WO2019040674A1 - SOLUBLE INTERFERON RECEPTORS AND USES THEREOF - Google Patents

SOLUBLE INTERFERON RECEPTORS AND USES THEREOF Download PDF

Info

Publication number
WO2019040674A1
WO2019040674A1 PCT/US2018/047614 US2018047614W WO2019040674A1 WO 2019040674 A1 WO2019040674 A1 WO 2019040674A1 US 2018047614 W US2018047614 W US 2018047614W WO 2019040674 A1 WO2019040674 A1 WO 2019040674A1
Authority
WO
WIPO (PCT)
Prior art keywords
polypeptide
domain
seq
amino acid
acid sequence
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2018/047614
Other languages
English (en)
French (fr)
Inventor
James Arthur Posada
Pamela SMOLAK
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Sanabio LLC
Original Assignee
Sanabio LLC
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to EP18773305.0A priority Critical patent/EP3672986A1/en
Priority to KR1020207007881A priority patent/KR102777015B1/ko
Priority to SG11202001311VA priority patent/SG11202001311VA/en
Priority to AU2018321359A priority patent/AU2018321359B2/en
Priority to CN201880067266.4A priority patent/CN111315767B/zh
Priority to MX2020002070A priority patent/MX2020002070A/es
Priority to CA3073537A priority patent/CA3073537A1/en
Priority to BR112020003670-6A priority patent/BR112020003670A2/pt
Priority to JP2020532857A priority patent/JP7374091B2/ja
Application filed by Sanabio LLC filed Critical Sanabio LLC
Publication of WO2019040674A1 publication Critical patent/WO2019040674A1/en
Priority to IL272749A priority patent/IL272749A/en
Anticipated expiration legal-status Critical
Priority to JP2023036377A priority patent/JP2023060304A/ja
Priority to AU2024201211A priority patent/AU2024201211A1/en
Priority to JP2025016404A priority patent/JP2025072475A/ja
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/715Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons
    • C07K14/7156Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons for interferons [IFN]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto

Definitions

  • SLE Systemic lupus erythematosus
  • IFN interferon
  • Type I interferons are the prominent cytokines in SLE and are strongly correlated with disease activity and nephritis.
  • Type I interferons are a subgroup of interferon proteins that include IFN- a, INF- ⁇ , IFN-D, -D, -D, -D, IFN-D, IFN-D; all of which bind to the IFN-a receptor (IFNAR) which is comprised of two distinct polypeptide chains, IFNAR1 and IFNAR2.
  • IFNAR IFN-a receptor
  • the disclosure relates, in part, to soluble interferon receptors which are capable of binding interferon (e.g., IFN-a, IFN- ⁇ ). Such soluble interferon receptors are useful to inhibit interferon activity.
  • the soluble interferon receptors of the disclosure are heterodimeric constructs.
  • the disclosure relates to soluble interferon receptors that are beneficial in the treatment of diseases characterized by interferon (e.g., SLE, Sjogren's syndrome).
  • the present disclosure provides heterodimers which binds type I interferons comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an interferon receptor 1 (IFNAR 1) domain operatively coupled with or without a linker domain to a mutant Fc domain, and wherein the second polypeptide comprises an interferon receptor 2 (IFNAR2) domain operatively coupled with or without a linker domain to a mutant Fc domain.
  • the present disclosure provides a heterodimer which binds type I interferons comprising a first polypeptide and a second polypeptide, wherein the first
  • polypeptide comprises an IFNAR1 domain operatively coupled without a linker domain to a mutant Fc domain
  • the second polypeptide comprises an IFNAR2 domain operatively coupled without a linker domain to a mutant Fc domain.
  • the heterodimer of the disclosure in which each of the first and second polypeptides is linked directly to a mutant Fc domain (without a linker) has increased binding to type I interferons relative to a heterodimer in which each of the first and second polypeptides comprise a polypeptide linker domain.
  • the heterodimer of the disclosure comprises a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled with a linker domain (e.g., a polypeptide linker) to a mutant Fc domain, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled with a linker domain (e.g., a polypeptide linker) to a mutant Fc domain.
  • a linker domain e.g., a polypeptide linker
  • the heterodimer of the disclosure comprises a first polypeptide, wherein the first polypeptide comprises a polypeptide linker (e.g., a Gly/Ser linker, e.g., (G 4 S) n , wherein n is 1-10, 2-5, 1, 2, 3, 4, or 5).
  • the heterodimer of the disclosure comprises a second polypeptide, wherein the second polypeptide comprises a polypeptide linker (e.g., a Gly/Ser linker, e.g., (G 4 S) n , wherein n is 1-10, 2-5, 1, 2, 3, 4, or 5).
  • the polypeptide linker is about 1-50, about 5-40, about 10- 30, or about 15-20 amino acids in length. In some aspects, the polypeptide linker is about 20 amino acids or less, about 15 amino acids or less, about 10 amino acids or less, or about 5 amino acids or less in length. In some aspects, the polypeptide linker is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 amino acids in length.
  • the heterodimer of the disclosure binds type I interferons selected from interferon-a (INFa), interferon- ⁇ (INFP), or both INFa and INFp.
  • type I interferon is INFa.
  • the type I interferon is ⁇ .
  • the type I interferon is both INFa and ⁇ .
  • the heterodimer of the disclosure inhibits an activity of INFa.
  • the heterodimer of the disclosure inhibits an activity of ⁇ .
  • the heterodimer of the disclosure inhibits an activity of both INFa and ⁇ .
  • the heterodimer of the disclosure inhibits induction of type I interferon (IFN) gene expression.
  • the heterodimer of the disclosure comprises a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled with or without a linker domain (e.g., a polypeptide linker) to a mutant Fc domain, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled with or without a linker domain (e.g., a polypeptide linker) to a mutant Fc domain.
  • the mutant Fc domain of each of the first and second polypeptides comprises a mutant human immunoglobulin Fc domain.
  • polypeptides comprises a mutant human IgGl Fc domain.
  • the mutant Fc domain of each of the first and second polypeptides comprises a mutant human IgG4 domain.
  • the disclosure provides heterodimers which bind type 1 interferons comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled with or without a linker domain (e.g., a polypeptide linker, e.g., a Gly/Ser linker, e.g., (G 4 S) n , wherein n is 1-10, 2-5, 1, 2, 3, 4, or 5) to a mutant Fc domain comprising a mutation T366Y, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled with or without a linker domain (e.g., a polypeptide linker, e.g., a Gly/Ser linker, e.g., (G 4 S) n , wherein n is 1-10, 2-5, 1, 2, 3, 4, or 5) to a mutant Fc domain comprising mutation Y407T, according to EU numbering.
  • the first and second polypeptide each comprise a mutant human IgGl Fc domain. In some aspects, the first and second polypeptide each comprise a mutant human IgG4 Fc domain. In some aspects, the first and second polypeptide each comprise a polypeptide linker, wherein the polypeptide linker is a Gly/Ser linker, e.g., (G 4 S) n , wherein n is 1-10, 2-5, 1, 2, 3, 4, or 5.
  • the disclosure provides heterodimers which bind type 1 interferons comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled with or without a linker domain (e.g., a polypeptide linker, e.g., a Gly/Ser linker, e.g., (G 4 S) n , wherein n is 1-10, 2-5, 1, 2, 3, 4, or 5) to a mutant Fc domain comprising a mutation Y407T, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled with or without a linker domain (e.g., a polypeptide linker, e.g., a Gly/Ser linker, e.g., (G 4 S) n , wherein n is 1-10, 2-5, 1, 2, 3, 4, or 5) to a mutant Fc domain comprising mutation T366Y, according to EU numbering.
  • the first and second polypeptide each comprise a mutant human IgGl Fc domain. In some aspects, the first and second polypeptide each comprise a mutant human IgG4 Fc domain. In some aspects, the first and second polypeptide each comprise a polypeptide linker, wherein the polypeptide linker is a Gly/Ser linker, e.g., (G 4 S) n , wherein n is 1-10, 2-5, 1, 2, 3, 4, or 5.
  • the disclosure provides heterodimers which bind type 1 interferons comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled with or without a linker domain (e.g., a polypeptide linker, e.g., a Gly/Ser linker, e.g., (G 4 S) n , wherein n is 1-10, 2-5, 1, 2, 3, 4, or 5) to a mutant Fc domain comprising a mutation T366W, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled with or without a linker domain (e.g., a polypeptide linker, e.g., a Gly/Ser linker, e.g., (G 4 S) n , wherein n is 1-10, 2-5, 1, 2, 3, 4, or 5) to a mutant Fc domain comprising mutations T366S, L368A and Y
  • the first and second polypeptide each comprise a mutant human IgGl Fc domain.
  • the first and second polypeptide each comprise a polypeptide linker, wherein the polypeptide linker is a Gly/Ser linker, e.g., (G 4 S) n , wherein n is 1-10, 2-5, 1, 2, 3, 4, or 5.
  • the disclosure provides heterodimers which bind type 1 interferons comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled with or without a linker domain (e.g., a polypeptide linker, e.g., a Gly/Ser linker, e.g., (G 4 S) n , wherein n is 1-10, 2-5, 1, 2, 3, 4, or 5) to a mutant Fc domain comprising mutations T366S, L368A and Y407V, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled with or without a linker domain (e.g., a polypeptide linker, e.g., a Gly/Ser linker, e.g., (G 4 S) n , wherein n is 1-10, 2-5, 1, 2, 3, 4, or 5) to a mutant Fc domain comprising a mutation T
  • the first and second polypeptide each comprise a mutant human IgGl Fc domain.
  • the first and second polypeptide each comprise a polypeptide linker, wherein the polypeptide linker is a Gly/Ser linker, e.g., (G 4 S) n , wherein n is 1-10, 2-5, 1, 2, 3, 4, or 5.
  • the disclosure provides heterodimers which bind type 1 interferons comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled with or without a linker domain (e.g., a polypeptide linker, e.g., a Gly/Ser linker, e.g., (G 4 S) n , wherein n is 1-10, 2-5, 1, 2, 3, 4, or 5) to a mutant Fc domain comprising mutations T350V, T366L, K392L and T394W, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled with or without a linker domain (e.g., a polypeptide linker, e.g., a Gly/Ser linker, e.g., (G 4 S) n , wherein n is 1-10, 2-5, 1, 2, 3, 4, or 5) to a mutant Fc domain comprising mutations T350
  • the first and second polypeptide each comprise a mutant human IgGl Fc domain.
  • the first and second polypeptide each comprise a polypeptide linker, wherein the polypeptide linker is a Gly/Ser linker, e.g., (G 4 S) n , wherein n is 1-10, 2-5, 1, 2, 3, 4, or 5.
  • the disclosure provides heterodimers which bind type 1 interferons comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled with or without a linker domain (e.g., a polypeptide linker, e.g., a Gly/Ser linker, e.g., (G 4 S) n , wherein n is 1-10, 2-5, 1, 2, 3, 4, or 5) to a mutant Fc domain comprising mutations T350V, L351Y, F405A and Y407V, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled with or without a linker domain (e.g., a polypeptide linker, e.g., a Gly/Ser linker, e.g., (G 4 S) n , wherein n is 1-10, 2-5, 1, 2, 3, 4, or 5) to a mutant Fc domain comprising
  • the first and second polypeptide each comprise a mutant human IgGl Fc domain.
  • the first and second polypeptide each comprise a polypeptide linker, wherein the polypeptide linker is a Gly/Ser linker, e.g., (G 4 S) n , wherein n is 1-10, 2-5, 1, 2, 3, 4, or 5.
  • the disclosure provides heterodimers which bind type 1 interferons comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled with or without a linker domain (e.g., a polypeptide linker, e.g., a Gly/Ser linker, e.g., (G 4 S) n , wherein n is 1-10, 2-5, 1, 2, 3, 4, or 5) to a mutant Fc domain comprising a mutation T366Y, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled with or without a linker domain (e.g., a polypeptide linker, e.g., a Gly/Ser linker, e.g., (G 4 S) n , wherein n is 1-10, 2-5, 1, 2, 3, 4, or 5) to a mutant Fc domain comprising mutations T366S, L368A and Y
  • the first and second polypeptide each comprise a mutant human IgG4 Fc domain.
  • the first and second polypeptide each comprise a polypeptide linker, wherein the polypeptide linker is a Gly/Ser linker, e.g., (G 4 S) n , wherein n is 1-10, 2-5, 1, 2, 3, 4, or 5.
  • the disclosure provides heterodimers which bind type 1 interferons comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled with or without a linker domain (e.g., a polypeptide linker, e.g., a Gly/Ser linker, e.g., (G 4 S) n , wherein n is 1-10, 2-5, 1, 2, 3, 4, or 5) to a mutant Fc domain comprising mutations T366S, L368A and Y407V, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled with or without a linker domain (e.g., a polypeptide linker, e.g., a Gly/Ser linker, e.g., (G 4 S) n , wherein n is 1-10, 2-5, 1, 2, 3, 4, or 5) to a mutant Fc domain comprising a mutation T
  • the first and second polypeptide each comprise a mutant human IgG4 Fc domain.
  • the first and second polypeptide each comprise a polypeptide linker, wherein the polypeptide linker is a Gly/Ser linker, e.g., (G 4 S) n , wherein n is 1-10, 2-5, 1, 2, 3, 4, or 5.
  • the disclosure provides heterodimers which bind type 1 interferons comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled with or without a linker domain (e.g., a polypeptide linker, e.g., a Gly/Ser linker, e.g., (G 4 S) n , wherein n is 1-10, 2-5, 1, 2, 3, 4, or 5) to a mutant Fc domain comprising mutations T350V, T366L, K392L and T394W, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled with or without a linker domain (e.g., a polypeptide linker, e.g., a Gly/Ser linker, e.g., (G 4 S) n , wherein n is 1-10, 2-5, 1, 2, 3, 4, or 5) to a mutant Fc domain comprising mutations T350
  • the first and second polypeptide each comprise a mutant human IgG4 Fc domain.
  • the first and second polypeptide each comprise a polypeptide linker, wherein the polypeptide linker is a Gly/Ser linker, e.g., (G 4 S) n , wherein n is 1-10, 2-5, 1, 2, 3, 4, or 5.
  • the disclosure provides heterodimers which bind type 1 interferons comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled with or without a linker domain (e.g., a polypeptide linker, e.g., a Gly/Ser linker, e.g., (G 4 S) n , wherein n is 1-10, 2-5, 1, 2, 3, 4, or 5) to a mutant Fc domain comprising mutations T350V, L351Y, F405A and Y407V, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled with or without a linker domain (e.g., a polypeptide linker, e.g., a Gly/Ser linker, e.g., (G 4 S) n , wherein n is 1-10, 2-5, 1, 2, 3, 4, or 5) to a mutant Fc domain comprising
  • the first and second polypeptide each comprise a mutant human IgG4 Fc domain.
  • the first and second polypeptide each comprise a polypeptide linker, wherein the polypeptide linker is a Gly/Ser linker, e.g., (G 4 S) n , wherein n is 1-10, 2-5, 1, 2, 3, 4, or 5.
  • the heterodimer of the disclosure comprises a first polypeptide comprising an IFNAR1 domain and a second polypeptide comprising an IFNAF2 domain, wherein each of the first and second polypeptides is operably coupled with or without a linker to a mutant Fc domain comprising one or more mutations (e.g., one or more CH2 mutations, one or more CH3 mutations, or one or more CH2 and CH3 mutations), wherein the one or more Fc mutations promotes, increases, or enhances the formation of a heterodimer relative to a heterodimer comprising a first polypeptide comprising an IFNAR1 domain and a second polypeptide comprising an IFNAF2 domain, each comprising a wild-type Fc domain (e.g., an Fc domain of the same isotype (e.g., human IgGl or human IgG4) without the one or more Fc mutations).
  • the mutant Fc domain is a mutant
  • the heterodimer of the disclosure comprises a first polypeptide comprising an IFNAR1 domain and a second polypeptide comprising an IFNAF2 domain, wherein each of the first and second polypeptides is operably coupled with or without a linker to a mutant Fc domain comprising one or more mutations (e.g., one or more CH2 mutations, one or more CH3 mutations, or one or more CH2 and CH3 mutations), wherein the mutant Fc domain of the first polypeptide and/or the mutant Fc domain of the second polypeptide further comprises one or more mutations which promotes, increases, or enhances stability of the Fc domain, and/or reduces binding to Fc receptors.
  • a mutant Fc domain comprising one or more mutations (e.g., one or more CH2 mutations, one or more CH3 mutations, or one or more CH2 and CH3 mutations)
  • the mutant Fc domain of the first polypeptide and/or the mutant Fc domain of the second polypeptide further comprises one or more mutation
  • the mutation is selected from the group consisting of: C220S, C226S, C229S, P238S, and P331S, and a combination thereof, according to EU numbering.
  • the mutations comprise C220S, P238S, and P331S.
  • the mutations comprise C220S, C226S, C229S, P238S, and P331S.
  • the first polypeptide and second polypeptide each comprise a mutant Fc domain comprising mutations C220S, P238S, and P331S.
  • the first polypeptide and second polypeptide each comprise a mutant Fc domain comprising mutations C220S, C226S, C229S, P238S, and P331S.
  • the heterodimer of the disclosure comprises a first polypeptide comprising an IFNAR1 domain and a second polypeptide comprising an IFNAF2 domain, wherein each of the first and second polypeptides is operably coupled with or without a linker to a mutant Fc domain, wherein the first polypeptide comprises an IFNAR1 domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the disclosure provides a heterodimer which binds type I interferons comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled to a mutant IgGl Fc domain comprising mutation T366Y, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgGl Fc domain comprising mutation Y407T, according to EU numbering.
  • the first polypeptide comprises an IFNAR1 domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 106.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 107.
  • the disclosure provides a heterodimer which binds type I interferons comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled to a mutant IgGl Fc domain comprising mutation Y407T, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgGl Fc domain comprising mutation T336Y, according to EU numbering.
  • the first polypeptide comprises an IFNAR1 domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 106.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 107.
  • the disclosure provides a heterodimer which binds type I interferons comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled to a mutant IgGl Fc domain comprising mutation T366W, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgGl Fc domain comprising mutations T366S, L368A and Y407V, according to EU numbering.
  • the first polypeptide comprises an IFNARl domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 108.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 109.
  • the disclosure provides a heterodimer which binds type I interferons comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNARl domain operatively coupled to a mutant IgGl Fc domain comprising mutations T366S, L368A and Y407V, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgGl Fc domain comprising mutation T336W, according to EU numbering.
  • the first polypeptide comprises an IFNARl domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 108.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 109.
  • the disclosure provides a heterodimer which binds type I interferons comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNARl domain operatively coupled to a mutant IgGl Fc domain comprising mutations T350V, T366L, K392L and T394W, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgGl Fc domain comprising mutations T350V, L351Y, F405A and Y407V, according to EU numbering.
  • the first polypeptide comprises an IFNARl domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 9. In some aspects, the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 10.
  • the disclosure provides a heterodimer which binds type I interferons comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled to a mutant IgGl Fc domain comprising mutations T350V, L351Y, F405A and Y407V, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgGl Fc domain comprising mutations T350V, T366L, K392L and T394W, according to EU numbering.
  • the first polypeptide comprises an IFNAR1 domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 9. In some aspects, the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 10.
  • the disclosure provides a heterodimer which binds type I interferons comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled to a mutant IgG4 Fc domain comprising mutation T366Y, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgG4 Fc domain comprising mutation Y407T, according to EU numbering.
  • the first polypeptide comprises an IFNAR1 domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 122.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 123.
  • the disclosure provides a heterodimer which binds type I interferons comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled to a mutant IgG4 Fc domain comprising mutation Y407T, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgG4 Fc domain comprising mutation T336Y, according to EU numbering.
  • the first polypeptide comprises an IFNAR1 domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 122. In some aspects, the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 123. In some aspects, the disclosure provides a heterodimer which binds type I interferons comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled to a mutant IgG4 Fc domain comprising mutation T366W, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgG4 Fc domain comprising mutations T366S, L368A and Y407V, according to EU numbering.
  • the first polypeptide comprises an IFNAR1 domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 124. In some aspects, the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 125.
  • the disclosure provides a heterodimer which binds type I interferons comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled to a mutant IgG4 Fc domain comprising mutations T366S, L368A and Y407V, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgG4 Fc domain comprising mutation T336W, according to EU numbering.
  • the first polypeptide comprises an IFNAR1 domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 124.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 125.
  • the disclosure provides a heterodimer which binds type I interferons comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled to a mutant IgG4 Fc domain comprising mutations T350V, T366L, K392L and T394W, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgG4 Fc domain comprising mutations T350V, L351Y, F405A and Y407V, according to EU numbering.
  • the first polypeptide comprises an IFNAR1 domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 120.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 121.
  • the disclosure provides a heterodimer which binds type I interferons comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled to a mutant IgG4 Fc domain comprising mutations T350V, L351Y, F405A and Y407V, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgG4 Fc domain comprising mutations T350V, T366L, K392L and T394W, according to EU numbering.
  • the first polypeptide comprises an IFNAR1 domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 120.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 121.
