 2 -;
- R c is as defined above.
- amatoxin conjugates are described, for example, in US Patent Nos. 9,233,173 and 9,399,681 , as well as in US 2016/0089450, the disclosures of each of which are incorporated herein by reference in their entirety.
- amatoxins that may be used for conjugation to an antibody, or antigen- binding fragment thereof, in accordance with the compositions and methods described herein are described, for example, in WO 2016/142049; WO 2016/071856; WO
- Am-L-Z is represented by formula (II), formula (MA), or formula (MB)
- Ri is H or a linker covalently bound to the antibody or antigen-binding fragment thereof through a chemical moeity Z, formed from a coupling reaction between a reactive substituent present on the linker and a reactive substituent present within an antibody, or antigen-binding fragment thereof; and R 2 is H or a linker covalently bound to the antibody or antigen-binding fragment thereof through a chemical moeity Z, formed from a coupling reaction between a reactive substituent present on the linker and a reactive substituent present within an antibody, or antigen-binding fragment thereof; wherein when R is H, R 2 is the linker, and when R 2 is H, R is the linker.
- Am-L-Z-Ab is:
- Am-L-Z-Ab is:
- the cytotoxin is an a-amanitin.
- the a-amanitin is a compound of formula III.
- the ⁇ -amanitin of formula III is attached to an anti-CD1 17 antibody via a linker L.
- the linker L may be attached to the ⁇ -amanitin of formula III at any one of several possible positions (e.g., any of R 1 -R 9 ) to provide an a-amanitin-linker conjugate of formula I, IA, IB, II, HA, or MB.
- the linker is attached at position R 1 .
- the linker is attached at position R 2 .
- the linker is attached at position R 3 . In some embodiments, the linker is attached at position R 4 . In some embodiments, the linker is attached at position R 5 . In some embodiments, the linker is attached at position R 6 . In some embodiments, the linker is attached at position R 7 . In some embodiments, the linker is attached at position R 8 . In some embodiments, the linker is attached at position R 9 . In some embodiments, the linker includes a hydrazine, a disulfide, a thioether or a dipeptide. In some embodiments, the linker includes a dipeptide selected from Val-Ala and Val-Cit.
- PAB para-aminobenzyl group
- the cytotoxin is a ⁇ -amanitin.
- the a- amanitin is a compound of formula III.
- the ⁇ -amanitin of formula III is attached to an anti-CD1 17 antibody via a linker L.
- the linker L may be attached to the ⁇ -amanitin of formula III at any one of several possible positions (e.g., any of R 1 -R 9 ) to provide an ⁇ -amanitin-linker conjugate of formula I, IA, IB, II, HA, or MB.
- the linker is attached at position R 1 .
- the linker is attached at position R 2 .
- the linker is attached at position R 3 . In some embodiments, the linker is attached at position R 4 . In some embodiments, the linker is attached at position R 5 . In some embodiments, the linker is attached at position R 6 . In some embodiments, the linker is attached at position R 7 . In some embodiments, the linker is attached at position R 8 . In some embodiments, the linker is attached at position R 9 . In some embodiments, the linker includes a hydrazine, a disulfide, a thioether or a dipeptide. In some embodiments, the linker includes a dipeptide selected from Val-Ala and Val-Cit.
- PAB para-aminobenzyl group
- the cytotoxin is a ⁇ -amanitin.
- the ⁇ - amanitin is a compound of formula III.
- the ⁇ -amanitin of formula III is attached to an anti-CD1 17 antibody via a linker L.
- the linker L may be attached to the ⁇ -amanitin of formula III at any one of several possible positions (e.g., any of R 1 -R 9 ) to provide an ⁇ -amanitin-linker conjugate of formula I, IA, IB, II, MA, or MB.
- the linker is attached at position R 1 .
- the linker is attached at position R 2 .
- the linker is attached at position R 3 . In some embodiments, the linker is attached at position R 4 . In some embodiments, the linker is attached at position R 5 . In some embodiments, the linker is attached at position R 6 . In some embodiments, the linker is attached at position R 7 . In some embodiments, the linker is attached at position R 8 . In some embodiments, the linker is attached at position R 9 . In some embodiments, the linker includes a hydrazine, a disulfide, a thioether or a dipeptide. In some embodiments, the linker includes a dipeptide selected from Val-Ala and Val-Cit.
- PAB para-aminobenzyl group
- the cytotoxin is a ⁇ -amanitin.
- the ⁇ -amanitin is a compound of formula III.
- the ⁇ -amanitin of formula III is attached to an anti-CD1 17 antibody via a linker L.
- the linker L may be attached to the ⁇ -amanitin of formula III at any one of several possible positions (e.g., any of R 1 -R 9 ) to provide an ⁇ -amanitin-linker conjugate of formula I, IA, IB, II, HA, or MB.
- the linker is attached at position R 1 .
- the linker is attached at position R 2 .
- the linker is attached at position R 3 . In some embodiments, the linker is attached at position R 4 . In some embodiments, the linker is attached at position R 5 . In some embodiments, the linker is attached at position R 6 . In some embodiments, the linker is attached at position R 7 . In some embodiments, the linker is attached at position R 8 . In some embodiments, the linker is attached at position R 9 . In some embodiments, the linker includes a hydrazine, a disulfide, a thioether or a dipeptide. In some embodiments, the linker includes a dipeptide selected from Val-Ala and Val-Cit.
- PAB para-aminobenzyl group
- the cytotoxin is an amanin.
- the amanin. is a compound of formula III.
- the amanin of formula III is attached to an anti-CD1 17 antibody via a linker L.
- the linker L may be attached to the amanin of formula III at any one of several possible positions (e.g., any of R 1 -R 9 ) to provide an amanin-linker conjugate of formula I, IA, IB, II, HA, or MB.
- the linker is attached at position R 1 . In some embodiments, the linker is attached at position R 2 . In some embodiments, the linker is attached at position R 3 . In some embodiments, the linker is attached at position R 4 . In some embodiments, the linker is attached at position R 5 . In some embodiments, the linker is attached at position R 6 . In some embodiments, the linker is attached at position R 7 . In some embodiments, the linker is attached at position R 8 . In some embodiments, the linker is attached at position R 9 . In some embodiments, the linker includes a hydrazine, a disulfide, a thioether or a dipeptide.
- PAB para-aminobenzyl group
- the cytotoxin is an amaninamide.
- the amaninamide is a compound of formula III.
- the amaninamide of formula III is attached to an anti-CD1 17 antibody via a linker L.
- the linker L may be attached to the amaninamide of formula III at any one of several possible positions (e.g., any of R 1 -R 9 ) to provide an amaninamide-linker conjugate of formula I, IA, IB, II, MA, or MB.
- the linker is attached at position R 1 .
- the linker is attached at position R 2 .
- the linker is attached at position R 3 .
- the linker is attached at position R 4 . In some embodiments, the linker is attached at position R 5 . In some embodiments, the linker is attached at position R 6 . In some embodiments, the linker is attached at position R 7 . In some embodiments, the linker is attached at position R 8 . In some embodiments, the linker is attached at position R 9 . In some embodiments, the linker includes a hydrazine, a disulfide, a thioether or a dipeptide. In some embodiments, the linker includes a dipeptide selected from Val-Ala and Val-Cit. In some embodiments, the linker includes a para- aminobenzyl group (PAB).
- PAB para- aminobenzyl group
- the cytotoxin is an amanullin.
- the amanullin is a compound of formula III.
- the amanullin of formula III is attached to an anti-CD1 17 antibody via a linker L.
- the linker L may be attached to the amanullin of formula III at any one of several possible positions (e.g., any of R 1 -R 9 ) to provide an amanullin-linker conjugate of formula I, IA, IB, II, MA, or MB.
- the linker is attached at position R 1 .
- the linker is attached at position R 2 .
- the linker is attached at position R 3 . In some embodiments, the linker is attached at position R 4 . In some embodiments, the linker is attached at position R 5 . In some embodiments, the linker is attached at position R 6 . In some embodiments, the linker is attached at position R 7 . In some embodiments, the linker is attached at position R 8 . In some embodiments, the linker is attached at position R 9 . In some embodiments, the linker includes a hydrazine, a disulfide, a thioether or a dipeptide. In some embodiments, the linker includes a dipeptide selected from Val-Ala and Val-Cit.
- PAB para- aminobenzyl group
- the cytotoxin is an amanullinic acid.
- the amanullinic acid is a compound of formula III.
- the amanullinic acid of formula III is attached to an anti-CD1 17 antibody via a linker L.
- the linker L may be attached to the amanullinic acid of formula III at any one of several possible positions (e.g., any of R 1 -R 9 ) to provide an amanullinic acid -linker conjugate of formula I, IA, IB, II, MA, or MB.
- the linker is attached at position R 1 .
- the linker is attached at position R 2 .
- the linker is attached at position R 3 . In some embodiments, the linker is attached at position R 4 . In some embodiments, the linker is attached at position R 5 . In some embodiments, the linker is attached at position R 6 . In some embodiments, the linker is attached at position R 7 . In some embodiments, the linker is attached at position R 8 . In some embodiments, the linker is attached at position R 9 . In some embodiments, the linker includes a hydrazine, a disulfide, a thioether or a dipeptide. In some embodiments, the linker includes a dipeptide selected from Val-Ala and Val-Cit.
- PAB para- aminobenzyl group
- the cytotoxin is a proamanullin.
- the proamanullin is a compound of formula III.
- the proamanullin of formula III is attached to an anti-CD1 17 antibody via a linker L.
- the linker L may be attached to the proamanullin of formula I II at any one of several possible positions (e.g., any of R 1 -R 9 ) to provide an proamanullin -linker conjugate of formula I, IA, IB, II, MA, or MB.
- the linker is attached at position R 1 .
- the linker is attached at position R 2 .
- the linker is attached at position R 3 . In some embodiments, the linker is attached at position R 4 . In some embodiments, the linker is attached at position R 5 . In some embodiments, the linker is attached at position R 6 . In some embodiments, the linker is attached at position R 7 . In some embodiments, the linker is attached at position R 8 . In some embodiments, the linker is attached at position R 9 . In some embodiments, the linker includes a hydrazine, a disulfide, a thioether or a dipeptide. In some embodiments, the linker includes a dipeptide selected from Val-Ala and Val-Cit.
- PAB para- aminobenzyl group
- Antibodies, and antigen-binding fragments, for use with the compositions and methods described herein can be conjugated to an amatoxin, such as a-amanitin or a variant thereof, using conjugation techniques known in the art or described herein.