  • the disclosure provides a heterodimer which binds type I interferons comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled with a Gly/Ser linker (e.g., a (G 4 S) n linker, wherein n is 1-5, 1, 2, 3, 4 or 5) to a mutant IgGl Fc domain comprising mutation T366Y, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgGl Fc domain comprising mutation Y407T, according to EU numbering.
  • a Gly/Ser linker e.g., a (G 4 S) n linker, wherein n is 1-5, 1, 2, 3, 4 or 5
  • the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgGl Fc domain comprising mutation Y407T, according to EU numbering.
  • the first polypeptide comprises an IFNAR1 domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 106.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 107.
  • the disclosure provides a heterodimer which binds type I interferons comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled with a Gly/Ser linker (e.g., a (G 4 S) n linker, wherein n is 1-5, 1, 2, 3, 4 or 5) to a mutant IgGl Fc domain comprising mutation Y407T, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgGl Fc domain comprising mutation T336Y, according to EU numbering.
  • a Gly/Ser linker e.g., a (G 4 S) n linker, wherein n is 1-5, 1, 2, 3, 4 or 5
  • the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgGl Fc domain comprising mutation T336Y, according to EU numbering.
  • the first polypeptide comprises an IFNAR1 domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 106.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 107.
  • the disclosure provides a heterodimer which binds type I interferons comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled with a Gly/Ser linker (e.g., a (G 4 S) n linker, wherein n is 1-5, 1, 2, 3, 4 or 5) to a mutant IgGl Fc domain comprising mutation T366W, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgGl Fc domain comprising mutations T366S, L368A and Y407V, according to EU numbering.
  • a Gly/Ser linker e.g., a (G 4 S) n linker, wherein n is 1-5, 1, 2, 3, 4 or 5
  • the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgGl Fc domain comprising mutations T366S, L3
  • the first polypeptide comprises an IFNAR1 domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 108.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 109.
  • the disclosure provides a heterodimer which binds type I interferons comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled with a Gly/Ser linker (e.g., a (G 4 S) n linker, wherein n is 1-5, 1, 2, 3, 4 or 5) to a mutant IgGl Fc domain comprising mutations T366S, L368A and Y407V, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgGl Fc domain comprising mutation T336W, according to EU numbering.
  • a Gly/Ser linker e.g., a (G 4 S) n linker, wherein n is 1-5, 1, 2, 3, 4 or 5
  • the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgGl Fc domain comprising mutation T336W, according to EU
  • the first polypeptide comprises an IFNAR1 domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 108.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 109.
  • the disclosure provides a heterodimer which binds type I interferons comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled with a Gly/Ser linker (e.g., a (G 4 S) n linker, wherein n is 1-5, 1, 2, 3, 4 or 5) to a mutant IgGl Fc domain comprising mutations T350V, T366L, K392L and T394W, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgGl Fc domain comprising mutations T350V, L351Y, F405A and Y407V, according to EU numbering.
  • a Gly/Ser linker e.g., a (G 4 S) n linker, wherein n is 1-5, 1, 2, 3, 4 or 5
  • the second polypeptide comprises an IFNAR2 domain operatively coupled to a
  • the first polypeptide comprises an IFNAR1 domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 9. In some aspects, the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 10.
  • the disclosure provides a heterodimer which binds type I interferons comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled with a Gly/Ser linker (e.g., a (G 4 S) n linker, wherein n is 1-5, 1, 2, 3, 4 or 5) to a mutant IgGl Fc domain comprising mutations T350V, L351Y, F405A and Y407V, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgGl Fc domain comprising mutations T350V, T366L, K392L and T394W, according to EU numbering.
  • a Gly/Ser linker e.g., a (G 4 S) n linker, wherein n is 1-5, 1, 2, 3, 4 or 5
  • the second polypeptide comprises an IFNAR2 domain operatively coupled to a
  • the first polypeptide comprises an IFNAR1 domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 9. In some aspects, the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 10.
  • the disclosure provides a heterodimer which binds type I interferons comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled with a Gly/Ser linker (e.g., a (G 4 S) n linker, wherein n is 1-5, 1, 2, 3, 4 or 5) to a mutant IgG4 Fc domain comprising mutation T366Y, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgG4 Fc domain comprising mutation Y407T, according to EU numbering.
  • a Gly/Ser linker e.g., a (G 4 S) n linker, wherein n is 1-5, 1, 2, 3, 4 or 5
  • the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgG4 Fc domain comprising mutation Y407T, according to EU numbering.
  • the first polypeptide comprises an IFNAR1 domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 122.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 123.
  • the disclosure provides a heterodimer which binds type I interferons comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNARl domain operatively coupled with a Gly/Ser linker (e.g., a (G 4 S) n linker, wherein n is 1-5, 1, 2, 3, 4 or 5) to a mutant IgG4 Fc domain comprising mutation Y407T, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgG4 Fc domain comprising mutation T336Y, according to EU numbering.
  • a Gly/Ser linker e.g., a (G 4 S) n linker, wherein n is 1-5, 1, 2, 3, 4 or 5
  • the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgG4 Fc domain comprising mutation T336Y, according to EU numbering.
  • the first polypeptide comprises an IFNARl domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 122.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 123.
  • the disclosure provides a heterodimer which binds type I interferons comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNARl domain operatively coupled with a Gly/Ser linker (e.g., a (G 4 S) n linker, wherein n is 1-5, 1, 2, 3, 4 or 5) to a mutant IgG4 Fc domain comprising mutation T366W, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgG4 Fc domain comprising mutations T366S, L368A and Y407V, according to EU numbering.
  • a Gly/Ser linker e.g., a (G 4 S) n linker, wherein n is 1-5, 1, 2, 3, 4 or 5
  • the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgG4 Fc domain comprising mutations T366S, L3
  • the first polypeptide comprises an IFNARl domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 124. In some aspects, the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 125.
  • the disclosure provides a heterodimer which binds type I interferons comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNARl domain operatively coupled with a Gly/Ser linker (e.g., a (G 4 S) n linker, wherein n is 1-5, 1, 2, 3, 4 or 5) to a mutant IgG4 Fc domain comprising mutations T366S, L368A and Y407V, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgG4 Fc domain comprising mutation T336W, according to EU numbering.
  • a Gly/Ser linker e.g., a (G 4 S) n linker, wherein n is 1-5, 1, 2, 3, 4 or 5
  • the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgG4 Fc domain comprising mutation T336W, according to EU
  • the first polypeptide comprises an IFNARl domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 124. In some aspects, the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 125.
  • the disclosure provides a heterodimer which binds type I interferons comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled with a Gly/Ser linker (e.g., a (G 4 S) n linker, wherein n is 1-5, 1, 2, 3, 4 or 5) to a mutant IgG4 Fc domain comprising mutations T350V, T366L, K392L and T394W, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgG4 Fc domain comprising mutations T350V, L351Y, F405A and Y407V, according to EU numbering.
  • a Gly/Ser linker e.g., a (G 4 S) n linker, wherein n is 1-5, 1, 2, 3, 4 or 5
  • the second polypeptide comprises an IFNAR2 domain operatively coupled to a
  • the first polypeptide comprises an IFNAR1 domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 120.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 121.
  • the disclosure provides a heterodimer which binds type I interferons comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled with a Gly/Ser linker (e.g., a (G 4 S) n linker, wherein n is 1-5, 1, 2, 3, 4 or 5) to a mutant IgG4 Fc domain comprising mutations T350V, L351Y, F405A and Y407V, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgG4 Fc domain comprising mutations T350V, T366L, K392L and T394W, according to EU numbering.
  • a Gly/Ser linker e.g., a (G 4 S) n linker, wherein n is 1-5, 1, 2, 3, 4 or 5
  • the second polypeptide comprises an IFNAR2 domain operatively coupled to a
  • the first polypeptide comprises an IFNAR1 domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 120.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 121.
  • the disclosure provides a heterodimer which binds type I interferons comprising a first polypeptide and a second polypeptide selected from:
  • the disclosure provides a heterodimer which binds type I interferons comprising a first polypeptide comprising the amino acid sequence of SEQ ID NO: 40 and a second polypeptide comprising the amino acid sequence of SEQ ID NO: 43.
  • the disclosure provides a heterodimer which binds type I interferons comprising a first polypeptide comprising the amino acid sequence of SEQ ID NO: 41 and a second polypeptide comprising the amino acid sequence of SEQ ID NO: 42. In some aspects, the disclosure provides a heterodimer which binds type I interferons comprising a first polypeptide comprising the amino acid sequence of SEQ ID NO: 53 and a second polypeptide comprising the amino acid sequence of SEQ ID NO: 55.
  • the disclosure provides a heterodimer which binds type I interferons comprising a first polypeptide comprising the amino acid sequence of SEQ ID NO: 57 and a second polypeptide comprising the amino acid sequence of SEQ ID NO: 59.
  • the disclosure provides a heterodimer which binds type 1 interferons, wherein the type I interferons are selected from interferon-a (INFa), interferon- ⁇ (INFP), or both INFa and INFp.
  • the type I interferon is INFa.
  • the type I interferon is ⁇ .
  • the type I interferon is both
  • the heterodimer inhibits an activity of INFa. In some aspects, the heterodimer inhibits an activity of ⁇ . In some aspects, the heterodimer inhibits an activity of both INFa and ⁇ . In some aspects, the heterodimer inhibits induction of type I interferon (IFN) gene expression.
  • INF type I interferon
  • the disclosure provides a heterodimer which binds type 1 interferons comprising a first and second polypeptide, wherein each of the first and second polypeptides is linked directly to a mutant Fc domain (without a linker), and wherein the heterodimer has increased binding to type I interferons relative to a heterodimer in which each of the first and second polypeptides comprise a polypeptide linker domain.
  • the disclosure provides a heterodimer which binds type 1 interferons comprising a first polypeptide comprising an IFNARl domain and a second polypeptide comprising an IFNAF2 domain, wherein each of the first and second polypeptides is operably coupled to a mutant Fc domain comprising one or more mutations (e.g., one or more CH2 mutations, one or more CH3 mutations, or one or more CH2 and CH3 mutations), and wherein the one or more Fc mutations promotes, increases, or enhances the formation of a heterodimer relative to a heterodimer comprising a first polypeptide comprising an IFNARl domain and a second polypeptide comprising an IFNAF2 domain, each comprising a wild-type Fc domain.
  • a mutant Fc domain comprising one or more mutations (e.g., one or more CH2 mutations, one or more CH3 mutations, or one or more CH2 and CH3 mutations)
  • the one or more Fc mutations
  • the heterodimer of the disclosure comprises a first polypeptide comprising an IFNARl domain and a second polypeptide comprising an IFNAF2 domain, wherein each of the first and second polypeptides is operably coupled with or without a linker to a mutant Fc domain comprising one or more mutations (e.g., one or more CH2 mutations, one or more CH3 mutations, or one or more CH2 and CH3 mutations), wherein the mutant Fc domain of the first polypeptide and/or the mutant Fc domain of the second polypeptide further comprises one or more mutations which promotes, increases, or enhances stability of the Fc domain, and/or reduces binding to Fc receptors.
  • a mutant Fc domain comprising one or more mutations (e.g., one or more CH2 mutations, one or more CH3 mutations, or one or more CH2 and CH3 mutations)
  • the mutant Fc domain of the first polypeptide and/or the mutant Fc domain of the second polypeptide further comprises one or more mutation
  • the mutation is selected from the group consisting of: C220S, C226S, C229S, P238S, and P331S, and a combination thereof, according to EU numbering.
  • the mutations comprise C220S, P238S, and P331S.
  • the mutations comprise C220S, C226S, C229S, P238S, and P331S.
  • the first polypeptide and second polypeptide each comprise a mutant Fc domain comprising mutations C220S, P238S, and P331S.
  • the first polypeptide and second polypeptide each comprise a mutant Fc domain comprising mutations C220S, C226S, C229S, P238S, and P331S.
  • the disclosure provides a composition comprising a heterodimer of the disclosure and a pharmaceutically acceptable carrier.
  • the disclosure provides a nucleic acid comprising a nucleotide sequence encoding a first polypeptide of the heterodimer, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled with or without a linker (e.g., a Gly/Ser linker (e.g., a (G 4 S)n linker, wherein n is 1-5, 1, 2, 3, 4 or 5) to a mutant Fc domain (e.g., a mutant human IgGl Fc domain or a mutant human IgG4 Fc domain).
  • a linker e.g., a Gly/Ser linker (e.g., a (G 4 S)n linker, wherein n is 1-5, 1, 2, 3, 4 or 5
  • a mutant Fc domain e.g., a mutant human IgGl Fc domain or a mutant human IgG4 Fc domain.
  • the first polypeptide comprising an IFNAR1 domain comprises the amino acid sequence
  • the disclosure provides a nucleic acid comprising a nucleotide sequence encoding a second polypeptide of the heterodimer, wherein the second polypeptide comprises an IFNAR2 domain operatively coupled with or without a linker (e.g., a Gly/Ser linker (e.g., a (G 4 S)n linker, wherein n is 1-5, 1, 2, 3, 4 or 5) to a mutant Fc domain (e.g., a mutant human IgGl Fc domain or a mutant human IgG4 Fc domain).
  • the second polypeptide comprising an IFNAR2 domain comprises the amino acid sequence in SEQ ID NO: 12.
  • the recombinant expression vector and host cell comprises a nucleic acid comprising a nucleotide sequence encoding a first polypeptide of the heterodimer, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled with or without a linker (e.g., a Gly/Ser linker (e.g., a (G 4 S) n linker, wherein n is 1-5, 1, 2, 3, 4 or 5) to a mutant Fc domain (e.g., a mutant human IgGl Fc domain or a mutant human IgG4 Fc domain).
  • a linker e.g., a Gly/Ser linker (e.g., a (G 4 S) n linker, wherein n is 1-5, 1, 2, 3, 4 or 5
  • a mutant Fc domain e.g., a mutant human IgGl Fc domain or a mutant human IgG4 Fc domain.
  • the recombinant expression vector and host cell comprises a nucleic acid comprising a nucleotide sequence encoding a second polypeptide of the heterodimer, wherein the second polypeptide comprises an IFNAR2 domain operatively coupled with or without a linker (e.g., a Gly/Ser linker (e.g., a (G 4 S) n linker, wherein n is 1-5, 1, 2, 3, 4 or 5) to a mutant Fc domain (e.g., a mutant human IgGl Fc domain or a mutant human IgG4 Fc domain).
  • a linker e.g., a Gly/Ser linker (e.g., a (G 4 S) n linker, wherein n is 1-5, 1, 2, 3, 4 or 5
  • a mutant Fc domain e.g., a mutant human IgGl Fc domain or a mutant human IgG4 Fc domain.
  • the recombinant expression vector and host cell comprises both a nucleic acid comprising a nucleotide sequence encoding the first polypeptide of the heterodimer and a nucleic acid comprising a nucleotide sequence encoding the a second polypeptide of the heterodimer.
  • the first polypeptide comprising an IFNAR1 domain comprises the amino acid sequence in SEQ ID NO: 11.
  • comprising an IFNAR2 domain comprises the amino acid sequence in SEQ ID NO: 12.
  • aspects of the disclosure provide methods of reducing, decreasing, or inhibiting interferon (IFN) gene expression in a subject in need thereof, comprising administering to the subject a heterodimer of the disclosure, or a composition of the disclosure comprising a heterodimer and a pharmaceutically acceptable carrier.
  • IFN interferon
  • aspects of the disclosure provide methods of reducing, decreasing, or inhibiting type I interferons in a subject in need thereof, comprising administering to the subject a heterodimer of the disclosure, or a composition of the disclosure comprising a heterodimer and a pharmaceutically acceptable carrier.
  • the type I interferon is INFoc.
  • the type I interferon is ⁇ .
  • the type I interferon is both INFoc and INF .
  • aspects of the disclosure provide methods of treating or inhibiting progression of a disease characterized by type I interferons and methods of treating an autoimmune disease in a subject in need thereof, comprising administering to the subject a heterodimer of the disclosure, or a composition of the disclosure comprising a heterodimer and a pharmaceutically acceptable carrier.
  • the type I interferon is INFoc.
  • the type I interferon is INF .
  • the type I interferon is both INFoc and ⁇ .
  • the autoimmune disease is SLE.
  • the autoimmune disease is Sjogren's syndrome.
  • the disclosure provides methods of reducing, decreasing, or inhibiting interferon (IFN) gene expression, methods of reducing, decreasing, or inhibiting type I interferons (e.g., INFoc, ⁇ , or both INF and ⁇ ), and methods of treating an autoimmune disease (e.g., SLE, Sjogren's syndrome) in a subject in need thereof, the method comprising administering to the subject a heterodimer of the disclosure, or a composition of the disclosure comprising a heterodimer and a pharmaceutically acceptable carrier, wherein the heterodimer comprises a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNARl domain operatively coupled to a mutant IgGl Fc domain comprising mutation T366Y, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgGl Fc domain comprising mutation Y407T, according to EU numbering.
  • IFN interferon
  • the first polypeptide comprises an IFNARl domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 106.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 107.
  • the autoimmune disease is SLE. In some aspects, the autoimmune disease is Sjogren's syndrome.
  • the disclosure provides methods of reducing, decreasing, or inhibiting interferon (IFN) gene expression, methods of reducing, decreasing, or inhibiting type I interferons (e.g., INFa, ⁇ , or both INFa and ⁇ ), and methods of treating an autoimmune disease (e.g., SLE, Sjogren's syndrome) in a subject in need thereof, the method comprising administering to the subject a heterodimer of the disclosure, or a composition of the disclosure comprising a heterodimer and a pharmaceutically acceptable carrier, wherein the heterodimer comprises a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNARl domain operatively coupled to a mutant IgGl Fc domain comprising mutation Y407T, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgGl Fc domain comprising mutation T336Y, according to EU numbering.
  • IFN interferon
  • the first polypeptide comprises an IFNARl domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 106.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 107.
  • the autoimmune disease is SLE. In some aspects, the autoimmune disease is Sjogren's syndrome.
  • the disclosure provides methods of reducing, decreasing, or inhibiting interferon (IFN) gene expression, methods of reducing, decreasing, or inhibiting type I interferons (e.g., INFoc, ⁇ , or both INFoc and ⁇ ), and methods of treating an autoimmune disease (e.g., SLE, Sjogren's syndrome) in a subject in need thereof, the method comprising administering to the subject a heterodimer of the disclosure, or a composition of the disclosure comprising a heterodimer and a pharmaceutically acceptable carrier, wherein the heterodimer comprises a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNARl domain operatively coupled to a mutant IgGl Fc domain comprising mutation T366W, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgGl Fc domain comprising mutations T366S, L368A and Y407V, according to EU numbering
  • the first polypeptide comprises an IFNARl domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 108.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 109.
  • the autoimmune disease is SLE. In some aspects, the autoimmune disease is Sjogren's syndrome.
  • the disclosure provides methods of reducing, decreasing, or inhibiting interferon (IFN) gene expression, methods of reducing, decreasing, or inhibiting type I interferons (e.g., INFoc, ⁇ , or both INFoc and ⁇ ), and methods of treating an autoimmune disease (e.g., SLE, Sjogren's syndrome) in a subject in need thereof, the method comprising administering to the subject a heterodimer of the disclosure, or a composition of the disclosure comprising a heterodimer and a pharmaceutically acceptable carrier, wherein the heterodimer comprises a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNARl domain operatively coupled to a mutant IgGl Fc domain comprising mutations T366S, L368A and Y407V, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgGl Fc domain comprising mutation T336W, according to EU numbering
  • the first polypeptide comprises an IFNARl domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 108.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 109.
  • the autoimmune disease is SLE. In some aspects, the autoimmune disease is Sjogren's syndrome.
  • the disclosure provides methods of reducing, decreasing, or inhibiting interferon (IFN) gene expression, methods of reducing, decreasing, or inhibiting type I interferons (e.g., INFoc, ⁇ , or both INFoc and ⁇ ), and methods of treating an autoimmune disease (e.g., SLE, Sjogren's syndrome) in a subject in need thereof, the method comprising administering to the subject a heterodimer of the disclosure, or a composition of the disclosure comprising a heterodimer and a pharmaceutically acceptable carrier, wherein the heterodimer comprises a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled to a mutant IgGl Fc domain comprising mutations T350V, T366L, K392L and T394W, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgGl Fc domain comprising mutations T350V, L35
  • the first polypeptide comprises an IFNAR1 domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 9.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 10.
  • the autoimmune disease is SLE. In some aspects, the autoimmune disease is Sjogren's syndrome.
  • the disclosure provides methods of reducing, decreasing, or inhibiting interferon (IFN) gene expression, methods of reducing, decreasing, or inhibiting type I interferons (e.g., INFoc, ⁇ , or both INFoc and ⁇ ), and methods of treating an autoimmune disease (e.g., SLE, Sjogren's syndrome) in a subject in need thereof, the method comprising administering to the subject a heterodimer of the disclosure, or a composition of the disclosure comprising a heterodimer and a pharmaceutically acceptable carrier, wherein the heterodimer comprises a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled to a mutant IgGl Fc domain comprising mutations T350V, L351Y, F405A and Y407V, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgGl Fc domain comprising mutations T350V, T
  • the first polypeptide comprises an IFNARl domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 9.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 10.
  • the autoimmune disease is SLE. In some aspects, the autoimmune disease is Sjogren's syndrome.
  • the disclosure provides methods of reducing, decreasing, or inhibiting interferon (IFN) gene expression, methods of reducing, decreasing, or inhibiting type I interferons (e.g., INFoc, ⁇ , or both INFoc and ⁇ ), and methods of treating an autoimmune disease (e.g., SLE, Sjogren's syndrome) in a subject in need thereof, the method comprising administering to the subject a heterodimer of the disclosure, or a composition of the disclosure comprising a heterodimer and a pharmaceutically acceptable carrier, wherein the heterodimer comprises a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNARl domain operatively coupled to a mutant IgG4 Fc domain comprising mutation T366Y, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgG4 Fc domain comprising mutation Y407T, according to EU numbering.
  • IFN interferon
  • the first polypeptide comprises an IFNARl domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 122.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 123.
  • the autoimmune disease is SLE. In some aspects, the autoimmune disease is Sjogren's syndrome.
  • the disclosure provides methods of reducing, decreasing, or inhibiting interferon (IFN) gene expression, methods of reducing, decreasing, or inhibiting type I interferons (e.g., INFoc, ⁇ , or both INFoc and ⁇ ), and methods of treating an autoimmune disease (e.g., SLE, Sjogren's syndrome) in a subject in need thereof, the method comprising administering to the subject a heterodimer of the disclosure, or a composition of the disclosure comprising a heterodimer and a pharmaceutically acceptable carrier, wherein the heterodimer comprises a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNARl domain operatively coupled to a mutant IgG4 Fc domain comprising mutation Y407T, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgG4 Fc domain comprising mutation T336Y, according to EU numbering.
  • IFN interferon
  • the first polypeptide comprises an IFNARl domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 122.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 123.
  • the autoimmune disease is SLE. In some aspects, the autoimmune disease is Sjogren's syndrome.
  • the disclosure provides methods of reducing, decreasing, or inhibiting interferon (IFN) gene expression, methods of reducing, decreasing, or inhibiting type I interferons (e.g., INFoc, ⁇ , or both INFoc and ⁇ ), and methods of treating an autoimmune disease (e.g., SLE, Sjogren's syndrome) in a subject in need thereof, the method comprising administering to the subject a heterodimer of the disclosure, or a composition of the disclosure comprising a heterodimer and a pharmaceutically acceptable carrier, wherein the heterodimer comprises a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNARl domain operatively coupled to a mutant IgG4 Fc domain comprising mutation T366W, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgG4 Fc domain comprising mutations T366S, L368A and Y407V, according to EU numbering
  • the first polypeptide comprises an IFNARl domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 124.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 125.
  • the autoimmune disease is SLE. In some aspects, the autoimmune disease is Sjogren's syndrome.
  • the disclosure provides methods of reducing, decreasing, or inhibiting interferon (IFN) gene expression, methods of reducing, decreasing, or inhibiting type I interferons (e.g., INFoc, ⁇ , or both INFoc and ⁇ ), and methods of treating an autoimmune disease (e.g., SLE, Sjogren's syndrome) in a subject in need thereof, the method comprising administering to the subject a heterodimer of the disclosure, or a composition of the disclosure comprising a heterodimer and a pharmaceutically acceptable carrier, wherein the heterodimer comprises a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled to a mutant IgG4 Fc domain comprising mutations T366S, L368A and Y407V, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgG4 Fc domain comprising mutation T336W, according to EU numbering
  • the first polypeptide comprises an IFNAR1 domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 124.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 125.
  • the autoimmune disease is SLE. In some aspects, the autoimmune disease is Sjogren's syndrome.
  • the disclosure provides methods of reducing, decreasing, or inhibiting interferon (IFN) gene expression, methods of reducing, decreasing, or inhibiting type I interferons (e.g., INF , ⁇ , or both INF and ⁇ ), and methods of treating an autoimmune disease (e.g., SLE, Sjogren's syndrome) in a subject in need thereof, the method comprising administering to the subject a heterodimer of the disclosure, or a composition of the disclosure comprising a heterodimer and a pharmaceutically acceptable carrier, wherein the heterodimer comprises a first polypeptide and a second polypeptide, wherein the first
  • IFN interferon
  • polypeptide comprises an IFNAR1 domain operatively coupled to a mutant IgG4 Fc domain comprising mutations T350V, T366L, K392L and T394W, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgG4 Fc domain comprising mutations T350V, L351Y, F405A and Y407V, according to EU numbering.
  • the first polypeptide comprises an IFNAR1 domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 120.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 121.
  • the first polypeptide comprises an IFNAR1 domain comprising the amino acid sequence in SEQ ID NO: 11
  • the second polypeptide comprises an IFNAR2
  • autoimmune disease is SLE. In some aspects, the autoimmune disease is Sjogren's syndrome.
  • the disclosure provides methods of reducing, decreasing, or inhibiting interferon (IFN) gene expression, methods of reducing, decreasing, or inhibiting type I interferons (e.g., INFa, ⁇ , or both INFa and ⁇ ), and methods of treating an autoimmune disease (e.g., SLE, Sjogren's syndrome) in a subject in need thereof, the method comprising administering to the subject a heterodimer of the disclosure, or a composition of the disclosure comprising a heterodimer and a pharmaceutically acceptable carrier, wherein the heterodimer comprises a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled to a mutant IgG4 Fc domain comprising mutations T350V, L351Y, F405A and Y407V, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled to a mutant IgG4 Fc domain comprising mutations T350V, T366
  • the first polypeptide comprises an IFNAR1 domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 120.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 121.
  • the autoimmune disease is SLE. In some aspects, the autoimmune disease is Sjogren's syndrome.
  • the disclosure provides methods of reducing, decreasing, or inhibiting interferon (IFN) gene expression, methods of reducing, decreasing, or inhibiting type I interferons (e.g., INFoc, ⁇ , or both INFoc and ⁇ ), and methods of treating an autoimmune disease (e.g., SLE, Sjogren's syndrome) in a subject in need thereof, the method comprising administering to the subject a heterodimer of the disclosure, or a composition of the disclosure comprising a heterodimer and a pharmaceutically acceptable carrier, wherein the heterodimer comprises a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled with a Gly/Ser linker (e.g., a (G 4 S) n linker, wherein n is 1-5, 1, 2, 3, 4 or 5) to a mutant IgGl Fc domain comprising mutation T366Y, and wherein the second polypeptide comprises an IFN
  • the first polypeptide comprises an IFNAR1 domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 106.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 107.
  • the autoimmune disease is SLE. In some aspects, the autoimmune disease is Sjogren's syndrome.
  • the disclosure provides methods of reducing, decreasing, or inhibiting interferon (IFN) gene expression, methods of reducing, decreasing, or inhibiting type I interferons (e.g., INFoc, ⁇ , or both INF and ⁇ ), and methods of treating an autoimmune disease (e.g., SLE, Sjogren's syndrome) in a subject in need thereof, the method comprising administering to the subject a heterodimer of the disclosure, or a composition of the disclosure comprising a heterodimer and a pharmaceutically acceptable carrier, wherein the heterodimer comprises a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNARl domain operatively coupled with a Gly/Ser linker (e.g., a (G 4 S) n linker, wherein n is 1-5, 1, 2, 3, 4 or 5) to a mutant IgGl Fc domain comprising mutation Y407T, and wherein the second polypeptide comprises an IFNAR
  • the first polypeptide comprises an IFNARl domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 106.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 107.
  • the autoimmune disease is SLE. In some aspects, the autoimmune disease is Sjogren's syndrome.
  • the disclosure provides methods of reducing, decreasing, or inhibiting interferon (IFN) gene expression, methods of reducing, decreasing, or inhibiting type I interferons (e.g., INFa, ⁇ , or both INFa and ⁇ ), and methods of treating an autoimmune disease (e.g., SLE, Sjogren's syndrome) in a subject in need thereof, the method comprising administering to the subject a heterodimer of the disclosure, or a composition of the disclosure comprising a heterodimer and a pharmaceutically acceptable carrier, wherein the heterodimer comprises a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNARl domain operatively coupled with a Gly/Ser linker (e.g., a (G 4 S) n linker, wherein n is 1-5, 1, 2, 3, 4 or 5) to a mutant IgGl Fc domain comprising mutation T366W, and wherein the second polypeptide comprises an IFNAR2
  • the first polypeptide comprises an IFNARl domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 108.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 109.
  • the autoimmune disease is SLE. In some aspects, the autoimmune disease is Sjogren's syndrome.
  • the disclosure provides methods of reducing, decreasing, or inhibiting interferon (IFN) gene expression, methods of reducing, decreasing, or inhibiting type I interferons (e.g., INFoc, ⁇ , or both INFoc and ⁇ ), and methods of treating an autoimmune disease (e.g., SLE, Sjogren's syndrome) in a subject in need thereof, the method comprising administering to the subject a heterodimer of the disclosure, or a composition of the disclosure comprising a heterodimer and a pharmaceutically acceptable carrier, wherein the heterodimer comprises a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNARl domain operatively coupled with a Gly/Ser linker (e.g., a (G 4 S) n linker, wherein n is 1-5, 1, 2, 3, 4 or 5) to a mutant IgGl Fc domain comprising mutations T366S, L368A and Y407V,
  • the first polypeptide comprises an IFNARl domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 108.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 109.
  • the autoimmune disease is SLE. In some aspects, the autoimmune disease is Sjogren's syndrome.
  • the disclosure provides methods of reducing, decreasing, or inhibiting interferon (IFN) gene expression, methods of reducing, decreasing, or inhibiting type I interferons (e.g., INFoc, ⁇ , or both INFoc and ⁇ ), and methods of treating an autoimmune disease (e.g., SLE, Sjogren's syndrome) in a subject in need thereof, the method comprising administering to the subject a heterodimer of the disclosure, or a composition of the disclosure comprising a heterodimer and a pharmaceutically acceptable carrier, wherein the heterodimer comprises a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNARl domain operatively coupled with a Gly/Ser linker (e.g., a (G 4 S) n linker, wherein n is 1-5, 1, 2, 3, 4 or 5) to a mutant IgGl Fc domain comprising mutations T350V, T366L, K392L and T39
  • the first polypeptide comprises an IFNARl domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 9.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 10.
  • the autoimmune disease is SLE. In some aspects, the autoimmune disease is Sjogren's syndrome.
  • the disclosure provides methods of reducing, decreasing, or inhibiting interferon (IFN) gene expression, methods of reducing, decreasing, or inhibiting type I interferons (e.g., INFoc, ⁇ , or both INFoc and ⁇ ), and methods of treating an autoimmune disease (e.g., SLE, Sjogren's syndrome) in a subject in need thereof, the method comprising administering to the subject a heterodimer of the disclosure, or a composition of the disclosure comprising a heterodimer and a pharmaceutically acceptable carrier, wherein the heterodimer comprises a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled with a Gly/Ser linker (e.g., a (G 4 S) n linker, wherein n is 1-5, 1, 2, 3, 4 or 5) to a mutant IgGl Fc domain comprising mutations T350V, L351Y, F405A and Y
  • the first polypeptide comprises an IFNAR1 domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 9.
  • the mutant IgGl Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 10.
  • the autoimmune disease is SLE. In some aspects, the autoimmune disease is Sjogren's syndrome.
  • the disclosure provides methods of reducing, decreasing, or inhibiting interferon (IFN) gene expression, methods of reducing, decreasing, or inhibiting type I interferons (e.g., INFoc, ⁇ , or both INFoc and ⁇ ), and methods of treating an autoimmune disease (e.g., SLE, Sjogren's syndrome) in a subject in need thereof, the method comprising administering to the subject a heterodimer of the disclosure, or a composition of the disclosure comprising a heterodimer and a pharmaceutically acceptable carrier, wherein the heterodimer comprises a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled with a Gly/Ser linker (e.g., a (G 4 S) n linker, wherein n is 1-5, 1, 2, 3, 4 or 5) to a mutant IgG4 Fc domain comprising mutation T366Y, and wherein the second polypeptide comprises an IFN
  • the first polypeptide comprises an IFNAR1 domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 122.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 123.
  • the autoimmune disease is SLE. In some aspects, the autoimmune disease is Sjogren's syndrome.
  • the disclosure provides methods of reducing, decreasing, or inhibiting interferon (IFN) gene expression, methods of reducing, decreasing, or inhibiting type I interferons (e.g., INFoc, ⁇ , or both INFoc and ⁇ ), and methods of treating an autoimmune disease (e.g., SLE, Sjogren's syndrome) in a subject in need thereof, the method comprising administering to the subject a heterodimer of the disclosure, or a composition of the disclosure comprising a heterodimer and a pharmaceutically acceptable carrier, wherein the heterodimer comprises a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled with a Gly/Ser linker (e.g., a (G 4 S) n linker, wherein n is 1-5, 1, 2, 3, 4 or 5) to a mutant IgG4 Fc domain comprising mutation Y407T, and wherein the second polypeptide comprises an IFNAR
  • the first polypeptide comprises an IFNAR1 domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 122.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 123.
  • the autoimmune disease is SLE. In some aspects, the autoimmune disease is Sjogren's syndrome.
  • the disclosure provides methods of reducing, decreasing, or inhibiting interferon (IFN) gene expression, methods of reducing, decreasing, or inhibiting type I interferons (e.g., INFoc, ⁇ , or both INFoc and ⁇ ), and methods of treating an autoimmune disease (e.g., SLE, Sjogren's syndrome) in a subject in need thereof, the method comprising administering to the subject a heterodimer of the disclosure, or a composition of the disclosure comprising a heterodimer and a pharmaceutically acceptable carrier, wherein the heterodimer comprises a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNARl domain operatively coupled with a Gly/Ser linker (e.g., a (G 4 S) n linker, wherein n is 1-5, 1, 2, 3, 4 or 5) to a mutant IgG4 Fc domain comprising mutation T366W, and wherein the second polypeptide comprises an IFN
  • the first polypeptide comprises an IFNARl domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 124.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 125.
  • the autoimmune disease is SLE. In some aspects, the autoimmune disease is Sjogren's syndrome.
  • the disclosure provides methods of reducing, decreasing, or inhibiting interferon (IFN) gene expression, methods of reducing, decreasing, or inhibiting type I interferons (e.g., INFoc, ⁇ , or both INFoc and ⁇ ), and methods of treating an autoimmune disease (e.g., SLE, Sjogren's syndrome) in a subject in need thereof, the method comprising administering to the subject a heterodimer of the disclosure, or a composition of the disclosure comprising a heterodimer and a pharmaceutically acceptable carrier, wherein the heterodimer comprises a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNARl domain operatively coupled with a Gly/Ser linker (e.g., a (G 4 S) n linker, wherein n is 1-5, 1, 2, 3, 4 or 5) to a mutant IgG4 Fc domain comprising mutations T366S, L368A and Y407V,
  • the first polypeptide comprises an IFNARl domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 124.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 125.
  • the autoimmune disease is SLE. In some aspects, the autoimmune disease is Sjogren's syndrome.
  • the disclosure provides methods of reducing, decreasing, or inhibiting interferon (IFN) gene expression, methods of reducing, decreasing, or inhibiting type I interferons (e.g., INFoc, ⁇ , or both INFoc and ⁇ ), and methods of treating an autoimmune disease (e.g., SLE, Sjogren's syndrome) in a subject in need thereof, the method comprising administering to the subject a heterodimer of the disclosure, or a composition of the disclosure comprising a heterodimer and a pharmaceutically acceptable carrier, wherein the heterodimer comprises a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled with a Gly/Ser linker (e.g., a (G 4 S) n linker, wherein n is 1-5, 1, 2, 3, 4 or 5) to a mutant IgG4 Fc domain comprising mutations T350V, T366L, K392L and T39
  • the first polypeptide comprises an IFNAR1 domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 120.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 121.
  • the autoimmune disease is SLE. In some aspects, the autoimmune disease is Sjogren's syndrome.
  • the disclosure provides methods of reducing, decreasing, or inhibiting interferon (IFN) gene expression, methods of reducing, decreasing, or inhibiting type I interferons (e.g., INFoc, ⁇ , or both INFoc and ⁇ ), and methods of treating an autoimmune disease (e.g., SLE, Sjogren's syndrome) in a subject in need thereof, the method comprising administering to the subject a heterodimer of the disclosure, or a composition of the disclosure comprising a heterodimer and a pharmaceutically acceptable carrier, wherein the heterodimer comprises a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNAR1 domain operatively coupled with a Gly/Ser linker (e.g., a (G 4 S) n linker, wherein n is 1-5, 1, 2, 3, 4 or 5) to a mutant IgG4 Fc domain comprising mutations T350V, L351Y, F405A and Y
  • the first polypeptide comprises an IFNAR1 domain comprising the amino acid sequence in SEQ ID NO: 11 and the second polypeptide comprises an IFNAR2 domain comprising the amino acid sequence in SEQ ID NO: 12.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 120.
  • the mutant IgG4 Fc domain comprises the amino acid sequence set forth in SEQ ID NO: 121.
  • the autoimmune disease is SLE. In some aspects, the autoimmune disease is Sjogren's syndrome.
  • the disclosure provides methods of reducing, decreasing, or inhibiting interferon (IFN) gene expression, methods of reducing, decreasing, or inhibiting type I interferons (e.g., INFoc, ⁇ , or both INFoc and ⁇ ), and methods of treating an autoimmune disease (e.g., SLE, Sjogren's syndrome) in a subject in need thereof, the method comprising administering to the subject a heterodimer of the disclosure, or a composition of the disclosure comprising a heterodimer and a pharmaceutically acceptable carrier, wherein the heterodimer comprises a first polypeptide and a second polypeptide selected from:
  • IFN interferon
  • the autoimmune disease is SLE. In some aspects, the autoimmune disease is Sjogren's syndrome.
  • the disclosure provides methods of reducing, decreasing, or inhibiting interferon (IFN) gene expression, methods of reducing, decreasing, or inhibiting type I interferons (e.g., INFoc, ⁇ , or both INFoc and ⁇ ), and methods of treating an autoimmune disease (e.g., SLE, Sjogren's syndrome) in a subject in need thereof, the method comprising administering to the subject a heterodimer of the disclosure, or a composition of the disclosure comprising a heterodimer and a pharmaceutically acceptable carrier, wherein the heterodimer comprises a first polypeptide comprising the amino acid sequence of SEQ ID NO: 40 and a second polypeptide comprising the amino acid sequence of SEQ ID NO: 43.
  • the autoimmune disease is SLE.
  • the autoimmune disease is Sjogren's syndrome.
  • the disclosure provides methods of reducing, decreasing, or inhibiting interferon (IFN) gene expression, methods of reducing, decreasing, or inhibiting type I interferons (e.g., INFoc, ⁇ , or both INFoc and ⁇ ), and methods of treating an autoimmune disease (e.g., SLE, Sjogren's syndrome) in a subject in need thereof, the method comprising administering to the subject a heterodimer of the disclosure, or a composition of the disclosure comprising a heterodimer and a pharmaceutically acceptable carrier, wherein the heterodimer comprises a first polypeptide comprising the amino acid sequence of SEQ ID NO: 41 and a second polypeptide comprising the amino acid sequence of SEQ ID NO: 42.
  • the autoimmune disease is SLE.
  • the autoimmune disease is Sjogren's syndrome.
  • the disclosure provides methods of reducing, decreasing, or inhibiting interferon (IFN) gene expression, methods of reducing, decreasing, or inhibiting type I interferons (e.g., INFoc, ⁇ , or both INFoc and ⁇ ), and methods of treating an autoimmune disease (e.g., SLE, Sjogren's syndrome) in a subject in need thereof, the method comprising administering to the subject a heterodimer of the disclosure, or a composition of the disclosure comprising a heterodimer and a pharmaceutically acceptable carrier, wherein the heterodimer comprises a first polypeptide comprising the amino acid sequence of SEQ ID NO: 53 and a second polypeptide comprising the amino acid sequence of SEQ ID NO: 55.
  • the autoimmune disease is SLE.
  • the autoimmune disease is Sjogren's syndrome.
  • the disclosure provides methods of reducing, decreasing, or inhibiting interferon (IFN) gene expression, methods of reducing, decreasing, or inhibiting type I interferons (e.g., INFoc, ⁇ , or both INFoc and ⁇ ), and methods of treating an autoimmune disease (e.g., SLE, Sjogren's syndrome) in a subject in need thereof, the method comprising administering to the subject a heterodimer of the disclosure, or a composition of the disclosure comprising a heterodimer and a pharmaceutically acceptable carrier, wherein the heterodimer comprises a first polypeptide comprising the amino acid sequence of SEQ ID NO: 57 and a second polypeptide comprising the amino acid sequence of SEQ ID NO: 59.
  • the autoimmune disease is SLE.
  • the autoimmune disease is Sjogren's syndrome.
  • aspects of the disclosure provide use of a heterodimer of the disclosure, and an optional pharmaceutically acceptable carrier, in the manufacture of a medicament for treating or delaying progression of an autoimmune disease in a subject in need thereof, wherein the treatment comprises administration of the medicament to a subject in need thereof.
  • kits comprising a medicament comprising a heterodimer of the disclosure, and an optional pharmaceutically acceptable carrier, and a package insert comprising instructions for administration of the medicament for treating or delaying progression of an autoimmune disease in a subject in need thereof.