- an amatoxin such as a-amanitin or a variant thereof
- antibodies, and antigen-binding fragments thereof, that recognize and bind CD1 17 can be conjugated to an amatoxin, such as a-amanitin or a variant thereof, as described in US 2015/0218220, the disclosure of which is incorporated herein by reference as it pertains, for example, to amatoxins, such as a- amanitin and variants thereof, as well as covalent linkers that can be used for covalent conjugation.
- Exemplary antibody-drug conjugates useful in conjunction with the methods described herein may be formed by the reaction of an antibody, or antigen-binding fragment thereof, with an amatoxin that is conjugated to a linker containing a substituent suitable for reaction with a reactive residue on the antibody, or antigen-binding fragment thereof.
- Amatoxins that are conjugated to a linker containing a substituent suitable for reaction with a reactive residue on the antibody, or antigen-binding fragment thereof, described herein include, without limitation, 7'C-(4-(6-(maleimido)hexanoyl)piperazin-1 -yl)- amatoxin; 7'C-(4-(6-(maleimido)hexanamido)piperidin-1 -yl)-amatoxin; 7'C-(4-(6-(6- (maleimido)hexanamido)hexanoyl)piperazin-1 -yl)-amatoxin; 7'C-(4-(4- ((maleimido)methyl)cyclohexanecarbonyl)piperazin-1 -yl)-amatoxin; 7'C-(4-(6-(4- ((maleimido)methyl)cyclohexanecarboxamido)hexanoy
- compositions and methods described herein are described, for example, in US Patent Application Publication No. 2015/0218220, the disclosure of which is incorporated herein by reference in its entirety.
- Additional cytotoxins that can be conjugated to antibodies, or antigen-binding fragments thereof, that recognize and bind CD1 17 (such as GNNK+ CD1 17 for use in directly treating a cancer, autommine condition, or for conditioning a patient (e.g., a human patient) in preparation for hematopoietic stem cell transplant therapy include, without limitation, 5- ethynyluracil, abiraterone, acylfulvene, adecypenol, adozelesin, aldesleukin, altretamine, ambamustine, amidox, amifostine, aminolevulinic acid, amrubicin, amsacrine, anagrelide, anastrozole, andrographolide, angiogenesis inhibitors, antarelix, anti-dorsalizing
- morphogenetic protein-1 antiandrogen, prostatic carcinoma, antiestrogen, antineoplaston, antisense oligonucleotides, aphidicolin glycinate, apoptosis gene modulators, apoptosis regulators, apurinic acid, asulacrine, atamestane, atrimustine, axinastatin 1 , axinastatin 2, axinastatin 3, azasetron, azatoxin, azatyrosine, baccatin III derivatives, balanol, batimastat, BCR/ABL antagonists, benzochlorins, benzoylstaurosporine, beta lactam derivatives, beta- alethine, betaclamycin B, betulinic acid, bFGF inhibitors, bicalutamide, bisantrene, bisaziridinylspermine, bisnafide, bistratene A, bizelesin, breflate,
- oxaunomycin, paclitaxel and analogues thereof palauamine, palmitoylrhizoxin, pamidronic acid, panaxytriol, panomifene, parabactin, pazelliptine, pegaspargase, peldesine, pentosan polysulfate sodium, pentostatin, pentrozole, perflubron, perfosfamide, phenazinomycin, picibanil, pirarubicin, piritrexim, podophyllotoxin, porfiromycin, purine nucleoside
- phosphorylase inhibitors raltitrexed, rhizoxin, rogletimide, rohitukine, rubiginone B1 , ruboxyl, safingol, saintopin, sarcophytol A, sargramostim, sobuzoxane, sonermin, sparfosic acid, spicamycin D, spiromustine, stipiamide, sulfinosine, tallimustine, tegafur, temozolomide, teniposide, thaliblastine, thiocoraline, tirapazamine, topotecan, topsentin, triciribine, trimetrexate, veramine, vinorelbine, vinxaltine, vorozole, zeniplatin, and zilascorb, among others.
- linkers can be used to conjugate antibodies, or antigen-binding
- fragments described herein (e.g., antibodies, or antigen-binding fragments thereof, that recognize and bind CD1 17 (such as GNNK+ CD1 17) with a cytotoxic molecule.
- Linker means a divalent chemical moiety comprising a covalent bond or a chain of atoms that covalently attaches an antibody or fragment thereof (Ab) to a drug moiety (D) to form antibody-drug conjugates of the present
- Suitable linkers have two reactive termini, one for conjugation to an antibody and the other for conjugation to a cytotoxin.
- the antibody conjugation reactive terminus of the linker (reactive moiety, Z') is typically a site that is capable of conjugation to the antibody through a cysteine thiol or lysine amine group on the antibody, and so is typically a thiol-reactive group such as a double bond (as in maleimide) or a leaving group such as a chloro, bromo, iodo, or an R-sulfanyl group, or an amine- reactive group such as a carboxyl group; while the antibody conjugation reactive terminus of the linker is typically a site that is capable of conjugation to the cytotoxin through formation of an amide bond with a basic amine or carboxyl group on the cytotoxin, and so is typically a carboxyl or basic amine group.
- linker When the term "linker” is used in describing the linker in conjugated form, one or both of the reactive termini will be absent (such as reactive moiety Z, having been converted to chemical moiety Z) or incomplete (such as being only the carbonyl of the carboxylic acid) because of the formation of the bonds between the linker and/or the cytotoxin, and between the linker and/or the antibody or antigen-binding fragment thereof.
- conjugation reactions are described further herein below.
- the linker is cleavable under intracellular conditions, such that cleavage of the linker releases the drug unit from the antibody in the intracellular environment.
- the linker unit is not cleavable and the drug is released, for example, by antibody degradation.
- the linkers useful for the present ADCs are preferably stable extracellularly, prevent aggregation of ADC molecules and keep the ADC freely soluble in aqueous media and in a monomeric state. Before transport or delivery into a cell, the ADC is preferably stable and remains intact, i.e. the antibody remains linked to the drug moiety.
- the linkers are stable outside the target cell and may be cleaved at some efficacious rate inside the cell.
- An effective linker will: (i) maintain the specific binding properties of the antibody; (ii) allow intracellular delivery of the conjugate or drug moiety; (iii) remain stable and intact, i.e. not cleaved, until the conjugate has been delivered or transported to its targeted site; and (iv) maintain a cytotoxic, cell-killing effect or a cytostatic effect of the cytotoxic moiety.
- Stability of the ADC may be measured by standard analytical techniques such as mass spectroscopy, HPLC, and the
- LC/MS separation/analysis technique
- Covalent attachment of the antibody and the drug moiety requires the linker to have two reactive functional groups, i.e. bivalency in a reactive sense.
- Bivalent linker reagents which are useful to attach two or more functional or biologically active moieties, such as peptides, nucleic acids, drugs, toxins, antibodies, haptens, and reporter groups are known, and methods have been described their resulting conjugates (Hermanson, G. T. (1996) Bioconjugate Techniques; Academic Press: New York, p. 234-242).
- Linkers include those that may be cleaved, for instance, by enzymatic hydrolysis, photolysis, hydrolysis under acidic conditions, hydrolysis under basic conditions, oxidation, disulfide reduction, nucleophilic cleavage, or organometallic cleavage (see, for example, Leriche et al., Bioorg. Med. Chem., 20:571 -582, 2012, the disclosure of which is incorporated herein by reference as it pertains to linkers suitable for covalent
- Linkers hydrolyzable under acidic conditions include, for example, hydrazones, semicarbazones, thiosemicarbazones, cis-aconitic amides, orthoesters, acetals, ketals, or the like.
- hydrazones semicarbazones, thiosemicarbazones, cis-aconitic amides, orthoesters, acetals, ketals, or the like.
- linkers suitable for covalent conjugation are relatively stable under neutral pH conditions, such as those in the blood, but are unstable at below pH 5.5 or 5.0, the approximate pH of the lysosome.
- Linkers cleavable under reducing conditions include, for example, a disulfide.
- a variety of disulfide linkers are known in the art, including, for example, those that can be formed using SATA (N-succinimidyl-S-acetylthioacetate), SPDP (N-succinimidyl-3-(2- pyridyldithio)propionate), SPDB (N-succinimidyl-3-(2-pyridyldithio)butyrate) and SMPT (N- succinimidyl-oxycarbonyl-alpha-methyl-alpha-(2-pyridyl-dithio)toluene), SPDB and SMPT (See, e.g., Thorpe et al., 1987, Cancer Res.
- Additional linkers suitable for the synthesis of drug-antibody conjugates as described herein include those capable of releasing a cytotoxin by a 1 ,6-elimination process (a "self-immolative" group), such as p-aminobenzyl alcohol (PABC), p- aminobenzyl (PAB), 6-maleimidohexanoic acid, pH-sensitive carbonates, and other reagents described in Jain et al., Pharm. Res. 32:3526-3540, 2015, the disclosure of which is incorporated herein by reference in its entirety.
- PABC p-aminobenzyl alcohol
- PAB p- aminobenzyl
- 6-maleimidohexanoic acid pH-sensitive carbonates
- the linker includes a self-immolative group such as the afore-mentioned PAB or PABC (para-aminobenzyloxycarbonyl), which are disclosed in, for example, Carl et al., J. Med. Chem. (1981 ) 24:479-480; Chakravarty et al (1983) J.
- PAB para-aminobenzyloxycarbonyl
- self-immolative linkers include methylene carbamates and heteroaryl groups such as aminothiazoles, aminoimidazoles, aminopyrimidines, and the like. Linkers containing such heterocyclic self-immolative groups are disclosed in, for example, U.S. Patent Publication Nos. 20160303254 and
- Linkers susceptible to enzymatic hydrolysis can be, e.g., a peptide-containing linker that is cleaved by an intracellular peptidase or protease enzyme, including, but not limited to, a lysosomal or endosomal protease.
- intracellular proteolytic release of the therapeutic agent is that the agent is typically attenuated when conjugated and the serum stabilities of the conjugates are typically high.
- the peptidyl linker is at least two amino acids long or at least three amino acids long.
- Exemplary amino acid linkers include a dipeptide, a tripeptide, a tetrapeptide or a pentapeptide.
- suitable peptides include those containing amino acids such as Valine, Alanine, Citrulline (Cit), Phenylalanine, Lysine, Leucine, and Glycine.
- Amino acid residues which comprise an amino acid linker component include those occurring naturally, as well as minor amino acids and non-naturally occurring amino acid analogs, such as citrulline.
- Exemplary dipeptides include valine-citrulline (vc or val-cit) and alanine-phenylalanine (af or ala-phe).
- Exemplary tripeptides include glycine-valine- citrulline (gly-val-cit) and glycine-glycine-glycine-glycine (gly-gly-gly).
- the linker includes a dipeptide such as Val-Cit, Ala-Val, or Phe-Lys, Val-Lys, Ala-Lys, Phe-Cit, Leu-Cit, lle-Cit, Phe-Arg, or Trp-Cit.
- Linkers containing dipeptides such as Val-Cit or Phe- Lys are disclosed in, for example, U.S. Pat. No. 6,214,345, the disclosure of which is incorporated herein by reference in its entirety as it pertains to linkers suitable for covalent conjugation.
- the linker includes a dipeptide selected from Val-Ala and Val-Cit.
- a dipeptide is used in combination with a self- immolative linker.
- Linkers suitable for use herein further may include one or more groups selected from C C 6 alkylene, C C 6 heteroalkylene, C 2 -C 6 alkenylene, C 2 -C 6 heteroalkenylene, C 2 - C 6 alkynylene, C 2 -C 6 heteroalkynylene, C 3 -C 6 cycloalkylene, heterocycloalkylene, arylene, heteroarylene, and combinations thereof, each of which may be optionally substituted.
- the linker includes a p-aminobenzyl group (PAB).
- PAB p-aminobenzyl group
- the p-aminobenzyl group is disposed between the cytotoxic drug and a protease cleavage site in the linker.
- the p-aminobenzyl group is part of a p-aminobenzyloxycarbonyl unit.
- the p-aminobenzyl group is part of a p-aminobenzylamido unit.
- the linker comprises PAB, Val-Cit-PAB, Val-Ala- PAB, Val-Lys(Ac)-PAB, Phe-Lys-PAB, Phe-Lys(Ac)-PAB, D-Val-Leu-Lys, Gly-Gly-Arg, Ala-Ala-Asn-PAB, or Ala-PAB.
- the linker comprises a combination of one or more of a peptide, oligosaccharide, -(CH 2 ) n -, -(CH 2 CH 2 0) n -, PAB, Val-Cit-PAB, Val-Ala-PAB, Val- Lys(Ac)-PAB, Phe-Lys-PAB, Phe-Lys(Ac)-PAB, D-Val-Leu-Lys, Gly-Gly-Arg, Ala-Ala-Asn- PAB, or Ala-PAB.
- Linkers that can be used to conjugate an antibody, or antigen-binding fragment thereof, to a cytotoxic agent include those that are covalently bound to the cytotoxic agent on one end of the linker and, on the other end of the linker, contain a chemical moiety formed from a coupling reaction between a reactive substituent present on the linker and a reactive substituent present within the antibody, or antigen-binding fragment thereof, that binds CD1 17 (such as GNNK+ CD1 17).
- Reactive substituents that may be present within an antibody, or antigen-binding fragment thereof, that binds CD1 17 include, without limitation, hydroxyl moieties of serine, threonine, and tyrosine residues; amino moieties of lysine residues; carboxyl moieties of aspartic acid and glutamic acid residues; and thiol moieties of cysteine residues, as well as propargyl, azido, haloaryl (e.g., fluoroaryl), haloheteroaryl (e.g., fluoroheteroaryl), haloalkyl, and haloheteroalkyl moieties of non-naturally occurring amino acids.
- haloaryl e.g., fluoroaryl
- haloheteroaryl e.g., fluoroheteroaryl
- haloalkyl e.g., fluoroheteroaryl
- linkers useful for the synthesis of drug-antibody conjugates include those that contain electrophiles, such as Michael acceptors (e.g., maleimides), activated esters, electron-deficient carbonyl compounds, and aldehydes, among others, suitable for reaction with nucleophilic substituents present within antibodies or antigen-binding fragments, such as amine and thiol moieties.
- electrophiles such as Michael acceptors (e.g., maleimides), activated esters, electron-deficient carbonyl compounds, and aldehydes, among others, suitable for reaction with nucleophilic substituents present within antibodies or antigen-binding fragments, such as amine and thiol moieties.
- linkers suitable for the synthesis of drug-antibody conjugates include, without limitation, succinimidyl 4-(N- maleimidomethyl)-cyclohexane-L-carboxylate (SMCC), N- succinimidyl iodoacetate (SIA), sulfo-SMCC, m-maleimidobenzoyl-A/-hydroxysuccinimidyl ester (MBS), sulfo-MBS, and succinimidyl iodoacetate, among others described, for instance, Liu et al., 18:690-697, 1979, the disclosure of which is incorporated herein by reference as it pertains to linkers for chemical conjugation.
- SMCC succinimidyl 4-(N- maleimidomethyl)-cyclohexane-L-carboxylate
- SIA N- succinimidyl iodoacetate
- MBS m-maleimidobenzoyl-A/-hydroxysuccinimid
- Additional linkers include the non-cleavable maleimidocaproyl linkers, which are particularly useful for the conjugation of microtubule-disrupting agents such as auristatins, are described by Doronina et al., Bioconjugate Chem. 17:14-24,
- Linkers useful in conjunction with the antibody-drug described herein include, without limitation, linkers containing chemical moieties formed by coupling reactions as depicted in Table 1 , below. Curved lines designate points of attachment to the antibody, or antigen-binding fragment, and the cytotoxic molecule, respectively.
- antibody-drug conjugates useful in conjunction with the methods described herein may be formed by the reaction of an antibody, or antigen-binding fragment thereof, with a linker or cytotoxin-linker conjugate, as described herein, the linker or cytotoxin-linker conjugate including a reactive substituent Z, suitable for reaction with a reactive substituent on the antibody, or antigen- binding fragment thereof, to form the chemical moiety Z.
- examples of suitably reactive substituents on the linker and antibody or antigen-binding fragment thereof include a nucleophile/electrophile pair (e.g., a thiol/haloalkyl pair, an amine/carbonyl pair, or a thiol/ ⁇ , ⁇ -unsaturated carbonyl pair, and the like), a diene/dienophile pair (e.g., an azide/alkyne pair, or a diene/ ⁇ , ⁇ - unsaturated carbonyl pair, among others), and the like.
- a nucleophile/electrophile pair e.g., a thiol/haloalkyl pair, an amine/carbonyl pair, or a thiol/ ⁇ , ⁇ -unsaturated carbonyl pair, and the like
- a diene/dienophile pair e.g., an azide/alkyne pair, or a diene/ ⁇ , ⁇
- Coupling reactions between the reactive substitutents to form the chemical moiety Z include, without limitation, thiol alkylation, hydroxyl alkylation, amine alkylation, amine or hydroxylamine condensation, hydrazine formation, amidation, esterification, disulfide formation, cycloaddition (e.g., [4+2] Diels-Alder cycloaddition, [3+2] Huisgen cycloaddition, among others), nucleophilic aromatic substitution, electrophilic aromatic substitution, and other reactive modalities known in the art or described herein.
- the linker contains an electrophilic functional group for reaction with a nucleophilic functional group on the antibody, or antigen-binding fragment thereof.
- Reactive substituents that may be present within an antibody, or antigen-binding fragment thereof, as disclosed herein include, without limitation, nucleophilic groups such as (i) N-terminal amine groups, (ii) side chain amine groups, e.g. lysine, (iii) side chain thiol groups, e.g. cysteine, and (iv) sugar hydroxyl or amino groups where the antibody is glycosylated.
- nucleophilic groups such as (i) N-terminal amine groups, (ii) side chain amine groups, e.g. lysine, (iii) side chain thiol groups, e.g. cysteine, and (iv) sugar hydroxyl or amino groups where the antibody is glycosylated.
- Reactive substituents that may be present within an antibody, or antigen- binding fragment thereof, as disclosed herein include, without limitation, hydroxyl moieties of serine, threonine, and tyrosine residues; amino moieties of lysine residues; carboxyl moieties of aspartic acid and glutamic acid residues; and thiol moieties of cysteine residues, as well as propargyl, azido, haloaryl (e.g., fluoroaryl), haloheteroaryl (e.g., fluoroheteroaryl), haloalkyi, and haloheteroalkyi moieties of non-naturally occurring amino acids.
- haloaryl e.g., fluoroaryl
- haloheteroaryl e.g., fluoroheteroaryl
- haloalkyi e.g., fluoroheteroaryl
- the reactive substituents present within an antibody, or antigen-binding fragment thereof as disclosed herein include, are amine or thiol moieties.
- Certain antibodies have reducible interchain disulfides, i.e. cysteine bridges.
- Antibodies may be made reactive for conjugation with linker reagents by treatment with a reducing agent such as DTT (dithiothreitol).
- DTT dithiothreitol
- Each cysteine bridge will thus form, theoretically, two reactive thiol nucleophiles. Additional nucleophilic groups can be introduced into antibodies through the reaction of lysines with 2-iminothiolane (Traut's reagent) resulting in conversion of an amine into a thiol.
- Reactive thiol groups may be introduced into the antibody (or fragment thereof) by introducing one, two, three, four, or more cysteine residues (e.g., preparing mutant antibodies comprising one or more non-native cysteine amino acid residues).
- cysteine residues e.g., preparing mutant antibodies comprising one or more non-native cysteine amino acid residues.
- U.S. Pat. No. 7,521 ,541 teaches engineering antibodies by introduction of reactive cysteine amino acids.
- the reactive moiety Z attached to the linker is a
- nucleophilic group which is reactive with an electrophilic group present on an antibody.
- Useful electrophilic groups on an antibody include, but are not limited to, aldehyde and ketone carbonyl groups.
- the heteroatom of a nucleophilic group can react with an electrophilic group on an antibody and form a covalent bond to the antibody.
- Useful nucleophilic groups include, but are not limited to, hydrazide, oxime, amino, hydroxyl, hydrazine, thiosemicarbazone, hydrazine carboxylate, and arylhydrazide.
- Z is the product of a reaction between reactive nucleophilic substituents present within the antibodies, or antigen-binding fragments thereof, such as amine and thiol moieties, and a reactive electrophilic substituent Z.
- Z may be a Michael acceptor (e.g., maleimide), activated ester, electron-deficient carbonyl compound, or an aldehyde, among others.
- the ADC comprises an anti-CD1 17 antibody conjugated to an amatoxin of any of formulae I, IA, IB, II, HA, or MB as disclosed herein via la inker and a chemical moiety Z.