  • the disclosure provides a kit comprising a container comprising a heterodimer of the disclosure, and an optional pharmaceutically acceptable carrier, and a package insert comprising instructions for administration of the heterodimer for treating or delaying progression of an autoimmune disease in a subject in need thereof.
  • Figure 1 depicts exemplary soluble interferon receptors RSLV 601-604, RSLV 602-603, RSLV 606-611, and RSLV 608-613.
  • Figure 2 graphically depicts the inhibition of IFNa induced SEAP production in HEK- Blue ⁇ / ⁇ cells by the inhibitors RSLV 601-604, RSLV 602-603, and anti-human IFNa positive control. Human IgG was used as a negative control.
  • Figure 3 graphically depicts the inhibition of ⁇ induced SEAP production in HEK- Blue ⁇ / ⁇ cells by the inhibitors RSLV 601-604, RSLV 602-603, and anti-human IFNp positive control. Human IgG was used as a negative control.
  • Figure 4 graphically depicts the impact of linker length on the inhibition of IFNa induced SEAP production in HEK-Blue ⁇ / ⁇ cells.
  • Figure 5 graphically depicts the impact of linker length on the inhibition of IFN induced SEAP production in HEK-Blue ⁇ / ⁇ cells.
  • Figure 6 depicts the inhibition of SLE sera induced interferon gene expression in PBMC with soluble interferon receptor RSLV 601-604.
  • Figure 7 depicts the inhibition of SLE sera induced interferon gene expression in PBMC with soluble interferon receptor RSLV 608-613.
  • the present disclosure provides soluble heterodimers which bind type I interferons and methods of reducing, decreasing, or inhibiting interferon (IFN) gene expression, methods of reducing, decreasing, or inhibiting type I interferons and/or type I interferon activity (e.g., INFa, INF , or both INFa and INFP), and methods of treating diseases characterized by type I interferon production in a subject in need thereof.
  • IFN interferon
  • the disclosure is based, at least in part, on the discovery that heterodimers comprising an IFNAR1 domain and an IFNAR2 domain, each operatively coupled to a mutant Fc domain, potently inhibit IFNa and IFNP activity and inhibit SLE sera induced interferon gene expression. These results indicate that the heterodimers of the disclosure are capable of binding to and inhibiting the activity of type I interferons in a subject with an autoimmune condition, such as SLE.
  • heterodimers comprising an IFNAR1 domain and an IFNAR2 domain, each operatively coupled directly to a mutant Fc domain (i.e., without a polypeptide linker) have increased binding affinity and potency for type I interferons, such as INFa, relative to a heterodimer in which the IFNARl domain and IFNAR2 domain are each operatively coupled to a mutant Fc domain with a polypeptide linker.
  • IFNARl and IRNAR2 required a degree of flexibility to form a pocket for interacting with a type I interferons.
  • IFNARl and IFNAR2 bind type I interferons and form a ternary complex, which results in bringing the intracellular domains into close proximity and regulates signaling through the receptor (Li et al., J. Mol. Biol. (2017) 429, 2571-2589). It has also been shown that ligand induced conformation changes to the receptor components are propagated to the membrane-proximal Ig domain of IFNARl, although this domain does not interact with the ligand. (Id. at 2572).
  • the crystal structure of a heterotrimeric complex of IFNARl, IFNAR2, and IFNoc2 depicts a linkerlike domain between the extracellular domain and the transmembrane domain of both IFNARs.
  • this linker-like domain may provide a degree of flexibility to facilitate formation of the ternary complex in an appropriate
  • a heterodimer comprising an IFNARl domain and an IFNAR2 domain, each coupled directly to a mutant Fc domain, without a linker, showed increased binding affinity and potency to type I interferon, relative to a heterodimer in which the IFNARl domain and IFNAR2 domain are each operatively coupled to a mutant Fc domain with a polypeptide linker (e.g., of 10 or 20 amino acids in length).
  • a polypeptide linker e.g., of 10 or 20 amino acids in length
  • the present disclosure provides heterodimers which binds type I interferons comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an IFNARl domain operatively coupled with or without a linker domain to a mutant Fc domain, and wherein the second polypeptide comprises an IFNAR2 domain operatively coupled with or without a linker domain to a mutant Fc domain.
  • the heterodimers of the disclosure are useful in methods of inhibiting type I interferon gene expression, methods of inhibiting type I interferon activity, and methods of treating autoimmune disease, as described herein. Definitions
  • amino acid refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids.
  • Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, ⁇ -carboxyglutamate, and O- phosphoserine.
  • Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, i.e., an a carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid.
  • Amino acid mimetics refer to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that function in a manner similar to a naturally occurring amino acid.
  • amino acid substitution refers to the replacement of at least one existing amino acid residue in a predetermined amino acid sequence (an amino acid sequence of a starting
  • amino acid insertion refers to the incorporation of at least one additional amino acid into a predetermined amino acid sequence. While the insertion will usually consist of the insertion of one or two amino acid residues, larger “peptide insertions” can be made, e.g. insertion of about three to about five or even up to about ten, fifteen, or twenty amino acid residues. The inserted residue(s) may be naturally occurring or non-naturally occurring as disclosed above.
  • amino acid deletion refers to the removal of at least one amino acid residue from a predetermined amino acid sequence.
  • Polypeptide “peptide,” and “protein” are used interchangeably herein to refer to a polymer of amino acid residues. The terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymer.
  • Nucleic acid refers to deoxyribonucleotides or ribonucleotides and polymers thereof in either single- or double-stranded form. Unless specifically limited, the term encompasses nucleic acids containing known analogues of natural nucleotides that have similar binding properties as the reference nucleic acid and are metabolized in a manner similar to naturally occurring nucleotides. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions) and complementary sequences, as well as the sequence explicitly indicated.
  • degenerate codon substitutions can be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et al., Nucleic Acid Res 1991;19:5081; Ohtsuka et al., JBC 1985;260:2605-8); Rossolini et al., Mol Cell Probes 1994;8:91-8).
  • modifications at the second base can also be conservative.
  • nucleic acid is used interchangeably with gene, cDNA, and mRNA encoded by a gene.
  • Polynucleotides of the present invention can be composed of any polyribonucleotide or polydeoxribonucleotide, which can be unmodified RNA or DNA or modified RNA or DNA.
  • polynucleotides can be composed of single- and double- stranded DNA, DNA that is a mixture of single- and double- stranded regions, single- and double-stranded RNA, and RNA that is mixture of single- and double- stranded regions, hybrid molecules comprising DNA and RNA that can be single-stranded or, more typically, double-stranded or a mixture of single- and double-stranded regions.
  • polynucleotide can be composed of triple-stranded regions comprising RNA or DNA or both RNA and DNA.
  • a polynucleotide can also contain one or more modified bases or DNA or RNA backbones modified for stability or for other reasons.
  • Modified bases include, for example, tritylated bases and unusual bases such as inosine.
  • a variety of modifications can be made to DNA and RNA; thus, "polynucleotide” embraces chemically, enzymatically, or metabolically modified forms.
  • operably linked or “operably coupled” refers to a juxtaposition wherein the components described are in a relationship permitting them to function in their intended manner.
  • glycoslation or “glycosylated” refers to a process or result of adding sugar moieties to a molecule.
  • altered glycosylation refers to a molecule that is
  • glycosylation site(s) refers to both sites that potentially could accept a carbohydrate moiety, as well as sites within the protein on which a carbohydrate moiety has actually been attached and includes any amino acid sequence that could act as an acceptor for an oligosaccharide and/or carbohydrate.
  • amino acid residues that serve as acceptors of glycosylation.
  • a protein or polypeptide can be expressed in, e.g., E. coli, to produce an aglycosylated protein or polypeptide.
  • deglycosylation or “deglycosylated” refers to the process or result of enzymatic removal of sugar moieties on a molecule.
  • underglycosylation or "underglycosylated” refers to a molecule in which one or more carbohydrate structures that would normally be present if produced in a mammalian cell has been omitted, removed, modified, or masked.
  • Fc region and "Fc domain” is the portion of a native immunoglobulin formed by the respective Fc domains (or Fc moieties) of its two heavy chains without the variable regions which bind antigen.
  • an Fc domain begins in the hinge region just upstream of the papain cleavage site and ending at the C-terminus of the antibody. Accordingly, a complete Fc domain comprises at least a hinge domain, a CH2 domain, and a CH3 domain.
  • an Fc domain comprises at least one of: a hinge (e.g., upper, middle, and/or lower hinge region) domain, a CH2 domain, a CH3 domain, a CH4 domain, or a variant, portion, or fragment thereof.
  • an Fc domain comprises a complete Fc domain (i.e., a hinge domain, a CH2 domain, and a CH3 domain).
  • an Fc domain comprises a hinge domain (or portion thereof) fused to a CH3 domain (or portion thereof).
  • an Fc domain comprises a CH2 domain (or portion thereof) fused to a CH3 domain (or portion thereof).
  • an Fc domain consists of a CH3 domain or portion thereof.
  • an Fc domain consists of a hinge domain (or portion thereof) and a CH3 domain (or portion thereof). In another embodiment, an Fc domain consists of a CH2 domain (or portion thereof) and a CH3 domain. In another embodiment, an Fc domain consists of a hinge domain (or portion thereof) and a CH2 domain (or portion thereof). In one embodiment, an Fc domain lacks at least a portion of a CH2 domain (e.g., all or part of a CH2 domain). In one embodiment, an Fc domain of the invention comprises at least the portion of an Fc molecule known in the art to be required for FcRn binding.
  • an Fc domain of the invention comprises at least the portion of an Fc molecule known in the art to be required for Protein A binding. In one embodiment, an Fc domain of the invention comprises at least the portion of an Fc molecule known in the art to be required for protein G binding.
  • An Fc domain herein generally refers to a polypeptide comprising all or part of the Fc domain of an immunoglobulin heavy-chain. This includes, but is not limited to, polypeptides comprising the entire CHI, hinge, CH2, and/or CH3 domains as well as fragments of such peptides comprising only, e.g., the hinge, CH2, and CH3 domain.
  • the Fc domain may be derived from an immunoglobulin of any species and/or any subtype, including, but not limited to, a human IgGl, IgG2, IgG3, IgG4, IgD, IgA, IgE, or IgM antibody.
  • the Fc domain encompasses native Fc and Fc variant molecules.
  • Fc domain includes molecules in monomeric or multimeric form, whether digested from whole antibody or produced by other means.
  • any Fc domain may be modified such that it varies in amino acid sequence from the native Fc domain of a naturally occurring immunoglobulin molecule.
  • the Fc domains of an interferon receptor Fc construct of the disclosure may be derived from different immunoglobulin molecules.
  • an Fc domain of an interferon receptor Fc construct may comprise a CH2 and/or CH3 domain derived from an IgGl molecule and a hinge region derived from an IgG3 molecule.
  • an Fc domain can comprise a chimeric hinge region derived, in part, from an IgGl molecule and, in part, from an IgG3 molecule.
  • an Fc domain can comprise a chimeric hinge derived, in part, from an IgGl molecule and, in part, from an IgG4 molecule.
  • the wild type human IgGl Fc domain has the amino acid sequence set forth in SEQ ID NO: 26.
  • the term “serum half-life” refers to the time required for the in vivo serum soluble interferon receptor concentration to decline by 50%. The shorter the serum half-life of the soluble interferon receptor, the shorter time it will have to exert a therapeutic effect.
  • the term “soluble interferon receptor” or “heterodimer” refers to a molecule comprising a first IFNAR domain, or variant or fragment thereof, and a second IFNAR domain, or a variant or fragment thereof. In some embodiments, an IFNAR domain is the extracellular domain of an IFNAR.
  • the soluble interferon receptor comprises a first polypeptide and a second polypeptide, wherein the first polypeptide comprises the extracellular domain of an IFNAR, or a variant or fragment thereof, and the second polypeptide comprises the extracellular domain of an IFNAR, or a variant or fragment thereof.
  • the first and second polypeptide interact to form a dimer (e.g., a heterodimer).
  • a soluble interferon receptor comprises a first polypeptide comprising an IFNAR domain, or a variant or fragment thereof operably linked, with or without a linker domain, to an immunoglobulin Fc domain, or a variant or fragment thereof, and wherein the second polypeptide comprises an IFNAR domain, or a variant or fragment thereof operably linked, with or without a linker domain, to an immunoglobulin Fc domain, or a variant or fragment thereof; and nucleic acids encoding such polypeptides.
  • the first polypeptide comprises INFAR1, or a variant or fragment thereof operably linked, with or without a linker domain, to a Fc domain, or variant or fragment thereof.
  • the second polypeptide comprises INFAR2, or a variant or fragment thereof operably linked, with or without a linker domain, to a variant Fc domain, or variant or fragment thereof.
  • the first and second polypeptides dimerize to form a heterodimeric construct.
  • the first and/or second polypeptides may or may not comprise a leader sequence.
  • the soluble interferon receptor may or may not comprise a leader sequence.
  • the soluble interferon receptors comprise two or more interferon receptor Fc constructs.
  • the soluble interferon receptor binds type I interferons, e.g., IFN-a, INF- ⁇ , IFN- ⁇ , - ⁇ , - ⁇ , - ⁇ , IFN- ⁇ , IFN-v.
  • interferon receptor Fc construct refers to a polypeptide comprising an IFNAR domain (e.g., IFNAR1 or IFNAR2), or a variant or fragment thereof operably linked, with or without a linker domain, to an Fc domain, or a variant or fragment thereof, and nucleic acids encoding such polypeptides.
  • the IFNAR domain is the extracellular domain of an IFNAR.
  • the interferon receptor Fc construct may or may not comprise a leader sequence.
  • the interferon receptor Fc construct may also be referred to as an "interferon receptor Fc protein".
  • type I interferon refers to a pro-inflammatory cytokine that binds to a heterodimeric cell surface receptor, IFN-a receptor (IFNAR), comprising IFNARl and IFNAR2.
  • IFNAR IFN-a receptor
  • Type I IFNs are rapidly produced in multiple different cell types, and known to have a wide variety of effects.
  • type I IFN activity refers to a biological activity which results upon interaction of a type I IFN to a receptor (IFNAR), including, but not limited to, those described herein.
  • IFNAR a receptor
  • Type I IFN modulates innate immune cell activation (e.g., maturation of dendritic cells) to promote antigen presentation and natural killer cell functions.
  • Type I IFN also promotes the development of high- affinity antigen- specific T and B cell responses and immunological memory (Ivashkiv and Donlin (2014) Nat Rev Immunol 14(l):36-49).
  • Type I IFNs have been shown to activate dendritic cells (DCs) and promote their T cell stimulatory capacity through autocrine signaling (Montoya et al., (2002) Blood 99:3263-3271).
  • Type I IFN exposure facilitates maturation of DCs via increasing the expression of chemokine receptors and adhesion molecules (e.g., to promote DC migration into draining lymph nodes), co-stimulatory molecules, and MHC class I and class II antigen presentation.
  • DCs that mature following type I IFN exposure can effectively prime protective T cell responses (Wijesundara et al., (2014) Front Immunol 29(412) and references therein).
  • type I IFN activity is an increase or induction in DC activation and/or maturation.
  • type I IFN activity is an increase or induction in DC migration to draining lymph nodes.
  • type I IFN can either promote T cell activation, proliferation, differentiation and survival (Crouse et al., (2015) Nat Rev Immunol 15:231-242).
  • MHC-I expression is upregulated in response to type I IFN in multiple cell types (Lindahl et al., (1976), J Infect Dis 133(Suppl):A66-A68; Lindahl et al., (1976) Proc Natl Acad Sci USA 17: 1284-1287) which is a requirement for optimal T cell stimulation, differentiation, expansion and cytolytic activity.
  • type I IFNs can exert potent co- stimulatory effects on CD8 T cells, enhancing CD8 T cell proliferation and differentiation (Curtsinger et al., (2005) J Immunol 174:4465-4469; Kolumam et al., (2005) J Exp Med 202:637-650). Accordingly, in some embodiments, type I IFN activity is an increase or induction in T cell proliferation. In some embodiments, type I IFN activity is an increase or induction in CD8+ T cell proliferation. In some embodiments, type I IFN activity is an increase or induction in T cell differentiation. In some embodiments, type I IFN activity is an increase or induction in CD8+ T cell
  • type I IFN exposure has been shown to promote B cell activation, antibody production and isotype switch following viral infection or following experimental immunization (Le Bon et al., (2006) J Immunol 176:4:2074-2078; Swanson et al., (2010) J Exp Med 207: 1485-1500). Accordingly, in some embodiments, type I IFN activity is an increase or induction in antibody production.
  • a type I IFN activity results upon IFNoc binding to IFNAR. In some embodiments, a type I IFN activity results upon IFN binding to IFNAR. In some embodiments, a type I IFN activity is selected from the group consisting of: (i) an increase or induction in T cell proliferation (e.g., CD8+ T cell proliferation); (ii) an increase or induction in DC maturation; (iii) an increase or induction in DC migration into draining lymph nodes; (iv) an increase or induction in T cell differentiation (e.g., CD8+ T cell differentiation); (v) an increase or induction in antibody production; and (vi) any combination of (i)-(v). In some embodiments, a type I IFN activity is determined in vitro. In some embodiments, a type I IFN activity is determined in vivo.
  • the heterodimers described herein inhibit or reduce a type I IFN activity.
  • the heterodimers described herein : (i) inhibit or reduce T cell proliferation (e.g., CD8+ T cell proliferation); (ii) inhibitor reduce DC maturation; (iii) inhibit or reduce DC migration into draining lymph nodes; (iv) inhibit or reduce T cell differentiation (e.g., CD8+ T cell differentiation); (v) inhibit or reduce IFN-mediated antibody production; or (vi) any combination of (i) - (v).
  • inhibition or reduction of type I IFN activity by the heterodimers described herein is relative to the activity in the absence of a heterodimer. Methods for determining inhibition or reduction of T cell proliferation, DC maturation, DC migration, T cell differentiation, and IFN-mediated antibody production are known to those of skill in the art.
  • the term "dimer” refers to a macromolecular complex formed by two macromolecules (e.g., polypeptides).
  • a “homodimer” refers to a dimer that is formed by two identical macromolecules (e.g., polypeptides).
  • a “heterodimer” refers to a dimer that is formed by two different macromolecules (e.g., polypeptides).
  • variant refers to a polypeptide derived from a wild-type interferon receptor or Fc domain and differs from the wild-type by one or more alteration(s), i.e., a substitution, insertion, and/or deletion, at one or more positions.
  • a substitution means a replacement of an amino acid occupying a position with a different amino acid.
  • a deletion means removal of an amino acid occupying a position.
  • An insertion means adding 1 or more, such as 1-3 amino acids, immediately adjacent to an amino acid occupying a position.
  • Variant polypeptides necessarily have less than 100% sequence identity or similarity with the wild-type polypeptide.
  • the variant polypeptide will have an amino acid sequence from about 75% to less than 100% amino acid sequence identity or similarity with the amino acid sequence of wild-type polypeptide, or from about 80% to less than 100%, or from about 85% to less than 100%, or from about 90% to less than 100% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%o, 99%) or from about 95% to less than 100%, e.g., over the length of the variant polypeptide.
  • the interferon receptor Fc constructs employ one or more "linker domains,” such as polypeptide linkers.
  • linker domain refers to one or more amino acids which connect two or more peptide domains in a linear polypeptide sequence.
  • polypeptide linker refers to a peptide or polypeptide sequence (e.g., a synthetic peptide or polypeptide sequence) which connects two or more polypeptide domains in a linear amino acid sequence of a protein.
  • polypeptide linkers may be used to operably link an interferon receptor to an Fc domain. Such polypeptide linkers in some embodiments provide flexibility to the polypeptide molecule.
  • the polypeptide linker is used to connect (e.g., genetically fuse), for example, an IFNAR1 domain to an Fc domain and/or an IFNAR2 domain to an Fc domain.
  • An interferon receptor Fc construct may include more than one linker domain or peptide linker.
  • Various peptide linkers are known in the art.
  • the term "gly-ser polypeptide linker” refers to a peptide that consists of glycine and serine residues.
  • An exemplary gly/ser polypeptide linker comprises the amino acid sequence (Gly 4 Ser)n.
  • n is 1 or more, such as 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, 7 or more, 8 or more, 9 or more, or 10 or more (e.g., (Gly 4 Ser)10).
  • Another exemplary gly/ser polypeptide linker comprises the amino acid sequence Ser(Gly 4 Ser)n.
  • n is 1 or more, such as 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, 7 or more, 8 or more, 9 or more, or 10 or more (e.g., Ser(Gly 4 Ser)10).
  • Coupled As used herein, the terms “coupled,” “conjugated,” “linked,” “fused,” or “fusion,” are used interchangeably. These terms refer to the joining together of two more elements or components or domains, by whatever means including chemical conjugation or recombinant means. Methods of chemical conjugation (e.g., using heterobifunctional crosslinking agents) are known in the art.
  • a polypeptide or amino acid sequence "derived from” a designated polypeptide or protein refers to the origin of the polypeptide.
  • the polypeptide or amino acid sequence which is derived from a particular sequence has an amino acid sequence that is essentially identical to that sequence or a portion thereof, wherein the portion consists of at least 10-20 amino acids, preferably at least 20-30 amino acids, more preferably at least 30-50 amino acids, or which is otherwise identifiable to one of ordinary skill in the art as having its origin in the sequence.