- the linker includes a hydrazine, a disulfide, a thioether or a dipeptide.
- the linker includes a dipeptide selected from Val-Ala and Val-Cit.
- the linker includes a para-aminobenzyl group (PAB).
- PAB para-aminobenzyl group
- the linker includes the moiety PAB-Cit-Val.
- the linker includes the moiety PAB-Ala-Val.
- the chemical moiety Z is selected from Table 1 .
- the chemical moiety Z is where S is a sulfur atom which represents the reactive substituent present within an antibody,or antigen-binding fragment thereof, that binds CD1 17 (e.g., from the -SH group of a cysteine residue).
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Molecular Biology (AREA)
- Epidemiology (AREA)
- Cell Biology (AREA)
- Toxicology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biochemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Developmental Biology & Embryology (AREA)
- Reproductive Health (AREA)
- Transplantation (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Biotechnology (AREA)
- Gynecology & Obstetrics (AREA)
- Virology (AREA)
- Zoology (AREA)
- Biomedical Technology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Medicinal Preparation (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU2018354189A AU2018354189A1 (en) | 2017-10-24 | 2018-10-23 | Compositions and methods for the depletion of CD117+ cells |
| CN201880084218.6A CN111601616A (zh) | 2017-10-24 | 2018-10-23 | 用于耗尽cd117+细胞的组合物和方法 |
| EP18870344.1A EP3700540A4 (en) | 2017-10-24 | 2018-10-23 | COMPOSITIONS AND METHODS OF DEPRODUCTION FROM CD117 + CELLS |
| JP2020523448A JP2021500391A (ja) | 2017-10-24 | 2018-10-23 | Cd117+細胞を減少させるための組成物及び方法 |
| CA3079215A CA3079215A1 (en) | 2017-10-24 | 2018-10-23 | Compositions and methods for the depletion of cd117+ cells |
| JP2023092860A JP2023116596A (ja) | 2017-10-24 | 2023-06-06 | Cd117+細胞を減少させるための組成物及び方法 |
Applications Claiming Priority (24)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201762576629P | 2017-10-24 | 2017-10-24 | |
| US201762576593P | 2017-10-24 | 2017-10-24 | |
| US201762576625P | 2017-10-24 | 2017-10-24 | |
| US201762576605P | 2017-10-24 | 2017-10-24 | |
| US201762576588P | 2017-10-24 | 2017-10-24 | |
| US201762576571P | 2017-10-24 | 2017-10-24 | |
| US201762576597P | 2017-10-24 | 2017-10-24 | |
| US201762576628P | 2017-10-24 | 2017-10-24 | |
| US201762576590P | 2017-10-24 | 2017-10-24 | |
| US201762576626P | 2017-10-24 | 2017-10-24 | |
| US62/576,588 | 2017-10-24 | ||
| US62/576,597 | 2017-10-24 | ||
| US62/576,605 | 2017-10-24 | ||
| US62/576,628 | 2017-10-24 | ||
| US62/576,625 | 2017-10-24 | ||
| US62/576,593 | 2017-10-24 | ||
| US62/576,590 | 2017-10-24 | ||
| US62/576,629 | 2017-10-24 | ||
| US62/576,571 | 2017-10-24 | ||
| US62/576,626 | 2017-10-24 | ||
| US201862638049P | 2018-03-02 | 2018-03-02 | |
| US201862638051P | 2018-03-02 | 2018-03-02 | |
| US62/638,049 | 2018-03-02 | ||
| US62/638,051 | 2018-03-02 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2019084057A2 true WO2019084057A2 (en) | 2019-05-02 |
| WO2019084057A3 WO2019084057A3 (en) | 2019-06-06 |
Family
ID=66247640
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2018/057172 Ceased WO2019084057A2 (en) | 2017-10-24 | 2018-10-23 | COMPOSITIONS AND METHODS FOR DEPLOYING CD117 + CELLS |
Country Status (8)
| Country | Link |
|---|---|
| US (2) | US10882915B2 (https=) |
| EP (1) | EP3700540A4 (https=) |
| JP (2) | JP2021500391A (https=) |
| CN (1) | CN111601616A (https=) |
| AU (1) | AU2018354189A1 (https=) |
| CA (1) | CA3079215A1 (https=) |
| TW (1) | TW201922782A (https=) |
| WO (1) | WO2019084057A2 (https=) |
Cited By (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2020219774A1 (en) * | 2019-04-24 | 2020-10-29 | Magenta Therapeutics, Inc. | Anthracycline antibody-drug conjugates and uses thereof |
| US10882915B2 (en) * | 2017-10-24 | 2021-01-05 | Magenta Therapeutics, Inc. | Compositions and methods for the depletion of CD117+ cells |
| WO2021074261A1 (en) * | 2019-10-15 | 2021-04-22 | Heidelberg Pharma Research Gmbh | B-lymphocyte specific amatoxin antibody conjugates |
| US20220177578A1 (en) * | 2019-04-24 | 2022-06-09 | Magenta Therapeutics, Inc. | Anti-cd117 antibodies and uses thereof |
| CN115667314A (zh) * | 2020-03-16 | 2023-01-31 | 美真达治疗公司 | T细胞双特异性结合蛋白 |
| WO2023111311A1 (en) * | 2021-12-16 | 2023-06-22 | Universität Basel | Discernible cell surface protein variants of cd117 for use in cell therapy |
| EP3958899A4 (en) * | 2019-04-24 | 2023-08-02 | Magenta Therapeutics, Inc. | ANTI-CD117 ANTIBODY-DRUG CONJUGATES AND THEIR USES |
| US12133884B2 (en) | 2018-05-11 | 2024-11-05 | Beam Therapeutics Inc. | Methods of substituting pathogenic amino acids using programmable base editor systems |
Families Citing this family (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2018183613A1 (en) | 2017-03-31 | 2018-10-04 | The Children's Medical Center Corporation | Antibody-mediated conditioning with immunosuppression to enable allogeneic transplantation |
| KR20200069364A (ko) | 2017-10-24 | 2020-06-16 | 마젠타 테라퓨틱스 인코포레이티드 | Cd117+ 세포의 고갈을 위한 조성물 및 방법 |
| AU2019366960A1 (en) * | 2018-10-23 | 2021-05-27 | Regeneron Pharmaceuticals, Inc. | Fc silenced antibody drug conjugates (ADCs) and uses thereof |
| US20200376135A1 (en) * | 2018-10-23 | 2020-12-03 | Magenta Therapeutics, Inc. | Fc silenced antibody drug conjugates (adcs) and uses thereof |
| CA3128755C (en) | 2019-02-13 | 2024-06-04 | Beam Therapeutics Inc. | Compositions and methods for treating hemoglobinopathies |
| EP3773918A4 (en) | 2019-03-05 | 2022-01-05 | Nkarta, Inc. | CD19 DIRECTED CHIMERIC ANTIGEN RECEPTORS AND THEIR USES IN IMMUNOTHERAPY |
| JP2022531141A (ja) * | 2019-04-24 | 2022-07-06 | マジェンタ セラピューティクス インコーポレイテッド | 遺伝子治療のコンディショニング方法 |
| WO2020252455A1 (en) | 2019-06-13 | 2020-12-17 | The General Hospital Corporation | Engineered human-endogenous virus-like particles and methods of use thereof for delivery to cells |
| CN120204384A (zh) * | 2019-08-06 | 2025-06-27 | 葛兰素史密斯克莱知识产权发展有限公司 | 生物药物组合物和相关方法 |
| EP4022051A4 (en) * | 2019-08-29 | 2024-01-10 | Beam Therapeutics Inc. | COMPOSITIONS AND METHODS FOR NON-TOXIC CONDITIONING |
| CA3189601A1 (en) | 2020-07-24 | 2022-01-27 | The General Hospital Corporation | Enhanced virus-like particles and methods of use thereof for delivery to cells |
| CN117916267A (zh) * | 2021-07-12 | 2024-04-19 | 恩卡尔塔公司 | Bcma定向细胞免疫疗法组合物和方法 |
| WO2024102954A1 (en) | 2022-11-10 | 2024-05-16 | Massachusetts Institute Of Technology | Activation induced clipping system (aics) |
| EP4724461A1 (en) | 2023-06-07 | 2026-04-15 | The Broad Institute, Inc. | Engineered viral like particles (evlps) for the selective transduction of target cells |
| WO2025149667A1 (en) | 2024-01-12 | 2025-07-17 | Pheon Therapeutics Ltd | Antibody drug conjugates and uses thereof |
| WO2025235862A1 (en) | 2024-05-10 | 2025-11-13 | Inndura Therapeutics Inc. | A modified immune cell receptor comprising a target-binding domain and the extracellular domain of cd16a |
Citations (75)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3896111A (en) | 1973-02-20 | 1975-07-22 | Research Corp | Ansa macrolides |
| US4137230A (en) | 1977-11-14 | 1979-01-30 | Takeda Chemical Industries, Ltd. | Method for the production of maytansinoids |
| US4151042A (en) | 1977-03-31 | 1979-04-24 | Takeda Chemical Industries, Ltd. | Method for producing maytansinol and its derivatives |
| US4248870A (en) | 1978-10-27 | 1981-02-03 | Takeda Chemical Industries, Ltd. | Maytansinoids and use |
| US4256746A (en) | 1978-11-14 | 1981-03-17 | Takeda Chemical Industries | Dechloromaytansinoids, their pharmaceutical compositions and method of use |
| US4260608A (en) | 1978-11-14 | 1981-04-07 | Takeda Chemical Industries, Ltd. | Maytansinoids, pharmaceutical compositions thereof and methods of use thereof |
| US4265814A (en) | 1978-03-24 | 1981-05-05 | Takeda Chemical Industries | Matansinol 3-n-hexadecanoate |
| US4294757A (en) | 1979-01-31 | 1981-10-13 | Takeda Chemical Industries, Ltd | 20-O-Acylmaytansinoids |
| US4307016A (en) | 1978-03-24 | 1981-12-22 | Takeda Chemical Industries, Ltd. | Demethyl maytansinoids |
| US4308268A (en) | 1979-06-11 | 1981-12-29 | Takeda Chemical Industries, Ltd. | Maytansinoids, pharmaceutical compositions thereof and method of use thereof |
| US4308269A (en) | 1979-06-11 | 1981-12-29 | Takeda Chemical Industries, Ltd. | Maytansinoids, pharmaceutical compositions thereof and method of use thereof |
| US4309428A (en) | 1979-07-30 | 1982-01-05 | Takeda Chemical Industries, Ltd. | Maytansinoids |
| US4313946A (en) | 1981-01-27 | 1982-02-02 | The United States Of America As Represented By The Secretary Of Agriculture | Chemotherapeutically active maytansinoids from Trewia nudiflora |
| US4315929A (en) | 1981-01-27 | 1982-02-16 | The United States Of America As Represented By The Secretary Of Agriculture | Method of controlling the European corn borer with trewiasine |
| US4317821A (en) | 1979-06-08 | 1982-03-02 | Takeda Chemical Industries, Ltd. | Maytansinoids, their use and pharmaceutical compositions thereof |
| US4322348A (en) | 1979-06-05 | 1982-03-30 | Takeda Chemical Industries, Ltd. | Maytansinoids |
| US4331598A (en) | 1979-09-19 | 1982-05-25 | Takeda Chemical Industries, Ltd. | Maytansinoids |
| US4362663A (en) | 1979-09-21 | 1982-12-07 | Takeda Chemical Industries, Ltd. | Maytansinoid compound |
| US4364866A (en) | 1979-09-21 | 1982-12-21 | Takeda Chemical Industries, Ltd. | Maytansinoids |
| US4371533A (en) | 1980-10-08 | 1983-02-01 | Takeda Chemical Industries, Ltd. | 4,5-Deoxymaytansinoids, their use and pharmaceutical compositions thereof |
| US4424219A (en) | 1981-05-20 | 1984-01-03 | Takeda Chemical Industries, Ltd. | 9-Thiomaytansinoids and their pharmaceutical compositions and use |
| US4450254A (en) | 1980-11-03 | 1984-05-22 | Standard Oil Company | Impact improvement of high nitrile resins |
| US4681581A (en) | 1983-12-05 | 1987-07-21 | Coates Fredrica V | Adjustable size diaper and folding method therefor |
| US4735210A (en) | 1985-07-05 | 1988-04-05 | Immunomedics, Inc. | Lymphographic and organ imaging method and kit |
| WO1992001047A1 (en) | 1990-07-10 | 1992-01-23 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| US5101827A (en) | 1985-07-05 | 1992-04-07 | Immunomedics, Inc. | Lymphographic and organ imaging method and kit |
| US5102990A (en) | 1989-08-09 | 1992-04-07 | Rhomed Incorporated | Direct radiolabeling of antibodies and other proteins with technetium or rhenium |
| US5413923A (en) | 1989-07-25 | 1995-05-09 | Cell Genesys, Inc. | Homologous recombination for universal donor cells and chimeric mammalian hosts |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| WO1996034096A1 (en) | 1995-04-28 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| WO1996033735A1 (en) | 1995-04-27 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US5621002A (en) | 1993-09-09 | 1997-04-15 | Behringwerke Aktiengesellschaft | Prodrugs for enzyme mediated activation |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5635483A (en) | 1992-12-03 | 1997-06-03 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Tumor inhibiting tetrapeptide bearing modified phenethyl amides |
| US5648237A (en) | 1991-09-19 | 1997-07-15 | Genentech, Inc. | Expression of functional antibody fragments |
| US5648471A (en) | 1987-12-03 | 1997-07-15 | Centocor, Inc. | One vial method for labeling antibodies with Technetium-99m |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5663149A (en) | 1994-12-13 | 1997-09-02 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Human cancer inhibitory pentapeptide heterocyclic and halophenyl amides |
| US5697902A (en) | 1985-07-05 | 1997-12-16 | Immunomedics, Inc. | Method for imaging and treating organs and tissues |
| US5712374A (en) | 1995-06-07 | 1998-01-27 | American Cyanamid Company | Method for the preparation of substantiallly monomeric calicheamicin derivative/carrier conjugates |
| US5714586A (en) | 1995-06-07 | 1998-02-03 | American Cyanamid Company | Methods for the preparation of monomeric calicheamicin derivative/carrier conjugates |
| WO1998013059A1 (en) | 1996-09-27 | 1998-04-02 | Bristol-Myers Squibb Company | Hydrolyzable prodrugs for delivery of anticancer drugs to metastatic cells |
| US5739116A (en) | 1994-06-03 | 1998-04-14 | American Cyanamid Company | Enediyne derivatives useful for the synthesis of conjugates of methyltrithio antitumor agents |
| US5770701A (en) | 1987-10-30 | 1998-06-23 | American Cyanamid Company | Process for preparing targeted forms of methyltrithio antitumor agents |
| US5770710A (en) | 1987-10-30 | 1998-06-23 | American Cyanamid Company | Antitumor and antibacterial substituted disulfide derivatives prepared from compounds possessing a methlytrithio group |
| US5780588A (en) | 1993-01-26 | 1998-07-14 | Arizona Board Of Regents | Elucidation and synthesis of selected pentapeptides |
| US5789199A (en) | 1994-11-03 | 1998-08-04 | Genentech, Inc. | Process for bacterial production of polypeptides |
| WO1998024893A3 (en) | 1996-12-03 | 1998-08-20 | Abgenix Inc | TRANSGENIC MAMMALS HAVING HUMAN IG LOCI INCLUDING PLURAL VH AND Vλ REGIONS AND ANTIBODIES PRODUCED THEREFROM |
| US5814318A (en) | 1990-08-29 | 1998-09-29 | Genpharm International Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5840523A (en) | 1995-03-01 | 1998-11-24 | Genetech, Inc. | Methods and compositions for secretion of heterologous polypeptides |
| US5885793A (en) | 1991-12-02 | 1999-03-23 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US5916771A (en) | 1996-10-11 | 1999-06-29 | Abgenix, Inc. | Production of a multimeric protein by cell fusion method |
| US5939598A (en) | 1990-01-12 | 1999-08-17 | Abgenix, Inc. | Method of making transgenic mice lacking endogenous heavy chains |
| US6214345B1 (en) | 1993-05-14 | 2001-04-10 | Bristol-Myers Squibb Co. | Lysosomal enzyme-cleavable antitumor drug conjugates |
| US6218519B1 (en) | 1996-04-12 | 2001-04-17 | Pro-Neuron, Inc. | Compounds and methods for the selective treatment of cancer and bacterial infections |
| US6268488B1 (en) | 1999-05-25 | 2001-07-31 | Barbas, Iii Carlos F. | Prodrug activation using catalytic antibodies |
| WO2002088172A2 (en) | 2001-04-30 | 2002-11-07 | Seattle Genetics, Inc. | Pentapeptide compounds and uses related thereto |
| US20030096743A1 (en) | 2001-09-24 | 2003-05-22 | Seattle Genetics, Inc. | p-Amidobenzylethers in drug delivery agents |
| US20040018194A1 (en) | 2000-11-28 | 2004-01-29 | Francisco Joseph A. | Recombinant anti-CD30 antibodies and uses thereof |
| US20040052793A1 (en) | 2001-02-22 | 2004-03-18 | Carter Paul J. | Caspase activivated prodrugs therapy |
| WO2004032828A2 (en) | 2002-07-31 | 2004-04-22 | Seattle Genetics, Inc. | Anti-cd20 antibody-drug conjugates for the treatment of cancer and immune disorders |
| US20040121940A1 (en) | 2001-03-23 | 2004-06-24 | De Groot Franciscus Marinus Hendrikus | Elongated and multiple spacers in activatible produgs |
| US6759509B1 (en) | 1996-11-05 | 2004-07-06 | Bristol-Myers Squibb Company | Branched peptide linkers |
| US6835807B1 (en) | 1998-05-22 | 2004-12-28 | Daiichi Pharmaceuticals Co., Ltd. | Drug complex and drug delivery system |
| US20050238649A1 (en) | 2003-11-06 | 2005-10-27 | Seattle Genetics, Inc. | Monomethylvaline compounds capable of conjugation to ligands |
| US20050256030A1 (en) | 2004-02-23 | 2005-11-17 | Bainian Feng | Heterocyclic self-immolative linkers and conjugates |
| US7521541B2 (en) | 2004-09-23 | 2009-04-21 | Genetech Inc. | Cysteine engineered antibodies and conjugates |
| US8552157B2 (en) | 2011-05-12 | 2013-10-08 | Imclone Llc | c-Kit antibodies and uses thereof |
| US20150079114A1 (en) | 2012-04-24 | 2015-03-19 | Seattle Genetics, Inc. | Dr5 ligand drug conjugates |
| US20150218220A1 (en) | 2012-09-12 | 2015-08-06 | Brian Alan MENDELSOHN | Amatoxin derivatives and cell-permeable conjugates thereof as inhibitors of rna polymerase |
| US20160303254A1 (en) | 2013-12-19 | 2016-10-20 | Seattle Genetics, Inc. | Methylene carbamate linkers for use with targeted-drug conjugates |
| US9676702B2 (en) | 2012-07-13 | 2017-06-13 | Heidelberg Pharma Gmbh | Methods for synthesizing amatoxin building block and amatoxins |
Family Cites Families (50)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| DE19600589C1 (de) | 1996-01-10 | 1997-01-16 | Univ Eberhard Karls | Antikörper A3C6E2 |
| WO1998025957A2 (en) | 1996-12-13 | 1998-06-18 | Human Genome Sciences, Inc. | HUMAN Prt1-LIKE SUBUNIT PROTEIN (hPrt1) AND HUMAN eIF4G-LIKE PROTEIN (p97) GENES |
| US6372448B1 (en) | 1998-12-30 | 2002-04-16 | Millennium Pharmaceuticals, Inc. | Use of ylqF, yqeG, yybQ, and ysxC, essential bacterial genes and polypeptides |