  • Polypeptides derived from another polypeptide may have one or more mutations relative to the starting polypeptide, e.g., one or more amino acid residues which have been substituted with another amino acid residue or which has one or more amino acid residue insertions or deletions.
  • Identity or similarity with respect to this sequence is defined herein as the percentage of amino acid residues in the candidate sequence that are identical (i.e., same residue) with the starting amino acid residues, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity.
  • a polypeptide of the disclosure consists of, consists essentially of, or comprises an amino acid sequence as set forth in the Sequence Listing or Sequence Table disclosed herein and functionally active variants thereof.
  • a polypeptide includes an amino acid sequence at least 80%, such as at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to an amino acid sequence set forth in the Sequence Listing or Sequence Table disclosed herein.
  • a polypeptide includes a contiguous amino acid sequence at least 80%, such as at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to a contiguous amino acid sequence set forth in the Sequence Listing or Sequence Table disclosed herein.
  • a polypeptide includes an amino acid sequence having at least 10, such as at least 15, at least 20, at least 25, at least 30, at least 35, at least 40, at least 45, at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 85, at least 90, at least 95, at least 100, at least 200, at least 300, at least 400, or at least 500 (or any integer within these numbers) contiguous amino acids of an amino acid sequence set forth in Sequence Listing or Sequence Table disclosed herein.
  • the interferon receptor Fc constructs of the disclosure are encoded by a nucleotide sequence.
  • Nucleotide sequences of the disclosure can be useful for a number of applications, including: cloning, gene therapy, protein expression and purification, mutation introduction, DNA vaccination of a host in need thereof, antibody generation for, e.g., passive immunization, PCR, primer and probe generation, siRNA design and generation (see, e.g., the Dharmacon siDesign website), and the like.
  • the nucleotide sequence of the disclosure comprises, consists of, or consists essentially of, a nucleotide sequence that encodes the amino acid sequence of the interferon receptor Fc constructs selected from the Sequence Table or Sequence Listing.
  • a nucleotide sequence includes a nucleotide sequence at least 80%, such as at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to a nucleotide sequence encoding an amino acid sequence of the Sequence Listing or Sequence Table disclosed herein.
  • a nucleotide sequence includes a contiguous nucleotide sequence at least 80%, such as at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to a contiguous nucleotide sequence encoding an amino acid sequence set forth in the Sequence Listing or Sequence Table disclosed herein.
  • a nucleotide sequence includes a nucleotide sequence having at least 10, such as at least 15, such as at least 20, at least 25, at least 30, at least 35, at least 40, at least 45, at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 85, at least 90, at least 95, at least 100, at least 200, at least 300, at least 400, or at least 500 (or any integer within these numbers) contiguous nucleotides of a nucleotide sequence encoding an amino acid sequence set forth in the Sequence Listing or Sequence Table disclosed herein.
  • interferon receptor Fc constructs may be altered such that they vary in sequence from the naturally occurring or native sequences from which their components (e.g., interferon receptor domains, linker domains, and Fc domains) are derived, while retaining the desirable activity of the native sequences.
  • nucleotide or amino acid substitutions leading to conservative substitutions or changes at "non-essential" amino acid residues may be made.
  • An isolated nucleic acid molecule encoding a non-natural variant can be created by introducing one or more nucleotide
  • substitutions, additions or deletions into the nucleotide sequence of the interferon receptor Fc constructs such that one or more amino acid substitutions, additions or deletions are introduced into the encoded protein. Mutations may be introduced by standard techniques, such as site- directed mutagenesis and PCR-mediated mutagenesis.
  • the interferon receptor Fc constructs may comprise conservative amino acid substitutions at one or more amino acid residues, e.g., at essential or non-essential amino acid residues.
  • a "conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain.
  • Families of amino acid residues having similar side chains have been defined in the art, including basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta- branched side chains (e.g., threonine, valine, isoleucine), and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
  • basic side chains e.g., lysine, arginine, histidine
  • acidic side chains e.g., aspartic
  • a nonessential amino acid residue in an interferon receptor Fc construct is preferably replaced with another amino acid residue from the same side chain family.
  • a string of amino acids can be replaced with a structurally similar string that differs in order and/or composition of side chain family members.
  • mutations may be introduced randomly along all or part of a coding sequence, such as by saturation mutagenesis, and the resultant mutants can be incorporated into the interferon receptor Fc constructs and screened for their ability to bind to the desired target.
  • ameliorating refers to any therapeutically beneficial result in the treatment of a disease state, e.g., an autoimmune disease state (e.g., SLE, Sjogren's syndrome), including prophylaxis, lessening in the severity or progression, remission, or cure thereof.
  • a disease state e.g., an autoimmune disease state (e.g., SLE, Sjogren's syndrome)
  • prophylaxis e.g., SLE, Sjogren's syndrome
  • in situ refers to processes that occur in a living cell growing separate from a living organism, e.g., growing in tissue culture.
  • in vivo refers to processes that occur in a living organism.
  • mammal or “subject” or “patient” as used herein includes both humans and non-humans and include but is not limited to humans, non-human primates, canines, felines, murines, bovines, equines, and porcines.
  • percent “identity,” in the context of two or more nucleic acid or polypeptide sequences, refer to two or more sequences or subsequences that have a specified percentage of nucleotides or amino acid residues that are the same, when compared and aligned for maximum correspondence, as measured using one of the sequence comparison algorithms described below (e.g., BLASTP and BLASTN or other algorithms available to persons of skill) or by visual inspection.
  • sequence comparison algorithms e.g., BLASTP and BLASTN or other algorithms available to persons of skill
  • the percent “identity” can exist over a region of the sequence being compared, e.g., over a functional domain, or, alternatively, exist over the full length of the two sequences to be compared.
  • sequence comparison typically one sequence acts as a reference sequence to which test sequences are compared.
  • test and reference sequences are input into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated.
  • sequence comparison algorithm then calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters.
  • Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv Appl Math 1981;2:482, by the homology alignment algorithm of Needleman & Wunsch, J Mol Biol 1970;48:443, by the search for similarity method of Pearson & Lipman, PNAS 1988;85:2444, by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.), or by visual inspection (see generally Ausubel et al, infra).
  • BLAST algorithm One example of an algorithm that is suitable for determining percent sequence identity and sequence similarity is the BLAST algorithm, which is described in Altschul et al., J Mol Biol 1990;215:403-10. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information website.
  • sufficient amount means an amount sufficient to produce a desired effect.
  • therapeutically effective amount is an amount that is effective to ameliorate a symptom of a disease.
  • a therapeutically effective amount can be a “prophylactically effective amount” as prophylaxis can be considered therapy.
  • the soluble interferon receptors of the disclosure include a first polypeptide and a second polypeptide, wherein each polypeptide comprises an interferon receptor Fc construct with or without a leader sequence.
  • An interferon receptor Fc construct includes an interferon receptor domain (e.g., IFNAR1 or IFNAR2), with or without a leader sequence, or a variant or fragment thereof, operably coupled with or without a linker domain to a Fc domain, or a variant or fragment thereof.
  • the first and second polypeptides dimerize to form a dimer; for example, a heterodimer.
  • a composition of the disclosure includes a soluble interferon receptor.
  • the interferon receptor domain is operably coupled to an Fc domain, or a variant of fragment thereof without a linker domain. In some embodiments, the interferon receptor domain is operably coupled to an Fc domain, or a variant or fragment thereof, via a linker domain. In some embodiments, the linker domain is a linker peptide. In some embodiments, the linker domain is a linker nucleotide.
  • linker domains include (gly4ser) 2, 3, 4 or 5 variants that alter the length of the linker by 5 amino acid progressions.
  • a linker domain is approximately 18 amino acids in length and includes an N-linked glycosylation site, which can be sensitive to protease cleavage in vivo.
  • an N-linked glycosylation site can protect the soluble interferon receptor from cleavage in the linker domain.
  • an N-linked glycosylation site can assist in separating the folding of independent functional domains separated by the linker domain.
  • the linker domain is an NLG linker (VDGASSPVNVSSPSVQDI) (SEQ ID NO: 18).
  • the interferon receptor Fc construct includes a leader molecule, e.g., a leader peptide.
  • the leader molecule is a leader peptide positioned at the N-terminus of the interferon receptor domain.
  • an interferon receptor Fc construct of the invention comprises a leader peptide at the N-terminus of the molecule, wherein the leader peptide is later cleaved from the interferon receptor Fc construct.
  • any of the interferon receptor Fc constructs of the present invention can be expressed or synthesized either with or without a leader fused to their N-terminus.
  • the protein sequence of an interferon receptor Fc construct of the present disclosure following cleavage of a fused leader peptide can be predicted and/or deduced by one of skill in the art.
  • the leader peptide comprises the amino acid sequence:
  • VK3 leader peptide VK3LP, which comprises the amino acid sequence:
  • the leader peptide is fused to the N-terminus of the interferon receptor Fc construct.
  • Such leader sequences can improve the level of synthesis and secretion of the interferon receptor Fc construct in mammalian cells.
  • the leader is cleaved, yielding interferon receptor Fc constructs.
  • an interferon receptor Fc construct of the present invention is expressed without a leader peptide fused to its N-terminus, and the resulting interferon receptor Fc construct has an N-terminal methionine.
  • the soluble interferon receptors of the disclosure include a first and a second polypeptide, wherein each of the polypeptides includes an interferon receptor domain (e.g. IFNAR1, IFNAR2), with or without a leader sequence, or variant or fragment thereof operably coupled, with or without a linker domain, to the N- or C-terminus of an immunoglobulin Fc domain, or a variant or fragment thereof.
  • the interferon receptor domains of each of the two polypeptides are different, e.g., IFNARl and IFNAR2.
  • a soluble interferon receptor is a dimeric molecule.
  • the first and second polypeptides dimerize to form a heterodimer.
  • the interferon receptor Fc construct includes substantially all or at least an active fragment of an interferon receptor.
  • the interferon receptor is IFNARl, for example, the extracellular domain of a human IFNARl (SEQ ID NO: 11), or a variant or fragment thereof.
  • the interferon receptor is IFNAR2, for example, a the extracellular domain of human IFNAR2 (SEQ ID NO: 12), or a variant or fragment thereof.
  • a IFNAR-linker-Fc containing a 20 or 25 aa linker domain is made.
  • a IFNAR-linker-Fc containing a 10 aa linker domain is made.
  • a IFNAR-linker-Fc containing a 5 aa linker domain is made. In some embodiments, a IFNAR-Fc without a linker domain is made. In some embodiments, the interferon receptor may or may not include a leader sequence.
  • interferon receptor Fc constructs include IFNAR-linker-Fc, wherein the IFNAR domain is located at the COOH side of the Fc. In other embodiments, interferon receptor Fc constructs include IFNAR-linker-Fc, wherein the IFNAR domain is located at the NH2 side of the Fc. In some embodiments, soluble interferon receptors include: IFNAR 1-Fc and IFNAR2-Fc; IFNAR 1-linker-Fc and IFNAR2-linker-Fc; Fc-IFNARl and Fc- IFNAR2; Fc-linker- IFNARl and Fc-linker-IFNAR2. The interferon receptor Fc constructs may or may not include a leader sequence.
  • fusion junctions between interferon receptor domains and the other domains of the interferon receptor Fc constructs are optimized.
  • Figure 1 displays exemplary configurations of the soluble interferon receptors, and the Sequence Table provides the sequences of exemplary interferon receptor Fc constructs of various configurations.
  • the interferon receptor domain is operably coupled (e.g., chemically conjugated or genetically fused (e.g., either directly or via a linker, such as a polypeptide linker)) to the N-terminus of a Fc domain, or a variant or fragment thereof.
  • the interferon receptor domain is operably coupled (e.g., chemically conjugated or genetically fused (e.g., either directly or via a linker, such as a polypeptide linker)) to the C-terminus of a Fc domain, or a variant or fragment thereof.
  • an interferon receptor domain is operably coupled (e.g., chemically conjugated or genetically fused (e.g., either directly or via a linker, such as a polypeptide linker)) via an amino acid side chain of a Fc domain, or a variant or fragment thereof.
  • the soluble interferon receptors comprise at least two of the same or different interferon receptor domains (e.g., IFNAR1 and IFNAR2), or a variant or fragment thereof, and at least two of the same or different Fc domains, or a variant or fragment thereof, with an optional linker domain between the interferon receptor domains and the Fc domains.
  • interferon receptor domains e.g., IFNAR1 and IFNAR2
  • Fc domains e.g., Fc domains
  • the interferon receptor Fc constructs form a heterodimer.
  • the soluble interferon receptor of the disclosure comprise a Fc domain, or a variant or fragment thereof, as described herein, thereby increasing serum half-life and bioavailability of the soluble interferon receptors.
  • interferon receptor domains and Fc domains are possible, with the inclusion of optional linkers between the interferon receptor domain and Fc domain. It will also be understood that domain orientation can be altered, so long as the interferon receptor domains are active in the particular
  • the soluble interferon receptor of the disclosure have at least one interferon receptor domain specific for a target molecule which mediates a biological effect.
  • binding of the soluble interferon receptor of the disclosure to a target molecule such as type I interferon (e.g. IFN-a, INF- ⁇ , IFN- ⁇ , - ⁇ , - ⁇ , - ⁇ , IFN- ⁇ , IFN-v), results in the reduction or elimination of the target molecule, e.g., from a cell, a tissue, or from circulation.
  • type I interferon e.g. IFN-a, INF- ⁇ , IFN- ⁇ , - ⁇ , - ⁇ , - ⁇ , IFN- ⁇ , IFN-v
  • the interferon receptor Fc constructs of the disclosure may be assembled together or with other interferon receptor Fc constructs or polypeptides to form binding proteins having two or more polypeptides ("multimers"), wherein at least one polypeptide of the multimer is an interferon receptor Fc construct of the disclosure.
  • multimeric forms include dimeric, trimeric, tetrameric, and hexameric altered binding proteins and the like.
  • the polypeptides of the multimer are the same (i.e., homomeric binding proteins, e.g., homodimers, homotetramers).
  • the polypeptides of the multimer are different (e.g., heteromeric binding proteins, e.g., heterodimers).
  • a soluble interferon receptor has a serum half-life that is increased at least about 1.5-fold, such as at least 3-fold, at least 5-fold, at least 10-fold, at least about 20- fold, at least about 50-fold, at least about 100-fold, at least about 200-fold, at least about 300- fold, at least about 400-fold, at least about 500-fold, at least about 600-fold, at least about 700- fold, at least about 800-fold, at least about 900-fold, at least about 1000-fold, or 1000-fold or greater relative to the corresponding interferon receptor molecules not fused to the Fc domain, or a variant or fragment thereof.
  • a soluble interferon receptor has a serum half-life that is decreased at least about 1.5-fold, such as at least 3-fold, at least 5-fold, at least 10-fold, at least about 20-fold, at least about 50-fold, at least about 100-fold, at least about 200- fold, at least about 300-fold, at least about 400-fold, at least about 500-fold, or 500-fold or lower relative to the corresponding interferon receptor molecules not fused to the Fc domain, or a variant or fragment thereof.
  • Routine art-recognized methods can be used to determine the serum half-life of the soluble interferon receptors of the disclosure.
  • the activity of the interferon receptor (e.g., IFNAR1 or IFNAR2) in the soluble interferon receptor is not less than about 10-fold less, such as 9-fold less, 8-fold less, 7-fold less, 6-fold less, 5-fold less, 4-fold less, 3-fold less, or 2-fold less than the activity of a naturally coccuring, wild type interferon receptor molecule. In some embodiments, the activity of the interferon receptor in the soluble interferon receptor is about equal to the activity of a naturally occuring, wild type interferon receptor molecule.
  • the soluble interferon receptor can bind to and decrease the effects of interferon.
  • the activity of the soluble interferon receptor is detectable in vitro and/or in vivo.
  • the soluble interferon receptor construct binds to a cell, a diseased cell, a malignant cell, or a cancer cell and interferes with its biologic activity.
  • a multifunctional soluble interferon receptor is provided that is attached to an enzyme or antibody having binding specificity, such as an scFv targeted to type I interferons.
  • type I interferons include IFN-a, INF- ⁇ , IFN- ⁇ , - ⁇ , - ⁇ , - ⁇ , IFN- ⁇ , IFN- v.
  • the targets of the IFNAR domains of the soluble interferon receptor are primarily extracellular type I interferons.
  • the soluble interferon receptor is active in the acidic environment of the endocytic vesicles.
  • a soluble interferon receptor, including a Fc domain, or a variant or fragment thereof, is adapted to be active both
  • the IFNAR domain of a soluble interferon receptor is not active in the cytoplasm of a cell.
  • soluble interferon receptors include both IFNAR 1 and IFNAR2. In some embodiments, these soluble interferon receptors improve therapy of SLE because they bind interferon (IFN), e.g., IFNoc or IFN , and negate or reduce the inflammatory effects of the cytokine.
  • IFN interferon
  • the interferon receptor Fc constructs of the present disclosure comprise one or more interferon receptor domains (IFNAR), or a variant or fragment thereof operably coupled with or without a linker domain to an immunoglobulin Fc domain, or a variant or fragment thereof.
  • the interferon receptor domain is a variant or fragment of an interferon receptor domain.
  • the interferon receptor domain comprises the extracellular domain of the interferon receptor.
  • the interferon receptor domain includes a leader sequence. In some embodiments, the interferon receptor domain does not include a leader sequence.
  • IFNAR domains are well-known in the art and include, but are not limited to, IFNAR1 and IFNAR2.
  • IFNAR domains are discussed in deWeerd et al., Type I Interferon Receptors: Biochemistry and Biological Functions, J. of Biol. Chem., Vol. 282, No. 28, 20053-20057 (2007), the entire contents of which is hereby incorporated herein by reference.
  • the type I interferon- / ⁇ receptor is a heteromeric cell surface receptor comprised of multiple components, designated IFNARl and IFNAR2.
  • the INFAR complex is unique among cytokine receptors as it binds to and/or mediates signaling by more than 15 different but related type I interferon (IFN) ligands, including, for example, IFN-oc and IFN- ⁇ , several IFN subtypes, IFN- ⁇ , IFN- ⁇ , IFN- ⁇ , and others.
  • IFNAR Upon binding of type I IFNs, IFNAR activates the JAK-STAT signaling pathway.
  • the interferon receptor Fc constructs of the disclosure bind interferon (e.g., IFN- a, INF- ⁇ , IFN-D, -D , -D , -D, IFN-D, IFN-D) when complexed with another interferon receptor Fc construct in the form of a heterodimer.
  • a heterodimer of the disclosure capable of binding interferon comprises a first interferon receptor Fc construct, wherein the IFNAR is IFNARl, and a second interferon receptor Fc construct, wherein the IFNAR is IFNAR2.
  • the IFNAR domain of an interferon receptor Fc construct is a naturally occurring wild-type IFNARl protein having the amino acid sequence set forth as SEQ ID NO:5.
  • the IFNAR domain is a variant or fragment of the IFNARl protein.
  • the IFNAR domain comprises 50-100, 100-150, 150-200, 200- 250, 250-300, 300-350, 350-400, 400-450, 450-500, or 450-557 amino acids of the amino acids sequence set forth as SEQ ID NO: 5.
  • the IFNAR domain comprises 350- 360, 360-370, 370-380, 380-390, 390-400, 400-410, 410-420, 420-430, 430-440, 440-450, 450- 470, 460-470, 470-480, 480-490, or 490-500 amino acids of the amino acid sequence set forth as SEQ ID NO: 5.
  • the IFNARl domain comprises amino acids 28-436 of the amino acid sequence set forth as SEQ ID NO: 5.
  • the IFNAR domain comprises an amino acid sequence at least 70% identical, such as 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or at least 99.5% identical to the amino acid sequence set forth as SEQ ID NO: 5.
  • the IFNAR domain of an interferon receptor Fc construct comprises the amino acid sequence set forth as SEQ ID NO:7. In some embodiments, the IFNAR domain comprises the amino acid sequence set forth as SEQ ID NO: 11. In some embodiments, the IFNAR domain comprises an amino acid sequence at least 80% identical, such as 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or at least 99.5% identical to the amino acid sequence set forth as SEQ ID NO: 7 or SEQ ID NO: 11.
  • the IFNAR domain is a naturally occurring human wild-type IFNAR2 protein having the amino acid sequence set forth as SEQ ID NO: 6. In some embodiments, the IFNAR domain is a variant or fragment of the IFNAR2 protein. In some embodiments, the IFNAR domain comprises 50-100, 100-150, 150-200, 200-250, 250-300, 300- 350, 350-400, 400-450, 450-500, or 450-515 amino acids of the amino acids sequence set forth as SEQ ID NO: 6.
  • the IFNAR domain comprises 150-160, 160-170, 170- 180, 180-190, 190-200, 200-210, 210-220, 220-230, 230-240, 240-250, 250-260, 260-270, 270- 280, 280-290, 290-300 amino acids of the amino acids sequence set forth as SEQ ID NO: 6.
  • the IFNAR2 domain comprises amino acids 27-243 of the amino acid sequence set forth as SEQ ID NO: 6.
  • the IFNAR domain comprises an amino acid sequence at least 70% identical, such as 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or at least 99.5% identical to the amino acid sequence set forth as SEQ ID NO: 6.