| US20040067532A1 (en) * | 2002-08-12 | 2004-04-08 | Genetastix Corporation | High throughput generation and affinity maturation of humanized antibody |
| CA2575791A1 (en) * | 2004-08-03 | 2006-02-16 | Dyax Corp. | Hk1-binding proteins |
| US8716195B2 (en) | 2005-11-14 | 2014-05-06 | Bioren, Inc. | Antibody ultrahumanization by predicted mature CDR blasting and cohort library generation and screening |
| TWI395754B (zh) | 2006-04-24 | 2013-05-11 | Amgen Inc | 人類化之c-kit抗體 |
| ES2371085T3 (es) | 2006-05-27 | 2011-12-27 | Faulstich, Heinz, Dr. | Utilización de conjugados de amatoxinas o falotoxinas con macromoléculas para la terapia tumoral y de la inflamación. |
| WO2008067115A2 (en) * | 2006-11-03 | 2008-06-05 | The Board Of Trustees Of The Leland Stanford Junior University | Selective immunodepletion of endogenous stem cell niche for engraftment |
| JP2010534469A (ja) | 2007-07-25 | 2010-11-11 | アストラゼネカ アクチボラグ | Kdr指向性標的化結合物質およびその使用 |
| HUE035700T2 (en) | 2008-11-07 | 2018-05-28 | Galaxy Biotech Llc | Monoclonal antibodies to Fibroblast Growth Factor receptor 2 |
| JO3096B1 (ar) | 2008-11-07 | 2017-03-15 | Imclone Llc | الأجسام المضادة لمستقبل ii مضاد tgfb |
| ES2784829T3 (es) | 2009-04-08 | 2020-10-01 | Faulstich Heinz Dr | Componentes de unión a la superficie de células terapéuticas provistos de amatoxina diseñados para terapia de tumores |
| KR20120128686A (ko) | 2010-02-18 | 2012-11-27 | 심포젠 에이/에스 | 녹농균의 혈청형 a 지질다당류에 대한 항체 |
| EP2603529A1 (en) | 2010-08-13 | 2013-06-19 | Roche Glycart AG | Anti-tenascin-c a2 antibodies and methods of use |
| ES2402254T3 (es) | 2010-09-30 | 2013-04-30 | Heidelberg Pharma Ag | Conjugados de amatoxinas con ligadores mejorados |
| US9540443B2 (en) * | 2011-01-26 | 2017-01-10 | Kolltan Pharmaceuticals, Inc. | Anti-kit antibodies |
| EP2497499A1 (en) | 2011-03-10 | 2012-09-12 | Heidelberg Pharma GmbH | Amatoxin-conjugates with improved linkages |
| CN115137753A (zh) * | 2013-02-05 | 2022-10-04 | 细胞结构公司 | 来自胎盘的自然杀伤细胞 |
| EP2774624A1 (en) | 2013-03-04 | 2014-09-10 | Heidelberg Pharma GmbH | Amatoxin derivatives |
| FR3008408B1 (fr) | 2013-07-11 | 2018-03-09 | Mc Saf | Nouveaux conjugues anticorps-medicament et leur utilisation en therapie |
| WO2015006475A1 (en) | 2013-07-12 | 2015-01-15 | Biogen Idec International Neuroscience Gmbh | Genetic and image biomarkers associated with decline in cognitive measures and brain glucose metabolism in populations with alzheimer's disease or those susceptible to developing alzheimer's disease |
| US10421802B2 (en) | 2013-10-18 | 2019-09-24 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Human monoclonal antibodies against the middle east respiratory syndrome coronavirus (MERS-CoV) and engineered bispecific fusions with inhibitory peptides |
| JP6441949B6 (ja) * | 2013-11-05 | 2019-01-30 | アンスティチュ ナショナル ドゥ ラ サンテ エ ドゥ ラ ルシェルシュ メディカル | ヒト中和抗kit抗体及びその使用 |
| CN106456749B (zh) | 2014-03-11 | 2021-03-30 | 小利兰·斯坦福大学托管委员会 | 抗SIRPα抗体和双特异性巨噬细胞增强型抗体 |
| WO2016020791A1 (en) | 2014-08-05 | 2016-02-11 | Novartis Ag | Ckit antibody drug conjugates |
| JP6899771B2 (ja) * | 2014-08-12 | 2021-07-14 | ギリース・マッキンドー・リサーチ・インスティチュートGillies Mcindoe Research Institute | 癌の診断及び治療 |
| EP3215519A1 (en) | 2014-11-06 | 2017-09-13 | Novartis AG | Amatoxin derivatives and conjugates thereof as inhibitors of rna polymerase |
| EP3268047B9 (en) | 2015-03-09 | 2024-01-10 | Heidelberg Pharma Research GmbH | Amatoxin-antibody conjugates |
| EP3273984B1 (en) | 2015-03-25 | 2021-05-05 | Children's Hospital Medical Center | Use of kit inhibitors to condition subjects for a hematopoietic stem cell (hsc) transplantation |
| HK1256681A1 (zh) | 2015-04-06 | 2019-10-04 | President And Fellows Of Harvard College | 用於非清髓性预处理的组合物和方法 |
| SI3280441T1 (sl) | 2015-04-07 | 2022-01-31 | Alector Llc | Protitelesa anti-sortilin in metoda njihove uporabe |
| WO2016164745A1 (en) | 2015-04-10 | 2016-10-13 | The Methodist Hospital System | Cd117 ligand-drug conjugates for targeted cancer therapy |
| US10526413B2 (en) | 2015-10-02 | 2020-01-07 | Hoffmann-La Roche Inc. | Bispecific antibodies specific for OX40 |
| PE20181326A1 (es) | 2015-11-03 | 2018-08-20 | Janssen Biotech Inc | Anticuerpos que se unen especificamente a pd-1 y sus usos |
| KR20260018979A (ko) | 2016-02-05 | 2026-02-09 | 젠맵 에이/에스 | 개선된 내재화 특징을 갖는 다중특이적 항원-결합 분자 |
| BR112018071465A2 (pt) | 2016-04-20 | 2019-02-05 | Hangzhou Dac Biotech Co Ltd | derivados de toxinas de amanita e sua conjugação a uma molécula de ligação celular |
| WO2017191579A1 (en) | 2016-05-05 | 2017-11-09 | Novartis Ag | Amatoxin derivatives and conjugates thereof as inhibitors of rna polymerase |
| IL263744B2 (en) | 2016-06-17 | 2023-11-01 | Magenta Therapeutics Inc | Compositions and methods for the depletion of cd117 plus cells |
| WO2018183613A1 (en) * | 2017-03-31 | 2018-10-04 | The Children's Medical Center Corporation | Antibody-mediated conditioning with immunosuppression to enable allogeneic transplantation |
| WO2019084057A2 (en) * | 2017-10-24 | 2019-05-02 | Magenta Therapeutics, Inc. | COMPOSITIONS AND METHODS FOR DEPLOYING CD117 + CELLS |
| WO2019084067A1 (en) * | 2017-10-24 | 2019-05-02 | Magenta Therapeutics, Inc. | ANTI-CD117 ANTIBODIES AND METHODS OF USE |
| KR20200069364A (ko) | 2017-10-24 | 2020-06-16 | 마젠타 테라퓨틱스 인코포레이티드 | Cd117+ 세포의 고갈을 위한 조성물 및 방법 |
| JP2021526525A (ja) | 2018-06-07 | 2021-10-07 | マジェンタ セラピューティクス インコーポレイテッドMagenta Therapeutics, Inc. | 抗体薬物コンジュゲート(adcs)を用いた治療方法 |
| WO2020092655A1 (en) | 2018-10-30 | 2020-05-07 | Magenta Therapeutics, Inc. | Methods for allogeneic hematopoietic stem cell transplantation |
| EP3959242A4 (en) | 2019-04-24 | 2023-09-13 | Magenta Therapeutics, Inc. | ANTRACYCLINE ANTIBODY-DRUG CONJUGATES AND THEIR USES |
| EP3958909A4 (en) | 2019-04-24 | 2024-01-10 | Magenta Therapeutics, Inc. | ANTI-CD117 ANTIBODY DRUG CONJUGATES AND USES THEREOF |
| JP2022530443A (ja) | 2019-04-24 | 2022-06-29 | マジェンタ セラピューティクス インコーポレイテッド | 抗cd117抗体薬物複合体およびその使用 |
| NZ781538A (en) | 2019-04-24 | 2025-12-19 | Heidelberg Pharma Res Gmbh | Amatoxin antibody-drug conjugates and uses thereof |
| JP2022531141A (ja) | 2019-04-24 | 2022-07-06 | マジェンタ セラピューティクス インコーポレイテッド | 遺伝子治療のコンディショニング方法 |
-
2018
- 2018-10-23 WO PCT/US2018/057172 patent/WO2019084057A2/en not_active Ceased
- 2018-10-23 EP EP18870344.1A patent/EP3700540A4/en active Pending
- 2018-10-23 US US16/168,816 patent/US10882915B2/en active Active
- 2018-10-23 JP JP2020523448A patent/JP2021500391A/ja active Pending
- 2018-10-23 CA CA3079215A patent/CA3079215A1/en active Pending
- 2018-10-23 AU AU2018354189A patent/AU2018354189A1/en not_active Abandoned
- 2018-10-23 TW TW107137414A patent/TW201922782A/zh unknown
- 2018-10-23 CN CN201880084218.6A patent/CN111601616A/zh active Pending
-
2020
- 2020-11-17 US US16/950,522 patent/US11572411B2/en active Active
-
2023
- 2023-06-06 JP JP2023092860A patent/JP2023116596A/ja active Pending
Patent Citations (88)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3896111A (en) | 1973-02-20 | 1975-07-22 | Research Corp | Ansa macrolides |
| US4151042A (en) | 1977-03-31 | 1979-04-24 | Takeda Chemical Industries, Ltd. | Method for producing maytansinol and its derivatives |
| US4137230A (en) | 1977-11-14 | 1979-01-30 | Takeda Chemical Industries, Ltd. | Method for the production of maytansinoids |
| US4265814A (en) | 1978-03-24 | 1981-05-05 | Takeda Chemical Industries | Matansinol 3-n-hexadecanoate |
| US4307016A (en) | 1978-03-24 | 1981-12-22 | Takeda Chemical Industries, Ltd. | Demethyl maytansinoids |
| US4361650A (en) | 1978-03-24 | 1982-11-30 | Takeda Chemical Industries, Ltd. | Fermentation process of preparing demethyl maytansinoids |
| US4248870A (en) | 1978-10-27 | 1981-02-03 | Takeda Chemical Industries, Ltd. | Maytansinoids and use |
| US4256746A (en) | 1978-11-14 | 1981-03-17 | Takeda Chemical Industries | Dechloromaytansinoids, their pharmaceutical compositions and method of use |
| US4260608A (en) | 1978-11-14 | 1981-04-07 | Takeda Chemical Industries, Ltd. | Maytansinoids, pharmaceutical compositions thereof and methods of use thereof |
| US4294757A (en) | 1979-01-31 | 1981-10-13 | Takeda Chemical Industries, Ltd | 20-O-Acylmaytansinoids |
| US4322348A (en) | 1979-06-05 | 1982-03-30 | Takeda Chemical Industries, Ltd. | Maytansinoids |
| US4317821A (en) | 1979-06-08 | 1982-03-02 | Takeda Chemical Industries, Ltd. | Maytansinoids, their use and pharmaceutical compositions thereof |