  • the IFNAR domain of an interferon receptor Fc construct comprises the amino acid sequence set forth as SEQ ID NO:8. In some embodiments, the IFNAR domain comprises the amino acid sequence set forth as SEQ ID NO: 12. In some embodiments, the IFNAR domain comprises an amino acid sequence at least 80% identical, such as 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or at least 99.5% identical to the amino acid sequence set forth as SEQ ID NO: 8 or SEQ ID NO: 12.
  • the interferon receptor domain comprises the extracellular domain of an interferon receptor. In some embodiments, the interferon receptor domain comprises the extracellular domain of IFNAR 1. In some embodiments, the interferon receptor domain comprises the extracellular domain of IFNAR2. In some embodiments, the extracellular domain of an interferon receptor (e.g., IFNAR1 or IFNAR2) is essentially free of the transmembrane and cytoplasmic domains. In some embodiments, the extracellular domain of an interferon receptor (e.g., IFNAR1 or IFNAR2) is anything less that the transmembrane and cytoplasmic domains.
  • the extracellular domain of IFNAR1 comprises the amino acid sequence set forth as SEQ ID NO: 7 or SEQ ID NO: 11. In some embodiments, the extracellular domains of IFNAR1 comprises amino acids 28-436 of the amino acid sequence set forth as SEQ ID NO: 5. In some embodiments, the extracellular domains of IFNAR1 comprises amino acids 1- 436 of the amino acid sequence set forth as SEQ ID NO: 5.
  • the extracellular domain of IFNAR2 comprises the amino acid sequence set forth as SEQ ID NO: 8 or SEQ ID NO: 12. In some embodiments, the extracellular domain of IFNAR2 domain comprises amino acids 27-243 of the amino acid sequence set forth as SEQ ID NO: 6. In some embodiments, the extracellular domain of IFNAR2 domain comprises amino acids 1-243 of the amino acid sequence set forth as SEQ ID NO: 6.
  • an IFNAR domain is altered or modified, e.g., by mutation which results in an amino acid addition, deletion, or substitution.
  • the term "IFNAR domain variant" refers to an IFNAR domain having at least one amino acid modification, such as an amino acid substitution, as compared to the wild-type IFNAR, or fragment thereof, from which the IFNAR domain is derived.
  • a variant comprises at least one amino acid mutation (e.g., substitution) as compared to a wild type amino acid at the corresponding position of the human wild-type IFNAR.
  • a variant comprises at least one amino acid mutation (e.g., substitution) as compared to an amino acid at the corresponding position of the extracellular IFNAR.
  • the IFNAR variant comprises one or more amino acid
  • substitutions at an amino acid position(s) located in the extracellular domain of the IFNAR are substitutions at an amino acid position(s) located in the extracellular domain of the IFNAR.
  • the soluble interferon receptors include one or more IFNAR domains. In some embodiments, the soluble interferon receptors include two IFNAR domains. In some embodiments, the IFNAR domains of the soluble interferon receptors are different (e.g., IFNAR 1 and IFNAR2).
  • the soluble interferon receptor includes a first polypeptide and a second polypeptide. In some embodiments, both the first polypeptide and the second
  • polypeptide comprise an interferon receptor Fc construct.
  • the IFNAR domain of the interferon receptor Fc construct is IFNAR 1, or a variant or fragment thereof.
  • the IFNAR domain of the interferon receptor Fc construct is IFNAR2, or a variant or fragment thereof.
  • the IFNAR domain of the first polypeptide of the soluble interferon receptor comprises IFNAR 1, or a variant or fragment thereof.
  • the IFNAR domain of the second polypeptide of the soluble interferon receptor comprises IFNAR2, or a variant or fragment thereof.
  • the IFNAR domain of the interferon receptor Fc construct is human IFNAR 1 or human IFNAR2.
  • the IFNAR domain of the interferon receptor Fc construct is a fragment or variant of IFNAR1 or a fragment or variant of IFNAR2. In some embodiments, the IFNAR domain of the interferon receptor Fc construct is the extracellular domain of human IFNAR 1 or the extracellular domain of human IFNAR2.
  • an interferon receptor Fc construct includes a linker domain. In some embodiments, an interferon receptor Fc construct includes a plurality of linker domains. In some embodiments, the linker domain is a polypeptide linker. In certain aspects, it is desirable to employ a polypeptide linker to fuse Fc, or a variant or fragment thereof, with one or more interferon receptor domains to form an interferon receptor Fc construct. In some embodiments, an interferon receptor Fc construct does not include a linker domain.
  • polypeptide linker is synthetic. As used herein, the term
  • polypeptide linker includes peptides (or polypeptides) which comprise an amino acid sequence (which may or may not be naturally occurring) that is linked in a linear sequence of amino acids to a sequence (which may or may not be naturally occurring) (e.g., a Fc sequence) to which it is not naturally linked in nature.
  • the polypeptide linker may comprise non-naturally occurring polypeptides which are modified forms of naturally occurring polypeptides (e.g., comprising a mutation such as an addition, substitution or deletion) or which comprise a first amino acid sequence (which may or may not be naturally occurring).
  • polypeptide linkers of the invention may be employed, for instance, to ensure that Fc, or a variant or fragment thereof, is juxtaposed to ensure proper folding and formation of a functional Fc, or a variant or fragment thereof.
  • a polypeptide linker compatible with the instant invention will be relatively non-immunogenic and not inhibit any non-covalent association among monomer subunits of a binding protein.
  • the interferon receptor Fc construct employs an NLG linker as set forth in SEQ ID NO: 18.
  • the interferon receptor Fc constructs of the disclosure employ a polypeptide linker to join any two or more domains in frame in a single polypeptide chain.
  • the two or more domains may be independently selected from any of the Fc domains, or variants or fragments thereof, or interferon receptor domains discussed herein.
  • a polypeptide linker can be used to fuse an Fc domain, or variant or fragment thereof to an IFNAR.
  • a polypeptide linker of the invention can be used to genetically fuse the C-terminus of an IFNAR to the N-terminus of a Fc domain, or variant or fragment thereof to form an interferon receptor Fc construct.
  • a polypeptide linker of the invention can be used to genetically fuse the C- terminus of a Fc domain, or variant or fragment thereof to the N-terminus of an IFNAR to form and interferon receptor Fc construct.
  • a polypeptide linker of the invention can be used to genetically fuse the C-terminus of an IFNAR to the C-terminus of a Fc domain, or variant or fragment thereof to form and interferon receptor Fc construct.
  • a polypeptide linker of the invention can be used to genetically fuse the N-terminus of an IFNAR to the N-terminus of a Fc domain, or variant or fragment thereof to form and interferon receptor Fc construct.
  • a polypeptide linker comprises a portion of a Fc domain, or a variant or fragment thereof.
  • a polypeptide linker can comprise a Fc fragment (e.g., C or N domain), or a different portion of a Fc domain or variant thereof.
  • a polypeptide linker comprises or consists of a gly-ser linker.
  • gly-ser linker refers to a peptide that consists of glycine and serine residues.
  • An exemplary gly/ser linker comprises an amino acid sequence of the formula
  • n is a positive integer (e.g., 1-10, 1, 2, 3, 4, or 5).
  • a preferred gly/ser linker is (Gly 4 Ser)i.
  • Another preferred gly/ser linker is (Gly 4 Ser) 2 .
  • Another preferred gly/ser linker is (Gly 4 Ser) 3 .
  • Another preferred gly/ser linker is (Gly 4 Ser) 4 .
  • Another preferred gly/ser linker is (Gly 4 Ser)5.
  • the gly-ser linker may be inserted between two other sequences of the polypeptide linker (e.g., any of the polypeptide linker sequences described herein).
  • a gly-ser linker is attached at one or both ends of another sequence of the polypeptide linker (e.g., any of the polypeptide linker sequences described herein). In yet other embodiments, two or more gly-ser linker are incorporated in series in a polypeptide linker.
  • a polypeptide linker of the invention comprises a biologically relevant peptide sequence or a sequence portion thereof.
  • a biologically relevant peptide sequence may include, but is not limited to, sequences derived from an anti-rejection or anti-inflammatory peptide.
  • Said anti-rejection or anti-inflammatory peptides may be selected from the group consisting of a cytokine inhibitory peptide, a cell adhesion inhibitory peptide, a thrombin inhibitory peptide, and a platelet inhibitory peptide.
  • a polypeptide linker comprises a peptide sequence selected from the group consisting of an IL- 1 inhibitory or antagonist peptide sequence, an erythropoietin (EPO)-mimetic peptide sequence, a thrombopoietin (TPO)-mimetic peptide sequence, G-CSF mimetic peptide sequence, a TNF- antagonist peptide sequence, an integrin-binding peptide sequence, a selectin antagonist peptide sequence, an anti-pathogenic peptide sequence, a vasoactive intestinal peptide (VIP) mimetic peptide sequence, a calmodulin antagonist peptide sequence, a mast cell antagonist, a SH3 antagonist peptide sequence, an urokinase receptor (UKR) antagonist peptide sequence, a somatostatin or cortistatin mimetic peptide sequence, and a macrophage and/or T-cell inhibiting peptide sequence.
  • EPO erythrop
  • linkers include GS linkers (i.e., (GS)n), GGSG (SEQ ID NO: 27) linkers (i.e., (GGSG)n), GSAT linkers (SEQ ID NO: 28), SEG linkers, and GGS linkers (i.e., (GGSGGS)n), wherein n is a positive integer (e.g., 1, 2, 3, 4, or 5).
  • GS linkers i.e., (GS)n
  • GGSG SEQ ID NO: 27
  • GSAT linkers SEQ ID NO: 28
  • SEG linkers i.e., 1, 2, 3, 4, or 5
  • GGS linkers i.e., (GGSGGS)n
  • n is a positive integer (e.g., 1, 2, 3, 4, or 5).
  • Other suitable linkers for use in the interferon receptor Fc constructs can be found using publicly available databases, such as the Linker Database (ibi.vu.nl/programs/linkerdbwww).
  • the Linker Database
  • variant forms of these exemplary polypeptide linkers can be created by introducing one or more nucleotide substitutions, additions or deletions into the nucleotide sequence encoding a polypeptide linker such that one or more amino acid
  • substitutions, additions or deletions are introduced into the polypeptide linker. Mutations may be introduced by standard techniques, such as site-directed mutagenesis and PCR-mediated mutagenesis.
  • Polypeptide linkers of the disclosure are at least one amino acid in length and can be of varying lengths.
  • a polypeptide linker of the invention is from about 1 to about 50 amino acids in length.
  • the term "about” indicates +/- two amino acid residues. Since linker length must be a positive integer, the length of from about 1 to about 50 amino acids in length, means a length of from 1 to 48-52 amino acids in length.
  • a polypeptide linker of the disclosure is from about 5-10 amino acids in length.
  • a polypeptide linker of the disclosure is from about 10-20 amino acids in length.
  • a polypeptide linker of the disclosure is from about 15-30 amino acids in length.
  • a polypeptide linker of the disclosure is from about 15 to about 50 amino acids in length.
  • a polypeptide linker of the disclosure is from about 20 to about 45 amino acids in length. In another embodiment, a polypeptide linker of the disclosure is from about 15 to about 25 amino acids in length. In another embodiment, a polypeptide linker of the disclosure is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56 ,57, 58, 59, 60, or 61 or more amino acids in length.
  • Polypeptide linkers can be introduced into polypeptide sequences using techniques known in the art. Modifications can be confirmed by DNA sequence analysis. Plasmid DNA can be used to transform host cells for stable production of the polypeptides produced.
  • the polypeptide comprising one or more interferon receptor domains, or a variant or fragment thereof is operably coupled, with or without a linker domain, to a Fc domain, which serves as a scaffold as well as a means to increase the serum half-life of the polypeptide.
  • the one or more interferon receptor domains and/or the Fc domain is aglycosylated, deglycosylated, or underglycosylated.
  • the Fc domain is a mutant or variant Fc domain, or a fragment of an Fc domain.
  • Suitable Fc domains are well-known in the art and include, but are not limited to, Fc and Fc variants, such as those disclosed in WO2011/053982, WO 02/060955, WO 02/096948, WO05/047327, WO05/018572, and US 2007/0111281 (the contents of the foregoing are incorporated herein by reference). It is within the abilities of the skilled artisan to use routine methods to introduce Fc domains (e.g., cloning, conjugation) into the interferon receptor Fc constructs disclosed herein (with or without altered glycosylation).
  • Fc and Fc variants such as those disclosed in WO2011/053982, WO 02/060955, WO 02/096948, WO05/047327, WO05/018572, and US 2007/0111281 (the contents of the foregoing are incorporated herein by reference). It is within the abilities of the skilled artisan to use routine methods to introduce Fc domains (e
  • the Fc domain is a wild type human IgGl Fc, such as is shown in SEQ ID NO: 26. In some embodiments, the Fc domain is a wild type human IgG4 Fc, such as is shown in SEQ ID NO: 112.
  • an Fc domain is altered or modified, e.g., by mutation which results in an amino acid addition, deletion, or substitution.
  • the term "Fc domain variant" refers to an Fc domain having at least one amino acid modification, such as an amino acid substitution, as compared to the wild-type Fc from which the Fc domain is derived.
  • a variant comprises at least one amino acid mutation (e.g., substitution) as compared to a wild type amino acid at the corresponding position of the human IgGl Fc region.
  • the amino acid substitution(s) of an Fc variant may be located at a position within the Fc domain referred to as corresponding to the position number that that residue would be given in an Fc region in an antibody (numbering according to EU index).
  • the Fc variant comprises one or more amino acid substitutions at an amino acid position(s) located in a hinge region or portion thereof. In another embodiment, the Fc variant comprises one or more amino acid substitutions at an amino acid position(s) located in a CH2 domain or portion thereof. In another embodiment, the Fc variant comprises one or more amino acid substitutions at an amino acid position(s) located in a CH3 domain or portion thereof. In another embodiment, the Fc variant comprises one or more amino acid substitutions at an amino acid position(s) located in a CH4 domain or portion thereof. In some embodiments, the Fc variant comprises one or more of the following amino acid substitutions: T350V, L351Y, F405A, and Y407V.
  • the Fc variant comprises one or more of the following amino acid substitutions: T350V, T366L, K392L, and T394W.
  • the Fc region has a mutation at N83 (i.e., N297 by Kabat numbering), yielding an aglycosylated Fc region (e.g., Fc N83S).
  • the Fc domain includes mutations in one or more of the three hinge region cysteines (residues 220, 226, and 229, numbering according to the EU index).
  • one or more of the three hinge cysteines in the Fc domain can be mutated to SCC (SEQ ID NO: 20) or SSS (SEQ ID NO: 21), where in "S” represents an amino acid substitution of cysteine with serine (wherein CCC refers to the three cysteines present in the wild type hinge domain).
  • SCC indicates an amino acid substitution to serine of only the first cysteine of the three hinge region cysteines (residues 220, 226, and 229, numbering according to the EU index)
  • SSS indicates that all three cysteines in the hinge region are substituted with serine (residues 220, 226, and 229, numbering according to the EU index).
  • the Fc domain is a mutant human IgGl Fc domain.
  • a mutant Fc domain comprises one or more mutations in the hinge, CH2, and/or CH3 domains.
  • the Fc domain is a mutant human IgG4 Fc domain.
  • mutations in the IgG4 Fc domain include one or more mutations selected from the following group of mutations: F296Y, E356K, R409K, and H345R. In some embodiments, mutations in the IgG4 Fc domain includes one or more mutation selected from the following group of mutations: F296Y, R409K, and K439E.
  • the soluble interferon receptors disclosed herein include a first polypeptide comprising a mutant IgG4 Fc domain, wherein the Fc domain includes mutations F296Y, E356K, R409K, and H345R, and a second polypeptide comprising a mutant IgG4 Fc domain, wherein the CH3 domain includes mutations F296Y, R409K, and K439E.
  • a mutant IgG4 Fc domain comprises one or more mutations in the hinge, CH2, and/or CH3 domains.
  • a mutant Fc domain includes a P238S mutation. In some aspects, a mutant Fc domain includes a P331S mutation. In some aspects, a mutant Fc domain includes a P238S mutation and a P331S mutation. In some aspects, a mutant Fc domain comprises P238S and/or P331S, and may include mutations in one or more of the three hinge cysteines (residues 220, 226, and 229), numbering according to the EU index. In some aspects, a mutant Fc domain comprises P238S and/or P331S, and/or one or more mutations in the three hinge cysteines (residues 220, 226, and 229), numbering according to the EU index.
  • a mutant Fc domain comprises P238S and/or P331S, and/or mutations in a hinge cysteine to SCC or in the three hinge cysteines to SSS. In some aspects, a mutant Fc domain comprises P238S and P331S and mutations in at least one of the three hinge cysteines. In some aspects, a mutant Fc domain comprises P238S and P331S and SCC. In some aspects, a mutant Fc domain comprises P238S and P331S and SSS. In some aspects, a mutant Fc domain includes P238S and SCC or SSS. In some aspects, a mutant Fc domain includes P331S and SCC or SSS. (All numbering according to the EU index).
  • a mutant Fc domain includes a mutation at a site of N-linked
  • a mutant Fc domain includes a mutation at a site of N- linked glycosylation, such as N297, e.g., a substitution of asparagine for another amino acid such as serine, e.g., N297S and a mutation in one or more of the three hinge cysteines.
  • a mutant Fc domain includes a mutation at a site of N-linked glycosylation, such as N297, e.g., a substitution of asparagine for another amino acid such as serine, e.g., N297S and mutations in one of the three hinge cysteines to SCC or all three cysteines to SSS.
  • a mutant Fc domain includes a mutation at a site of N-linked glycosylation, such as N297, e.g., a substitution of asparagine for another amino acid such as serine, e.g., N297 and one or more mutations in the CH2 domain which decrease FcyR binding and/or complement activation, such as mutations at P238 or P331 or both, e.g., P238S or P331S or both P238S and P331S.
  • such mutant Fc domains can further include a mutation in the hinge region, e.g., SCC or SSS. (All numbering according to the EU index.)
  • the mutant Fc domain is as shown in the Sequence Table or Sequence Listing herein.
  • heterodimers are formed by mutations in the CH3 domain of the Fc domain on the interferon receptor Fc constructs disclosed herein. Heavy chains were first engineered for heterodimerization using a "knobs-into-holes" strategy (Rigway B, et al., Protein Eng., 9 (1996) pp. 617-621), incorporated herein by reference.
  • knock-into-hole refers to the technology directing the pairing of two polypeptides together in vitro or in vivo by introducing a pertuberance (knob) into one polypeptide and a cavity (hole) into the other polypeptide at an interface in which they interact.
  • a combination of mutations in the CH3 domain can be used to form heterodimers, for example, S354C, T366W in the "knob” heavy chain, and Y349C, T366S, L368A, Y407V in the "hole” heavy chain.
  • T366Y in the "knob” heavy chain, and Y407T in the "hole” heavy chain can be used to form heterodimers, for example, S354C, T366W in the "knob” heavy chain, and Y349C, T366S, L368A, Y407V in the "hole” heavy chain.
  • the soluble interferon receptors disclosed herein includes a first CH3 domain having the knob mutation T366W and a second CH3 domain having the hole mutations T366S, L368A, and Y407V. (Numbering according to the EU index.) In some embodiments, the soluble interferon receptors disclosed herein includes a first CH3 domain having the knob mutation T366Y and a second CH3 domain having the hole mutation Y407T.
  • the CH3 mutations are those described in US 2012/0149876 Al, US 2017/0158779, US 9574010, and US 9562109, each of which is incorporated herein by reference in its entirety; and Von Kreudenstein, T.S. et al. mABs, 5 (2013), pp. 646-654, incorporated herein by reference, and include the following mutations: T350V, L351Y, F405A, and Y407V (first CH3 domain); and T350V, T366L, K392L, T394W (second CH3 domain).
  • the soluble interferon receptors disclosed herein include a first CH3 domain having T350V, L351Y, F405A, and Y407V mutations and a second CH3 domain having T350V, T366L, K392L, T394W mutations. (Numbering according to the EU index.)
  • heterodimers are formed by mutations in the CH3 domain of the Fc domain on the interferon receptor Fc constructs disclosed herein.
  • a combination of mutations in the CH3 domain can be used to form heterodimers with high heterodimeric stability and purity; for example, See e.g., Von Kreudenstein et al., mAbs 5:5, 646-654;
  • mutations in the Fc domain include one or more mutations selected from the following group of mutations: T350V, L351Y, F405A, and Y407V. In some embodiments, mutations in the Fc domain include one or more mutation selected from the following group of mutations: T350V, T366L, K392L, and T394W. In some embodiments, the interferon receptor Fc constructs disclosed herein include a CH3 domain having mutations T350V, L351Y, F405A, and Y407V.
  • the interferon receptor Fc constructs disclosed herein include a CH3 domain having mutations T350V, T366L, K392L, and T394W.
  • the soluble interferon receptors disclosed herein include a first polypeptide comprising a mutant Fc domain, wherein the CH3 domain includes mutations T350V, L351Y, F405A, and Y407V, and a second polypeptide comprising a mutant Fc domain, wherein the CH3 domain includes mutations T350V, T366L, K392L, and T394W.
  • mutations in the Fc domain of the first polypeptide include one or more mutations selected from, the following group of mutations: T350V, L351Y, F405A, and Y407V
  • mutations in the Fc domain of the second polypeptide include one or more mutations selected from the following group of mutations: T350V, T366L, K392M, and T394W.
  • mutations in the Fc domain of the first polypeptide include one or more mutations selected from the following group of mutations: L351Y, F405A, and Y407V
  • mutations in the Fc domain of the second polypeptide include one or more mutations selected from the following group of mutations: T366L, K392M, and T394W.
  • the CH3 mutations are those described by Moore, G.L. et al. (mABs, 3 (2011), pp. 546-557) and include the following mutations: S364H and F405A (first CH3 domain); and Y349T and T394F (second CH3 domain).
  • the interferon receptor Fc constructs disclosed herein include a first CH3 domain having S364H and F405A mutations and a second CH3 domain having Y349T and T394F mutations. (Numbering according to the EU index.)
  • the CH3 mutations are those described by Gunasekaran, . et al. (J. Biol. Chem., 285 (2010), pp. 19637-19646) and include the following mutations: K409D and K392D (first CH3 domain); and D399K and E365K (second CH3 domain).
  • K409D and K392D first CH3 domain
  • D399K and E365K second CH3 domain
  • the interferon receptor Fc constructs disclosed herein includes a first CH3 domain having K409D and K392D mutations and a second CH3 domain having D399K and E365K mutations. (Numbering according to the EU index.)
  • the interferon receptor Fc constructs of the disclosure may employ art-recognized Fc variants which are known to impart an alteration in effector function and/or FcR binding. For example, a change (e.g., a substitution) at one or more of the amino acid positions disclosed in International PCT Publications WO88/07089A1, W096/14339A1, WO98/05787A1,
  • the specific change (e.g., the specific substitution of one or more amino acids disclosed in the art) may be made at one or more of the disclosed amino acid positions.
  • a different change at one or more of the disclosed amino acid positions (e.g., the different substitution of one or more amino acid position disclosed in the art) may be made.
  • mutations at positions 238, 239, 248, 249, 252, 254, 255, 256, 258, 265, 267, 268, 269, 270, 272, 279, 280, 283, 285, 298, 289, 290, 292, 293, 294, 295, 296, 298, 301, 303, 305, 307, 312, 315, 322, 324, 327, 329, 330, 331, 333, 334, 335, 337, 338, 340, 356, 360, 373, 376, 378, 379, 382, 388, 389, 398, 414, 416, 419, 430, 434, 435, 437, 438 or 439 of the Fc region can alter binding as described in U.S.
  • Fc variants that exhibit reduced binding to Fc gamma receptors, reduced antibody dependent cell-mediated cytotoxicity, or reduced complement dependent cytotoxicity, that comprise at least one amino acid modification in the Fc region, including 232G, 234G, 234H, 235D, 235G, 235H, 2361, 236N, 236P, 236R, 237K, 237L, 237N, 237P, 238K, 239R, 265G, 267R, 269R, 270H, 297S, 299A, 2991, 299V, 325A, 325L, 327R, 328R, 329K, 3301, 330L, 330N, 330P, 330R, and 331L (numbering is according to the EU index), as
  • mutations contemplated for use as described in this publication include 227G, 234D, 234E, 234G, 2341, 234Y, 235D, 2351, 235S, 236S, 239D, 246H, 255Y, 258H, 260H, 2641, 267D, 267E, 268D, 268E, 272H, 2721, 272R, 28 ID, 282G, 283H, 284E, 293R, 295E, 304T, 324G, 3241, 327D, 327A, 328A, 328D, 328E, 328F, 3281, 328M, 328N, 328Q, 328T, 328V, 328Y, 3301, 330L, 330Y, 332D, 332E, 335D, an insertion of G between positions 235 and 236, an insertion of A between positions 235 and 236, an insertion of S between positions 235 and 236, an insertion of T between positions 235
  • mutations described in U.S. Pat. App. Pub. No. 2006/0235208 include 227G/332E, 234D/332E, 234E/332E, 234Y/332E, 234I/332E, 234G/332E, 235I 332E, 235S/332E, 235D/332E, 235E/332E, 236S/332E,
  • an alternative scaffold may be an alternative Fc format.
  • an alternative scaffold may be utilized to generate a heterodimeric construct.
  • the soluble interferon receptor includes an alternative Fc domain.
  • an alternative Fc domain is any of the suitable alternative Fc formats known in the art.
  • the Fc domain may comprises any of the alternative Fc formats discussed in Spiess et al. Molecular Immunology, 2015, Oct; 67 (2 Pt A)95- 106, the entire contents of which is incorporated herein by reference.
  • the alternative Fc format may be selected from any one of the following formats: (i) bispecific IgG (BsIgG), (ii) appended IgG, (iii) bispecific fragments, (iv) bispecific fusion proteins, (v) bispecific conjugates, (vi) and IgG4 Fab arm exchange, and (vii) alternative scaffolds.
  • the heterodimers of the disclosure can be formed by utilizing alternative Fc formats.
  • the Fc domain can be engineered to facilitate heterodimerization.
  • heterodimers are formed by mutations in the CH3 domain of the Fc domain of the soluble interferon receptors disclosed herein.
  • Bispecific IgG is an alternative Fc format that can be utilized to facilitate
  • the CH3 domain of an Fc can be mutated to facilitate heterodimerization.
  • "knobs-into-holes” can be used to facilitate heterodimerization of Fc domains.
  • a combination of mutations in the CH3 domain can be used to form heterodimers.
  • the "knobs” are created by replacing small amino acid side chains at the interface between CH3 domains with larger amino acid side chains, and "holes” are created by replacing large amino acid side chains at the interface between CH3 domains with small amino acid side chains.
  • the soluble interferon receptors of the disclosure include a first interferon receptor Fc construct comprising a first CH3 domain having the knob mutation T366W and a second interferon receptor Fc construct comprising a second CH3 domain having the hole mutations T366S, L368A, and Y407V.
  • the soluble interferon receptors of the disclosure include a first interferon receptor Fc construct comprising a first CH3 domain having the knob mutation T366Y and a second interferon receptor Fc construct comprising a second CH3 domain having the hole mutation Y407V (Ridgeway et al., (1996) Prot. Eng. 9, 617-621).
  • the "hole” mutations provide efficient pairing with the "knob” mutation to promote heterodimerization of the Fc domains.
  • a "duobody” can also be used to facilitate heterodimerization of Fc domains (Labrijn et al., (2013) Proc. Natl. Acad. Sci. U.S.A. 110, 5145-5150, the entire contents of which is herein incorporated by reference).
  • the Fc domain of a first interferon receptor Fc construct may include a F405L mutation and the Fc domain of a second interferon receptor Fc construct may include a K409R mutation.
  • "azymetric mutations” can be introduced into interferon receptor Fc constructs to promote the formation of heterodimers.
  • the azymetric mutations include T350V, L351Y, F405A, and Y407V in the Fc domain of a first interferon receptor Fc construct, and T350V, T366L, K392L, and T394W in the Fc domain of a second interferon receptor Fc construct.
  • charge pair mutations which were identified by rational design of electrostatic steering mutations, can also be introduced into interferon receptor Fc constructs to promote heterodimerization (Gunasekaran et al., (2010) J. Biol. Chem. 285, 19637-19646, and Strop et al., (2012) J. Mol. Biol. 420, 204-219, both of which are incorporated herein by reference).
  • the "charge pair” mutations create altered charge polarity across the Fc dimer interface such that co-expression of electrostatically matched Fc chains support favorable attractive interactions thereby promoting Fc heterodimer formation.
  • the Fc domain of a first interferon receptor Fc construct may include K409D and K392D
  • the Fc domain of a second interferon receptor Fc construct may include D399K and E356K.
  • the Fc domain of a first interferon receptor Fc construct may include D221E, P228E, L368E
  • the Fc domain of a second interferon receptor Fc construct may include D221R, P228R, and K409R.
  • the Fc domain of a first interferon receptor Fc construct includes S364H and F405A
  • the Fc domain of a second interferon receptor Fc construct includes Y349T and T394F.
  • heterodimeric soluble interferon receptors can also be promoted by exploiting the structural similarity and sequence divergence between immunoglobulins from different classes.
  • the SEED platform uses the sequence divergence but structural similarity of the CH3 domains of IgG and IgA (Davis et al., (2010) Protein Eng. Des. Sel. 23, 195-202, the entire contents of which is herein incorporated by reference).
  • the Fc domain of a first interferon receptor Fc construct includes and IgG/A chimera and the Fc domain of a second interferon receptor Fc construct includes and IgA/G chimera.
  • the inability of IgG3 to bind protein A can be used for differential tagging of the Fc domain to enable efficient purification of heterodimers (Davis et al., 2013, U.S. Patent No. 8,586,713, the entire contents of which are herein incorporated by reference).
  • the Fc domain of a interferon receptor Fc construct includes an H354R mutation.
  • CH3 domain mutations can be introduced into IgGl, IgG2, and IgG4 constant regions to promote heterodimerization.
  • the Fc domain of a first interferon receptor Fc construct may include a 407A substitution
  • the Fc domain of a second interferon receptor Fc construct may include a 366V or 366M substitution and a 409V substitution.
  • the Fc domain of a first interferon receptor Fc construct may include a 407A substitution as well as one or more substitutions selected from the following group of substitutions: 356G, 357D, 360D, 364Q, 364R, and 399M.
  • the Fc domain of a second interferon receptor Fc construct may include a 366V or 366M substitution and a 409V substitution as well as one or more substitutions selected from the following group of substitutions: 345R, 347R, 349S, 366V, 370Y, and 399M.
  • the Fc domain of a second interferon receptor Fc construct may include a 366V and a 409V substitution as well as one or more substitutions selected from the following group of substitutions: 345R, 347R, 349S, 366V, 370Y, and 399M.
  • the Fc domain of a second interferon receptor Fc construct may include a 366M and a 409V substitution as well as one or more substitutions selected from the following group of substitutions: 345R, 347R, 349S, 366V, 370Y, and 399M. (see US2018/0009908 and Lewis et al., nature Biotechnology (2014) 32(2), 191-198, both of which are incorporated by reference in their entirety).
  • an Fc domain can be engineered to include two different binding domains by appending either the amino and/or carboxyl termini of the Fc domain with one or more binding domains.
  • the one or more binding domains may be appended to the Fc domain via a peptide linker.
  • the binding domain is an IFNAR (e.g., IFNAR1 or IFNAR2), or variant or fragment thereof. In some embodiments, the binding domain is the extracellular domain of IFNAR 1 or IFNAR2.
  • the soluble interferon receptor can lack some or all of the Fc domain.
  • binding domains and partial Fc domains of a soluble interferon receptor that lacks some or all of the Fc domain may be connected via a peptide linker.
  • a soluble interferon receptor can be generated using polypeptide linkers to connect each of the domains of the soluble interferon receptor (e.g., binding domains, Fc domains) and thereby generate a single polypeptide chain.
  • the binding domain is an IFNAR (e.g., IFNAR1 or IFNAR2), or variant or fragment thereof. In some embodiments, the binding domain is the extracellular domain of IFNAR 1 or IFNAR2.
  • the binding domains of the soluble interferon receptor are linked to other proteins to add additional functionality of specificity.
  • the binding domain is an IFNAR (e.g., IFNAR1 or IFNAR2), or variant or fragment thereof.
  • the binding domain is the extracellular domain of IFNAR 1 or IFNAR2.
  • the binding domains of the soluble interferon receptor are chemically conjugated to each other and/or to an Fc domain.
  • the binding domain is an IFNAR (e.g., IFNAR1 or IFNAR2), or variant or fragment thereof.
  • the binding domain is the extracellular domain of IFNAR 1 or IFNAR2.
  • Fab arm exchange can be used to facilitate the heterodimerization of Fc domains.
  • Fab arm exchange is a post translational modification of IgG4 antibodies that involves the third constant domain of IgG4 in addition to the hinge region of IgG4 and requires a reducing environment to be activated, (van der Neut Kolfschoten et al. (2007) Science 317, 1554-1557, the entire contents of which is incorporated herein by reference).
  • IgG4 antibodies exchange Fab arms by swapping a heavy chain and attached light chain with a heavy chain pair from another molecule, which results in bispecific antibodies, (van der Neut Kolfschoten et al. (2007)).
  • heterodimerization of the soluble interferon receptors of the disclosure can be promoted by replacing the CH3 domain in an IgGl Fc with the CH3 domain from an IgG4 Fc as well as replacing the IgGl core hinge sequence with the IgG4 sequence ⁇ i.e., by replacing Pro228 with Ser (P228S)).
  • engineered proteins scaffolds e.g., Affibody, DARPin,
  • Adnectins may be used to generate a molecule with at least two IFNAR binding domains.
  • the binding domain is the extracellular domain of IFNAR1 or IFNAR2.
  • the soluble interferon receptor is operably coupled to a PK moiety, which serves as a scaffold as well as a means to increase the serum half-life of the soluble interferon receptor.
  • PK moieties are well-known in the art and include, but are not limited to, albumin, transferrin, Fc, and their variants, and polyethylene glycol (PEG) and its derivatives.
  • Suitable PK moieties include, but are not limited to, HSA, or variants or fragments thereof, such as those disclosed in US 5,876,969, WO 2011/124718, and WO 2011/0514789; Fc and Fc variants, such as those disclosed in WO2011/053982, WO 02/060955, WO 02/096948,
  • the PK moiety is HSA, which is naturally aglycosylated.
  • the PK moiety is a wild type Fc (SEQ ID NO: 26).
  • an Fc domain is altered or modified, e.g., by amino acid mutation (e.g., addition, deletion, or substitution).
  • the term "Fc domain variant" refers to an Fc domain having at least one amino acid modification, such as an amino acid substitution, as compared to the wild-type Fc from which the Fc domain is derived.
  • a variant comprises at least one amino acid mutation (e.g., substitution) as compared to a wild type amino acid at the corresponding position of the human IgGl Fc region.
  • the PK moiety is any of the Fc variants described herein.
  • the PK moiety is a wild type HST. In other embodiments, the PK moiety is a HST with a mutations at N413 and/or N611 and/or S 12 (S 12 is a potential O-linked glycosylation site), yielding a HST with altered glycosylation (i.e., HST N413S, HST N611S, HST N413S/N611S and HST S 12A/N413S/N611S).
  • S 12 is a potential O-linked glycosylation site
  • the soluble interferon receptors of the disclosure can be configured to incorporate various interferon receptor Fc constructs.
  • the interferon receptor Fc constructs of the invention can be configured to incorporate various domains.
  • the interferon receptor Fc construct may include the IFNAR1 domain set forth in (SEQ ID NO: 11).
  • the interferon receptor Fc construct may include the IFNAR2 domain set forth in (SEQ ID NO: 12).
  • the interferon receptor Fc construct may include a linker domain.
  • the IFNAR1 domain is operatively coupled with a linker domain (e.g., a polypeptide linker) to a mutant Fc domain.
  • the IFNAR2 domain is operatively coupled with a linker domain (e.g., a polypeptide linker) to a mutant Fc domain.
  • the linker domain is a polypeptide linker (e.g., a Gly/Ser linker, e.g., (G 4 S) n , wherein n is 1-10, 2-5, 1, 2, 3, 4, or 5).
  • the polypeptide linker is about 1- 50, about 5-40, about 10-30, or about 15-20 amino acids in length.
  • the polypeptide linker is about 20 amino acids or less, about 15 amino acids or less, about 10 amino acids or less, or about 5 amino acids or less in length.
  • the polypeptide linker is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 amino acids in length.
  • the interferon receptor Fc construct may include the (Gly 4 Ser) 4 linker domain set forth in SEQ ID NO: 15. In another embodiment, the interferon receptor Fc construct may include the (Gly 4 Ser) 2 linker domain set forth in SEQ ID NO: 38. In another embodiment, the interferon receptor Fc construct does not include a linker domain.
  • the interferon receptor Fc construct may include a leader sequence set forth in SEQ ID NO: 13.
  • the interferon receptor Fc construct may include an IgGl Fc domain comprising mutations C220S, P238S, P331S, and T350V, T366L, K392L, and T394W as set forth in (SEQ ID NO: 10). In some embodiments, the interferon receptor Fc construct may include an IgGl Fc domain comprising mutations C220S, P238S, P331S, and T350V, L351Y, F405A, and Y407V as set forth in (SEQ ID NO: 9).
  • the interferon Fc receptor construct may include an IgGl Fc domain comprising the mutation T366Y as set forth in SEQ ID NO: 106, and optionally, one or more mutations selected from C220S, P238S, and P331S. In some embodiments, the interferon Fc receptor construct may include an IgGl Fc domain comprising the mutation Y407T as set forth in SEQ ID NO: 107, and optionally, one or more mutations selected from C220S, P238S, and P331S.
  • the interferon Fc receptor construct may include an IgGl Fc domain comprising the mutation T366W as set forth in SEQ ID NO: 108, and optionally, one or more mutations selected from C220S, P238S, and P331S.
  • the interferon Fc construct may include an IgGl Fc domain comprising mutations T366S, L368A, and Y407V as set forth in SEQ ID NO: 109, and optionally, one or more mutations selected from C220S, P238S, and P331S.
  • the interferon Fc receptor construct comprises a mutant IgG4 Fc domain comprising mutation S228P, F296Y, E356K, R409K, H435R and L445P according to EU numbering.
  • the heterodimer comprises a mutant IgG4 Fc domain comprising mutations T366S, L368A and Y407V, according to EU numbering.
  • the interferon Fc construct comprises the IgG4 Fc domain comprising mutations S228P, F234A, L235A, L445P (EU) and K478del (Kabat) as set forth in SEQ ID NO: 113.
  • the interferon Fc construct comprises the IgG4 Fc domain with mutations F296Y, E356K, R409K, and H435R (EU) as set forth in SEQ ID NO: 116.
  • the interferon Fc construct comprises the IgG4 Fc domain with mutations F296Y, R409K, and K439E (EU) as set forth in SEQ ID NO: 117.
  • the interferon Fc construct comprises the IgG4 Fc domain with mutations S228P, F296Y, E356K, R409K, H435R, L445P, G446del (EU) and K478del(Kabat) as set forth in SEQ ID NO: 118.
  • the interferon Fc construct comprises the IgG4 Fc domain with mutations S228P, F296Y, R409K, K439E, L445P, G446del (EU)and K478del(Kabat) as set forth in SEQ ID NO: 119.
  • an IFNAR1 extracellular domain can be operatively coupled to an Fc domain via a (Gly 4 Ser) 4 linker domain.
  • an IFNAR2 extracellular domain can be operatively coupled to an Fc domain via a (Gly 4 Ser) 4 linker domain.
  • an IFNAR1 extracellular domain can be operatively coupled to an Fc domain via a (Gly 4 Ser) 2 linker domain.
  • an IFNAR2 extracellular domain can be operatively coupled to an Fc domain via a (Gly 4 Ser) 2 linker domain.
  • an IFNAR1 extracellular domain can be operably coupled to an Fc domain.
  • an IFNAR2 extracellular domain can be operably coupled to an Fc domain.
  • Various other configurations are possible, with non-limiting exemplary configurations disclosed herein, in Figure 1 and in the Sequence Table.
  • the interferon receptor Fc construct comprises an IFNAR1 extracellular domain operably coupled to an IgGl Fc domain comprising mutations C220S, P238S, P331S, and T350V, T366L, K392L, and T394W via a linker domain, such as a
  • the interferon receptor Fc construct comprises an IFNAR1 extracellular domain operably coupled to an IgGl Fc domain comprising mutations C220S, P238S, P331S, and T350V, T366L, K392L, and T394W via a linker domain, such as a
  • the interferon receptor Fc construct comprises an IFNAR1 extracellular domain operably coupled to an IgGl Fc domain comprising mutations C220S, P238S, P331S, and T350V, T366L, K392L, and T394W without a linker domain, with or without a leader sequence.
  • the interferon receptor Fc construct comprises an IFNAR2 extracellular domain operably coupled to an IgGl Fc domain comprising mutations C220S, P238S, P331S, and T350V, T366L, K392L, and T394W via a linker domain, such as a
  • the interferon receptor Fc construct comprises an IFNAR2 extracellular domain operably coupled to an IgGl Fc domain comprising mutations C220S, P238S, P331S, and T350V, T366L, K392L, and T394W via a linker domain, such as a
  • the interferon receptor Fc construct comprises an IFNAR2 extracellular domain operably coupled to an IgGl Fc domain comprising mutations C220S, P238S, P331S, and T350V, T366L, K392L, and T394W without a linker domain, with or without a leader sequence.
  • the interferon receptor Fc construct comprises an IFNAR1 extracellular domain operably coupled to an IgGl Fc domain comprising mutations C220S, P238S, P331S, and T350V, L351Y, F405A, and Y407V via a linker domain, such as a (Gly 4 Ser) 4 linker domain, with or without a leader sequence.
  • a linker domain such as a (Gly 4 Ser) 4 linker domain
  • the interferon receptor Fc construct comprises an IFNAR1 extracellular domain operably coupled to an IgGl Fc domain comprising mutations C220S, P238S, P331S, and T350V, L351Y, F405A, and Y407V via a linker domain, such as a
  • the interferon receptor Fc construct comprises an IFNAR1 extracellular domain operably coupled to an IgGl Fc domain comprising mutations C220S, P238S, P331S, and T350V, L351Y, F405A, and Y407V without a linker domain, with or without a leader sequence.