| US4308268A (en) | 1979-06-11 | 1981-12-29 | Takeda Chemical Industries, Ltd. | Maytansinoids, pharmaceutical compositions thereof and method of use thereof |
| US4308269A (en) | 1979-06-11 | 1981-12-29 | Takeda Chemical Industries, Ltd. | Maytansinoids, pharmaceutical compositions thereof and method of use thereof |
| US4309428A (en) | 1979-07-30 | 1982-01-05 | Takeda Chemical Industries, Ltd. | Maytansinoids |
| US4331598A (en) | 1979-09-19 | 1982-05-25 | Takeda Chemical Industries, Ltd. | Maytansinoids |
| US4362663A (en) | 1979-09-21 | 1982-12-07 | Takeda Chemical Industries, Ltd. | Maytansinoid compound |
| US4364866A (en) | 1979-09-21 | 1982-12-21 | Takeda Chemical Industries, Ltd. | Maytansinoids |
| US4371533A (en) | 1980-10-08 | 1983-02-01 | Takeda Chemical Industries, Ltd. | 4,5-Deoxymaytansinoids, their use and pharmaceutical compositions thereof |
| US4450254A (en) | 1980-11-03 | 1984-05-22 | Standard Oil Company | Impact improvement of high nitrile resins |
| US4313946A (en) | 1981-01-27 | 1982-02-02 | The United States Of America As Represented By The Secretary Of Agriculture | Chemotherapeutically active maytansinoids from Trewia nudiflora |
| US4315929A (en) | 1981-01-27 | 1982-02-16 | The United States Of America As Represented By The Secretary Of Agriculture | Method of controlling the European corn borer with trewiasine |
| US4424219A (en) | 1981-05-20 | 1984-01-03 | Takeda Chemical Industries, Ltd. | 9-Thiomaytansinoids and their pharmaceutical compositions and use |
| US4681581A (en) | 1983-12-05 | 1987-07-21 | Coates Fredrica V | Adjustable size diaper and folding method therefor |
| US4735210A (en) | 1985-07-05 | 1988-04-05 | Immunomedics, Inc. | Lymphographic and organ imaging method and kit |
| US5101827A (en) | 1985-07-05 | 1992-04-07 | Immunomedics, Inc. | Lymphographic and organ imaging method and kit |
| US5697902A (en) | 1985-07-05 | 1997-12-16 | Immunomedics, Inc. | Method for imaging and treating organs and tissues |
| US5770710A (en) | 1987-10-30 | 1998-06-23 | American Cyanamid Company | Antitumor and antibacterial substituted disulfide derivatives prepared from compounds possessing a methlytrithio group |
| US5770701A (en) | 1987-10-30 | 1998-06-23 | American Cyanamid Company | Process for preparing targeted forms of methyltrithio antitumor agents |
| US5648471A (en) | 1987-12-03 | 1997-07-15 | Centocor, Inc. | One vial method for labeling antibodies with Technetium-99m |
| US5693761A (en) | 1988-12-28 | 1997-12-02 | Protein Design Labs, Inc. | Polynucleotides encoding improved humanized immunoglobulins |
| US6180370B1 (en) | 1988-12-28 | 2001-01-30 | Protein Design Labs, Inc. | Humanized immunoglobulins and methods of making the same |
| US5585089A (en) | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5693762A (en) | 1988-12-28 | 1997-12-02 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5413923A (en) | 1989-07-25 | 1995-05-09 | Cell Genesys, Inc. | Homologous recombination for universal donor cells and chimeric mammalian hosts |
| US5102990A (en) | 1989-08-09 | 1992-04-07 | Rhomed Incorporated | Direct radiolabeling of antibodies and other proteins with technetium or rhenium |
| USRE35500E (en) | 1989-08-09 | 1997-05-06 | Aberlyn Capital Management Limited Partnership | Direct radiolabeling of antibodies and other proteins with technetium or rhenium |
| US5939598A (en) | 1990-01-12 | 1999-08-17 | Abgenix, Inc. | Method of making transgenic mice lacking endogenous heavy chains |
| WO1992001047A1 (en) | 1990-07-10 | 1992-01-23 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5814318A (en) | 1990-08-29 | 1998-09-29 | Genpharm International Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5648237A (en) | 1991-09-19 | 1997-07-15 | Genentech, Inc. | Expression of functional antibody fragments |
| US5885793A (en) | 1991-12-02 | 1999-03-23 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US5635483A (en) | 1992-12-03 | 1997-06-03 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Tumor inhibiting tetrapeptide bearing modified phenethyl amides |
| US5780588A (en) | 1993-01-26 | 1998-07-14 | Arizona Board Of Regents | Elucidation and synthesis of selected pentapeptides |
| US6214345B1 (en) | 1993-05-14 | 2001-04-10 | Bristol-Myers Squibb Co. | Lysosomal enzyme-cleavable antitumor drug conjugates |
| US5621002A (en) | 1993-09-09 | 1997-04-15 | Behringwerke Aktiengesellschaft | Prodrugs for enzyme mediated activation |
| US5877296A (en) | 1994-06-03 | 1999-03-02 | American Cyanamid Company | Process for preparing conjugates of methyltrithio antitumor agents |
| US5773001A (en) | 1994-06-03 | 1998-06-30 | American Cyanamid Company | Conjugates of methyltrithio antitumor agents and intermediates for their synthesis |
| US5739116A (en) | 1994-06-03 | 1998-04-14 | American Cyanamid Company | Enediyne derivatives useful for the synthesis of conjugates of methyltrithio antitumor agents |
| US5767285A (en) | 1994-06-03 | 1998-06-16 | American Cyanamid Company | Linkers useful for the synthesis of conjugates of methyltrithio antitumor agents |
| US5789199A (en) | 1994-11-03 | 1998-08-04 | Genentech, Inc. | Process for bacterial production of polypeptides |
| US5663149A (en) | 1994-12-13 | 1997-09-02 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Human cancer inhibitory pentapeptide heterocyclic and halophenyl amides |
| US5840523A (en) | 1995-03-01 | 1998-11-24 | Genetech, Inc. | Methods and compositions for secretion of heterologous polypeptides |
| WO1996033735A1 (en) | 1995-04-27 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| WO1996034096A1 (en) | 1995-04-28 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US5714586A (en) | 1995-06-07 | 1998-02-03 | American Cyanamid Company | Methods for the preparation of monomeric calicheamicin derivative/carrier conjugates |
| US5712374A (en) | 1995-06-07 | 1998-01-27 | American Cyanamid Company | Method for the preparation of substantiallly monomeric calicheamicin derivative/carrier conjugates |
| US6218519B1 (en) | 1996-04-12 | 2001-04-17 | Pro-Neuron, Inc. | Compounds and methods for the selective treatment of cancer and bacterial infections |
| WO1998013059A1 (en) | 1996-09-27 | 1998-04-02 | Bristol-Myers Squibb Company | Hydrolyzable prodrugs for delivery of anticancer drugs to metastatic cells |
| US5916771A (en) | 1996-10-11 | 1999-06-29 | Abgenix, Inc. | Production of a multimeric protein by cell fusion method |
| US6759509B1 (en) | 1996-11-05 | 2004-07-06 | Bristol-Myers Squibb Company | Branched peptide linkers |
| WO1998024893A3 (en) | 1996-12-03 | 1998-08-20 | Abgenix Inc | TRANSGENIC MAMMALS HAVING HUMAN IG LOCI INCLUDING PLURAL VH AND Vλ REGIONS AND ANTIBODIES PRODUCED THEREFROM |
| US6835807B1 (en) | 1998-05-22 | 2004-12-28 | Daiichi Pharmaceuticals Co., Ltd. | Drug complex and drug delivery system |
| US6268488B1 (en) | 1999-05-25 | 2001-07-31 | Barbas, Iii Carlos F. | Prodrug activation using catalytic antibodies |
| US6677435B2 (en) | 1999-05-25 | 2004-01-13 | The Scripps Research Institute | Prodrug activation using catalytic antibodies |
| US20040018194A1 (en) | 2000-11-28 | 2004-01-29 | Francisco Joseph A. | Recombinant anti-CD30 antibodies and uses thereof |
| US20040052793A1 (en) | 2001-02-22 | 2004-03-18 | Carter Paul J. | Caspase activivated prodrugs therapy |
| US7223837B2 (en) | 2001-03-23 | 2007-05-29 | Syntarga B.V. | Elongated and multiple spacers in activatible prodrugs |
| US20040121940A1 (en) | 2001-03-23 | 2004-06-24 | De Groot Franciscus Marinus Hendrikus | Elongated and multiple spacers in activatible produgs |
| WO2002088172A2 (en) | 2001-04-30 | 2002-11-07 | Seattle Genetics, Inc. | Pentapeptide compounds and uses related thereto |
| US20030130189A1 (en) | 2001-09-24 | 2003-07-10 | Senter Peter D. | P-amidobenzylethers in drug delivery agents |
| US20030096743A1 (en) | 2001-09-24 | 2003-05-22 | Seattle Genetics, Inc. | p-Amidobenzylethers in drug delivery agents |
| WO2004032828A2 (en) | 2002-07-31 | 2004-04-22 | Seattle Genetics, Inc. | Anti-cd20 antibody-drug conjugates for the treatment of cancer and immune disorders |
| US20050238649A1 (en) | 2003-11-06 | 2005-10-27 | Seattle Genetics, Inc. | Monomethylvaline compounds capable of conjugation to ligands |
| US20050256030A1 (en) | 2004-02-23 | 2005-11-17 | Bainian Feng | Heterocyclic self-immolative linkers and conjugates |
| US7754681B2 (en) | 2004-02-23 | 2010-07-13 | Seattle Genetics, Inc. | Heterocyclic self-immolative linkers and conjugates |
| US7521541B2 (en) | 2004-09-23 | 2009-04-21 | Genetech Inc. | Cysteine engineered antibodies and conjugates |
| US8552157B2 (en) | 2011-05-12 | 2013-10-08 | Imclone Llc | c-Kit antibodies and uses thereof |
| US20150079114A1 (en) | 2012-04-24 | 2015-03-19 | Seattle Genetics, Inc. | Dr5 ligand drug conjugates |
| US9676702B2 (en) | 2012-07-13 | 2017-06-13 | Heidelberg Pharma Gmbh | Methods for synthesizing amatoxin building block and amatoxins |
| US20150218220A1 (en) | 2012-09-12 | 2015-08-06 | Brian Alan MENDELSOHN | Amatoxin derivatives and cell-permeable conjugates thereof as inhibitors of rna polymerase |
| US20160303254A1 (en) | 2013-12-19 | 2016-10-20 | Seattle Genetics, Inc. | Methylene carbamate linkers for use with targeted-drug conjugates |
Non-Patent Citations (48)
| Title |
|---|
| "Bone Marrow Transplantation for Non-Malignant Disease", ASH EDUCATION BOOK, vol. 1, 2000, pages 319 - 338 |
| "Remington's Pharmaceutical Sciences", 1980 |
| ANTONOW, D.THURSTON, D.E: "Synthesis of DNA-interactive pyrrolo[2,1-c][1,4]benzodiazepines (PBDs).", CHEM. REV., vol. 111, 2011, pages 2815 - 2864, XP055004244, DOI: 10.1021/cr100120f |
| BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426 |
| BODER E.T.WITTRUP K.D.: "Yeast surface display for directed evolution of protein expression, affinity, and stability", METHODS ENZYMOL, vol. 328, 2000, pages 430 - 44, XP009103962, DOI: 10.1016/S0076-6879(00)28410-3 |
| BODER E.T.WITTRUP K.D.: "Yeast surface display for screening combinatorial polypeptide libraries", NAT BIOTECHNOL., vol. 15, no. 6, June 1997 (1997-06-01), pages 553 - 7, XP002945515, DOI: 10.1038/nbt0697-553 |
| C. PETERSON ET AL.: "Transport And Storage Of Anthracycline In Experimental Systems And Human Leukemia", ANTHRACYCLINE ANTIBIOTICS IN CANCER THERAPY; N.R. BACHUR, ''FREE RADICAL DAMAGE, pages 97 - 102 |
| CARL ET AL., J. MED. CHEM., vol. 24, 1981, pages 479 - 480 |
| CHAKRAVARTY ET AL., J. MED. CHEM., vol. 26, pages 638 - 644 |
| DALL'ACQUA ET AL., J BIOL CHEM, vol. 281, 2006, pages 23514 - 24 |
| DATTA-MANNAN ET AL., DRUG METAB DISPOS, vol. 35, 2007, pages 86 - 94 |
| DE GROOT ET AL., J. ORG. CHEM., vol. 66, 2001, pages 8815 - 8830 |
| DORONINA, NAT. BIOTECHNOL., vol. 248, no. 7, 2003, pages 778 - 784 |
| GRAHAM ET AL., J. GEN VIROL., vol. 36, 1977, pages 59 |
| GU ET AL., METH. ENZYMOL., vol. 502, 2012, pages 25 - 41 |
| HARTLEY, J.A.: "The development of pyrrolobenzodiazepines as antitumour agents.", EXPERT OPIN. INV. DRUG, vol. 20, no. 6, 2011, pages 733 - 744, XP008139716 |
| HAY ET AL., BIOORG. MED. CHEM. LETT., vol. 9, 1999, pages 2237 |
| HINMAN ET AL., CANCER RESEARCH, vol. 53, 1993, pages 3336 - 3342 |
| HINTON ET AL., J BIOL CHEM, vol. 279, 2004, pages 6213 - 6 |
| HINTON ET AL., J IMMUNOL, vol. 176, 2006, pages 346 - 56 |
| HOLLIGER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 48 |
| HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883 |
| KIM ET AL., EUR J IMMUNOL, vol. 29, 1999, pages 2819 - 25 |
| KINDBLOM ET AL., AM J. PATH., vol. 152, no. 5, 1998, pages 1259 |
| LERICHE ET AL., BIOORG. MED. CHEM., vol. 20, 2012, pages 571 - 582 |
| LODE ET AL., CANCER RESEARCH, vol. 58, 1998, pages 2925 - 2928 |
| LONDON ET AL., CLIN CANCER RES, 2016 |
| MATHER ET AL., ANNALS N.Y. ACAD. SCI., vol. 383, 1982, pages 44 - 68 |
| MATHER, BIOL. REPROD., vol. 23, 1980, pages 243 - 251 |
| PETKOVA ET AL., INT IMMUNOL, vol. 18, 2006, pages 1759 - 69 |
| PETTIT ET AL., ANTICANCER DRUG DESIGN, vol. 13, 1998, pages 243 - 277 |
| PETTIT ET AL., ANTIMICROB. AGENTS CHEMOTHER., vol. 42, 1998, pages 2961 - 2965 |
| PETTIT ET AL., J. AM. CHEM. SOC., vol. 111, 1989, pages 5463 - 5465 |
| PETTIT ET AL., J. CHEM. SOC. PERKIN TRANS., vol. 15, 1996, pages 859 - 863 |
| PETTIT, G. R. ET AL., SYNTHESIS, 1996, pages 719 - 725 |
| RATHANASWAMI ET AL., ANALYTICAL BIOCHEMISTRY, vol. 373, 2008, pages 52 - 60 |
| RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 7 |
| See also references of EP3700540A4 |
| SESSA ET AL., CARDIOVASC. TOXICOL., vol. 7, 2007, pages 75 - 79 |
| SHIELDS ET AL., J BIOL CHEM, vol. 276, 2001, pages 6591 - 604 |
| STANKOV ET AL., CURR PHARM DES., vol. 20, no. 17, 2014, pages 2849 - 80 |
| URLAUB ET AL., PROC. NATL. ACAD. SCI. USA, vol. 77, 1980, pages 4216 |
| VACCARO ET AL., NAT BIOTECHNOL, vol. 23, 2005, pages 1283 - 8 |
| WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 546 |
| WOYKE ET AL., ANTIMICROB. AGENTS AND CHEMOTHER., vol. 45, no. 12, 2001, pages 3580 - 3584 |
| YEUNG ET AL., CANCER RES, vol. 70, 2010, pages 3269 - 77 |
| ZALEVSKY ET AL., NAT BIOTECHNOL, vol. 28, 2010, pages 157 - 9 |
| ZANOTTI ET AL., INT. J. PEPTIDE PROTEIN RES., vol. 30, 1987, pages 450 - 459 |
Cited By (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11572411B2 (en) | 2017-10-24 | 2023-02-07 | Magenta Therapeutics, Inc. | Anti-CD117 antibodies and conjugates |
| US10882915B2 (en) * | 2017-10-24 | 2021-01-05 | Magenta Therapeutics, Inc. | Compositions and methods for the depletion of CD117+ cells |
| US12133884B2 (en) | 2018-05-11 | 2024-11-05 | Beam Therapeutics Inc. | Methods of substituting pathogenic amino acids using programmable base editor systems |
| US20220177578A1 (en) * | 2019-04-24 | 2022-06-09 | Magenta Therapeutics, Inc. | Anti-cd117 antibodies and uses thereof |
| WO2020219774A1 (en) * | 2019-04-24 | 2020-10-29 | Magenta Therapeutics, Inc. | Anthracycline antibody-drug conjugates and uses thereof |
| EP3959243A4 (en) * | 2019-04-24 | 2023-04-12 | Magenta Therapeutics, Inc. | ANTI-CD117 ANTIBODIES AND USES THEREOF |
| EP3958899A4 (en) * | 2019-04-24 | 2023-08-02 | Magenta Therapeutics, Inc. | ANTI-CD117 ANTIBODY-DRUG CONJUGATES AND THEIR USES |
| EP3959242A4 (en) * | 2019-04-24 | 2023-09-13 | Magenta Therapeutics, Inc. | ANTRACYCLINE ANTIBODY-DRUG CONJUGATES AND THEIR USES |
| CN114845737A (zh) * | 2019-10-15 | 2022-08-02 | 海德堡医药研究有限责任公司 | B淋巴细胞特异性鹅膏毒素抗体缀合物 |
| WO2021074261A1 (en) * | 2019-10-15 | 2021-04-22 | Heidelberg Pharma Research Gmbh | B-lymphocyte specific amatoxin antibody conjugates |
| CN115667314A (zh) * | 2020-03-16 | 2023-01-31 | 美真达治疗公司 | T细胞双特异性结合蛋白 |
| JP2023520636A (ja) * | 2020-03-16 | 2023-05-18 | マジェンタ セラピューティクス インコーポレイテッド | T細胞二重特異性結合タンパク質 |
| EP4121462A4 (en) * | 2020-03-16 | 2024-04-24 | Magenta Therapeutics, Inc. | BISPECIFIC T CELL BINDING PROTEINS |
| WO2023111311A1 (en) * | 2021-12-16 | 2023-06-22 | Universität Basel | Discernible cell surface protein variants of cd117 for use in cell therapy |
Also Published As
| Publication number | Publication date |
|---|---|
| US11572411B2 (en) | 2023-02-07 |
| JP2023116596A (ja) | 2023-08-22 |
| US20190144558A1 (en) | 2019-05-16 |
| US20210317228A1 (en) | 2021-10-14 |
| CN111601616A (zh) | 2020-08-28 |
| EP3700540A2 (en) | 2020-09-02 |
| JP2021500391A (ja) | 2021-01-07 |
| TW201922782A (zh) | 2019-06-16 |
| AU2018354189A1 (en) | 2020-04-23 |
| WO2019084057A3 (en) | 2019-06-06 |
| CA3079215A1 (en) | 2019-05-02 |
| US10882915B2 (en) | 2021-01-05 |
| EP3700540A4 (en) | 2021-11-10 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11572411B2 (en) | Anti-CD117 antibodies and conjugates | |
| JP7641452B2 (ja) | Cd117+細胞を減少させるための組成物及び方法 | |
| JP7669269B2 (ja) | 抗-cd45抗体及びそのコンジュゲート | |
| JP7709376B2 (ja) | Fcサイレンス化抗体薬物コンジュゲート(ADC)及びその使用 | |
| JP7716399B2 (ja) | 抗-cd45抗体及びそのコンジュゲート | |
| AU2018374283A1 (en) | Compositions and methods for the depletion of CD5+ cells | |
| EP3958902A1 (en) | Anti-cd117 antibodies and uses thereof | |
| US20220177578A1 (en) | Anti-cd117 antibodies and uses thereof | |
| WO2019173780A2 (en) | Anti-cd252 antibodies, conjugates, and methods of use |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18870344 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 3079215 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2018354189 Country of ref document: AU Date of ref document: 20181023 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2020523448 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2018870344 Country of ref document: EP Effective date: 20200525 |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18870344 Country of ref document: EP Kind code of ref document: A2 |