  • the interferon receptor Fc construct comprises an IFNAR2 extracellular domain operably coupled to an IgGl Fc domain comprising mutations C220S, P238S, P331S, and T350V, L351Y, F405A, and Y407V via a linker domain, such as a
  • the interferon receptor Fc construct comprises an IFNAR2 extracellular domain operably coupled to an IgGl Fc domain comprising mutations C220S, P238S, P331S, and T350V, L351Y, F405A, and Y407V via a linker domain, such as a
  • the interferon receptor Fc construct comprises an IFNAR2 extracellular domain operably coupled to an IgGl Fc domain comprising mutations C220S, P238S, P331S, and T350V, L351Y, F405A, and Y407V without a linker domain, with or without a leader sequence.
  • the interferon receptor Fc construct comprises an IFNAR1 extracellular domain operably coupled to an IgGl Fc domain comprising mutation T366Y via a linker domain, such as a (Gly 4 Ser) 4 linker domain, with or without a leader sequence, and optionally, one or more mutations selected from C220S, P238S, and P331S.
  • a linker domain such as a (Gly 4 Ser) 4 linker domain
  • a leader sequence optionally, one or more mutations selected from C220S, P238S, and P331S.
  • the interferon receptor Fc construct comprises an IFNAR1 extracellular domain operably coupled to an IgGl Fc domain comprising mutation T366Y via a linker domain, such as a (Gly 4 Ser) 2 linker domain, with or without a leader sequence, and optionally, one or more mutations selected from C220S, P238S, and P331S.
  • the interferon receptor Fc construct comprises an IFNAR1 extracellular domain operably coupled to an IgGl Fc domain comprising mutation T366Y without a linker domain, with or without a leader sequence, and optionally, one or more mutations selected from C220S, P238S, and P331S.
  • the interferon receptor Fc construct comprises an IFNAR2 extracellular domain operably coupled to an IgGl Fc domain comprising mutation T366Y via a linker domain, such as a (Gly 4 Ser) 4 linker domain, with or without a leader sequence, and optionally, one or more mutations selected from C220S, P238S, and P331S.
  • a linker domain such as a (Gly 4 Ser) 4 linker domain
  • a leader sequence optionally, one or more mutations selected from C220S, P238S, and P331S.
  • the interferon receptor Fc construct comprises an IFNAR2 extracellular domain operably coupled to an IgGl Fc domain comprising mutation T366Y via a linker domain, such as a (Gly 4 Ser) 2 linker domain, with or without a leader sequence, and optionally, one or more mutations selected from C220S, P238S, and P331S.
  • a linker domain such as a (Gly 4 Ser) 2 linker domain
  • a leader sequence optionally, one or more mutations selected from C220S, P238S, and P331S.
  • the interferon receptor Fc construct comprises an IFNAR2 extracellular domain operably coupled to an IgGl Fc domain comprising mutation T366Y without a linker domain, with or without a leader sequence, and optionally, one or more mutations selected from C220S, P238S, and P331S.
  • the interferon receptor Fc construct comprises an IFNAR1 extracellular domain operably coupled to an IgGl Fc domain comprising mutation Y407T via a linker domain, such as a (Gly 4 Ser) 4 linker domain, with or without a leader sequence, and optionally, one or more mutations selected from C220S, P238S, and P331S.
  • a linker domain such as a (Gly 4 Ser) 4 linker domain
  • the interferon receptor Fc construct comprises an IFNAR1 extracellular domain operably coupled to an IgGl Fc domain comprising mutation Y407T via a linker domain, such as a (Gly 4 Ser) 2 linker domain, with or without a leader sequence, and optionally, one or more mutations selected from C220S, P238S, and P331S.
  • a linker domain such as a (Gly 4 Ser) 2 linker domain
  • the interferon receptor Fc construct comprises an IFNAR1 extracellular domain operably coupled to an IgGl Fc domain comprising mutation Y407T without a linker domain, with or without a leader sequence, and optionally, one or more mutations selected from C220S, P238S, and P331S.
  • the interferon receptor Fc construct comprises an IFNAR2 extracellular domain operably coupled to an IgGl Fc domain comprising mutation Y407T via a linker domain, such as a (Gly 4 Ser) 4 linker domain, with or without a leader sequence, and optionally, one or more mutations selected from C220S, P238S, and P331S.
  • a linker domain such as a (Gly 4 Ser) 4 linker domain
  • the interferon receptor Fc construct comprises an IFNAR2 extracellular domain operably coupled to an IgGl Fc domain comprising mutation Y407T via a linker domain, such as a (Gly 4 Ser) 2 linker domain, with or without a leader sequence, and optionally, one or more mutations selected from C220S, P238S, and P331S.
  • a linker domain such as a (Gly 4 Ser) 2 linker domain
  • a leader sequence optionally, one or more mutations selected from C220S, P238S, and P331S.
  • the interferon receptor Fc construct comprises an IFNAR2 extracellular domain operably coupled to an IgGl Fc domain comprising mutation Y407T without a linker domain, with or without a leader sequence, and optionally, one or more mutations selected from C220S, P238S, and P331S.
  • the interferon receptor Fc construct comprises an IFNAR1 extracellular domain operably coupled to an IgGl Fc domain comprising mutation T366W via a linker domain, such as a (Gly 4 Ser) 4 linker domain, with or without a leader sequence, and optionally, one or more mutations selected from C220S, P238S, and P331S.
  • a linker domain such as a (Gly 4 Ser) 4 linker domain
  • a leader sequence optionally, one or more mutations selected from C220S, P238S, and P331S.
  • the interferon receptor Fc construct comprises an IFNAR1 extracellular domain operably coupled to an IgGl Fc domain comprising mutation T366W via a linker domain, such as a (Gly 4 Ser) 2 linker domain, with or without a leader sequence, and optionally, one or more mutations selected from C220S, P238S, and P331S.
  • a linker domain such as a (Gly 4 Ser) 2 linker domain
  • a leader sequence optionally, one or more mutations selected from C220S, P238S, and P331S.
  • the interferon receptor Fc construct comprises an IFNAR1 extracellular domain operably coupled to an IgGl Fc domain comprising mutation T366W without a linker domain, with or without a leader sequence, and optionally, one or more mutations selected from C220S, P238S, and P331S.
  • the interferon receptor Fc construct comprises an IFNAR2 extracellular domain operably coupled to an IgGl Fc domain comprising mutation T366W via a linker domain, such as a (Gly 4 Ser) 4 linker domain, with or without a leader sequence, and optionally, one or more mutations selected from C220S, P238S, and P331S.
  • a linker domain such as a (Gly 4 Ser) 4 linker domain
  • a leader sequence optionally, one or more mutations selected from C220S, P238S, and P331S.
  • the interferon receptor Fc construct comprises an IFNAR2 extracellular domain operably coupled to an IgGl Fc domain comprising mutation T366W via a linker domain, such as a (Gly 4 Ser) 2 linker domain, with or without a leader sequence, and optionally, one or more mutations selected from C220S, P238S, and P331S.
  • the interferon receptor Fc construct comprises an IFNAR2 extracellular domain operably coupled to an IgGl Fc domain comprising mutation T366W without a linker domain, with or without a leader sequence, and optionally, one or more mutations selected from C220S, P238S, and P331S.
  • the interferon receptor Fc construct comprises an IFNAR1 extracellular domain operably coupled to an IgGl Fc domain comprising mutations T366S, L368A, and Y407V via a linker domain, such as a (Gly 4 Ser) 4 linker domain, with or without a leader sequence, and optionally, one or more mutations selected from C220S, P238S, and P331S.
  • a linker domain such as a (Gly 4 Ser) 4 linker domain, with or without a leader sequence, and optionally, one or more mutations selected from C220S, P238S, and P331S.
  • the interferon receptor Fc construct comprises an IFNAR1 extracellular domain operably coupled to an IgGl Fc domain comprising mutations T366S, L368A, and Y407V via a linker domain, such as a (Gly 4 Ser) 2 linker domain, with or without a leader sequence, and optionally, one or more mutations selected from C220S, P238S, and P331S.
  • a linker domain such as a (Gly 4 Ser) 2 linker domain, with or without a leader sequence, and optionally, one or more mutations selected from C220S, P238S, and P331S.
  • the interferon receptor Fc construct comprises an IFNAR1 extracellular domain operably coupled to an IgGl Fc domain comprising mutations T366S, L368A, and Y407V without a linker domain, with or without a leader sequence, and optionally, one or more mutations selected from C220S, P238S, and P331S.
  • the interferon receptor Fc construct comprises an IFNAR2 extracellular domain operably coupled to an IgGl Fc domain comprising mutations T366S, L368A, and Y407V via a linker domain, such as a (Gly 4 Ser) 4 linker domain, with or without a leader sequence, and optionally, one or more mutations selected from C220S, P238S, and P331S.
  • a linker domain such as a (Gly 4 Ser) 4 linker domain, with or without a leader sequence, and optionally, one or more mutations selected from C220S, P238S, and P331S.
  • the interferon receptor Fc construct comprises an IFNAR2 extracellular domain operably coupled to an IgGl Fc domain comprising mutations T366S, L368A, and Y407V via a linker domain, such as a (Gly 4 Ser) 2 linker domain, with or without a leader sequence, and optionally, one or more mutations selected from C220S, P238S, and P331S.
  • a linker domain such as a (Gly 4 Ser) 2 linker domain, with or without a leader sequence, and optionally, one or more mutations selected from C220S, P238S, and P331S.
  • the interferon receptor Fc construct comprises an IFNAR2 extracellular domain operably coupled to an IgGl Fc domain comprising mutations T366S, L368A, and Y407V without a linker domain, with or without a leader sequence, and optionally, one or more mutations selected from C220S, P238S, and P331S.
  • the interferon receptor Fc construct comprises a IFNAR1 operably coupled to an IgG4 Fc domain comprising mutations F296Y, E356K, R409K, and H435R via a linker domain, such as a (Gly 4 Ser) 4 linker domain, with or without a leader sequence.
  • a linker domain such as a (Gly 4 Ser) 4 linker domain
  • the interferon receptor Fc construct comprises a IFNAR1 operably coupled to an IgG4 Fc domain comprising mutations F296Y, E356K, R409K, and H435R via a linker domain, such as a (Gly 4 Ser) 2 linker domain, with or without a leader sequence.
  • a linker domain such as a (Gly 4 Ser) 2 linker domain
  • the interferon receptor Fc construct comprises a IFNAR1 operably coupled to an IgG4 Fc domain comprising mutations F296Y, E356K, R409K, and H435R without a linker domain, with or without a leader sequence.
  • the interferon receptor Fc construct comprises a IFNAR2 operably coupled to an IgG4 Fc domain comprising mutations F296Y, E356K, R409K, and H435R via a linker domain, such as a (Gly 4 Ser) 4 linker domain, with or without a leader sequence.
  • a linker domain such as a (Gly 4 Ser) 4 linker domain
  • the interferon receptor Fc construct comprises a IFNAR2 operably coupled to an IgG4 Fc domain comprising mutations F296Y, E356K, R409K, and H435R via a linker domain, such as a (Gly 4 Ser) 2 linker domain, with or without a leader sequence.
  • a linker domain such as a (Gly 4 Ser) 2 linker domain
  • the interferon receptor Fc construct comprises a IFNAR2 operably coupled to an IgG4 Fc domain comprising mutations F296Y, E356K, R409K, and H435R without a linker domain, with or without a leader sequence.
  • the interferon receptor Fc construct comprises a IFNAR1 operably coupled to an IgG4 Fc domain comprising mutations F296Y, R409K, and K439E via a linker domain, such as a (Gly 4 Ser) 4 linker domain, with or without a leader sequence.
  • a linker domain such as a (Gly 4 Ser) 4 linker domain
  • the interferon receptor Fc construct comprises a IFNAR1 operably coupled to an IgG4 Fc domain comprising mutations F296Y, R409K, and K439E via a linker domain, such as a (Gly 4 Ser) 2 linker domain, with or without a leader sequence.
  • a linker domain such as a (Gly 4 Ser) 2 linker domain
  • the interferon receptor Fc construct comprises a IFNAR1 operably coupled to an IgG4 Fc domain comprising mutations F296Y, R409K, and K439E without a linker domain, with or without a leader sequence.
  • the interferon receptor Fc construct comprises a IFNAR2 operably coupled to an IgG4 Fc domain comprising mutations F296Y, R409K, and K439E via a linker domain, such as a (Gly 4 Ser) 4 linker domain, with or without a leader sequence.
  • the interferon receptor Fc construct comprises a IFNAR2 operably coupled to an IgG4 Fc domain comprising mutations F296Y, R409K, and K439E via a linker domain, such as a (Gly 4 Ser) 2 linker domain, with or without a leader sequence.
  • a linker domain such as a (Gly 4 Ser) 2 linker domain
  • the interferon receptor Fc construct comprises a IFNAR2 operably coupled to an IgG4 Fc domain comprising mutations F296Y, R409K, and K439E without a linker domain, with or without a leader sequence.
  • the interferon receptor Fc construct comprises the amino acid sequence set forth as SEQ ID NO: 1, with or without a leader sequence, and nucleic acids encoding the amino acid sequence set forth as SEQ ID NO: l.
  • the interferon receptor Fc construct comprises the amino acid sequence set forth as SEQ ID NO: 2, with or without a leader sequence, and nucleic acids encoding the amino acid sequence set forth as SEQ ID NO:2.
  • the interferon receptor Fc construct comprises the amino acid sequence set forth as SEQ ID NO: 3, with or without a leader sequence, and nucleic acids encoding the amino acid sequence set forth as SEQ ID NO:3.
  • the interferon receptor Fc construct comprises the amino acid sequence set forth as SEQ ID NO: 4, with or without a leader sequence, and nucleic acids encoding the amino acid sequence set forth as SEQ ID NO:4.
  • the interferon receptor Fc construct comprises the amino acid sequence set forth as SEQ ID NO: 52, with or without a leader sequence, and nucleic acids encoding the amino acid sequence set forth as SEQ ID NO: 52.
  • the interferon receptor Fc construct comprises the amino acid sequence set forth as SEQ ID NO: 54, with or without a leader sequence, and nucleic acids encoding the amino acid sequence set forth as SEQ ID NO: 54.
  • the interferon receptor Fc construct comprises the amino acid sequence set forth as SEQ ID NO: 56, with or without a leader sequence, and nucleic acids encoding the amino acid sequence set forth as SEQ ID NO: 56. In some embodiments, the interferon receptor Fc construct comprises the amino acid sequence set forth as SEQ ID NO: 58, with or without a leader sequence, and nucleic acids encoding the amino acid sequence set forth as SEQ ID NO: 58.
  • the interferon receptor Fc constructs dimerize to form a soluble interferon receptor, such as a heterodimeric soluble interferon receptor.
  • the soluble interferon receptor comprises a heterodimer comprising an interferon receptor Fc construct comprising an IFNAR1 extracellular domain operably coupled to an IgGl Fc domain comprising mutations C220S, P238S, P331S, and T350V, T366L, K392L, and T394W via a linker domain, such as a (Gly 4 Ser) 4 linker domain, with or without a leader sequence, and an interferon receptor Fc construct comprising an IFNAR2 extracellular domain operably coupled to an IgGl Fc domain comprising mutations C220S, P238S, P331S, and T350V, L351Y, F405A, and Y407V via a linker domain, such as a (Gly 4 Ser) 4
  • the soluble interferon receptor comprises a heterodimer comprising an interferon receptor Fc construct comprising an IFNAR2 extracellular domain operably coupled to an IgGl Fc domain comprising mutations C220S, P238S, P331S, and T350V, T366L, K392L, and T394W via a linker domain, such as a (Gly 4 Ser) 4 linker domain, with or without a leader sequence, and an interferon receptor Fc construct comprising an IFNAR1 extracellular domain operably coupled to an IgGl Fc domain comprising mutations C220S, P238S, P331S, and T350V, L351Y, F405A, and Y407V via a linker domain, such as a (Gly 4 Ser) 4 linker domain, with or without a leader sequence.
  • a linker domain such as a (Gly 4 Ser) 4 linker domain
  • the soluble interferon receptor comprises a heterodimer comprising an interferon receptor Fc construct comprising an IFNAR1 extracellular domain operably coupled to an IgGl Fc domain comprising mutations C220S, P238S, P331S, and T350V, T366L, K392L, and T394W via a linker domain, such as a (Gly 4 Ser) 2 linker domain, with or without a leader sequence, and an interferon receptor Fc construct comprising an IgGl Fc domain comprising mutations C220S, P238S, P331S, and T350V, T366L, K392L, and T394W via a linker domain, such as a (Gly 4 Ser) 2 linker domain, with or without a leader sequence, and an interferon receptor Fc construct comprising an IgGl Fc domain comprising mutations C220S, P238S, P331S, and T350V, T366L, K392
  • IFNAR2 extracellular domain operably coupled to an IgGl Fc domain comprising mutations C220S, P238S, P331S, and T350V, L351Y, F405A, and Y407V via a linker domain, such as a (Gly 4 Ser) 2 linker domain, with or without a leader sequence.
  • a linker domain such as a (Gly 4 Ser) 2 linker domain, with or without a leader sequence.
  • the soluble interferon receptor comprises a heterodimer comprising an interferon receptor Fc construct comprising an IFNAR2 extracellular domain operably coupled to an IgGl Fc domain comprising mutations C220S, P238S, P331S, and T350V, T366L, K392L, and T394W via a linker domain, such as a (Gly 4 Ser) 2 linker domain, with or without a leader sequence, and an interferon receptor Fc construct comprising an IFNAR1 extracellular domain operably coupled to an IgGl Fc domain comprising mutations C220S, P238S, P331S, and T350V, L351Y, F405A, and Y407V via a linker domain, such as a (Gly 4 Ser) 2 linker domain, with or without a leader sequence.
  • a linker domain such as a (Gly 4 Ser) 2 linker domain
  • the soluble interferon receptor comprises a heterodimer comprising an interferon receptor Fc construct comprising an IFNAR1 extracellular domain operably coupled to an IgGl Fc domain comprising mutations C220S, P238S, P331S, and T350V, T366L, K392L, and T394W without a linker domain, with or without a leader sequence, and an interferon receptor Fc construct comprising an IFNAR2 extracellular domain operably coupled to an IgGl Fc domain comprising mutations C220S, P238S, P331S, and T350V, L351Y, F405A, and Y407V without a linker domain, with or without a leader sequence.
  • the soluble interferon receptor comprises a heterodimer comprising an interferon receptor Fc construct comprising an IFNAR2 extracellular domain operably coupled to an IgGl Fc domain comprising mutations C220S, P238S, P331S, and T350V, T366L, K392L, and T394W without a linker domain, with or without a leader sequence, and an interferon receptor Fc construct comprising an IFNAR1 extracellular domain operably coupled to an IgGl Fc domain comprising mutations C220S, P238S, P331S, and T350V, L351Y, F405A, and Y407V without a linker domain, with or without a leader sequence.
  • an interferon receptor Fc construct comprising an IFNAR2 extracellular domain operably coupled to an IgGl Fc domain comprising mutations C220S, P238S, P331S, and T350V, L351Y, F405A, and
  • the soluble interferon receptor comprises a heterodimer comprising an interferon receptor Fc construct comprising an IFNAR1 extracellular domain operably coupled to an IgGl Fc domain comprising mutation T366Y via a linker domain, such as a (Gly 4 Ser) 4 linker domain, with or without a leader sequence, and an interferon receptor Fc construct comprising an IFNAR2 extracellular domain operably coupled to an IgGl Fc domain comprising mutation Y407T via a linker domain, such as a (Gly 4 Ser) 4 linker domain, with or without a leader sequence.
  • a linker domain such as a (Gly 4 Ser) 4 linker domain
  • the soluble interferon receptor comprises a heterodimer comprising an interferon receptor Fc construct comprising an IFNAR1 extracellular domain operably coupled to an IgGl Fc domain comprising mutation Y407T via a linker domain, such as a (Gly 4 Ser) 4 linker domain, with or without a leader sequence, and an interferon receptor Fc construct comprising an IFNAR2 extracellular domain operably coupled to an IgGl Fc domain comprising mutation T366Y via a linker domain, such as a (Gly 4 Ser) 4 linker domain, with or without a leader sequence.
  • a linker domain such as a (Gly 4 Ser) 4 linker domain
  • the soluble interferon receptor comprises a heterodimer comprising an interferon receptor Fc construct comprising an IFNAR1 extracellular domain operably coupled to an IgGl Fc domain comprising mutation T366Y via a linker domain, such as a (Gly 4 Ser) 2 linker domain, with or without a leader sequence, and an interferon receptor Fc construct comprising an IFNAR2 extracellular domain operably coupled to an IgGl Fc domain comprising mutation Y407T via a linker domain, such as a (Gly 4 Ser) 2 linker domain, with or without a leader sequence.
  • a linker domain such as a (Gly 4 Ser) 2 linker domain
  • the soluble interferon receptor Fc construct comprises a heterodimer comprising an interferon receptor Fc construct comprising an IFNAR1 extracellular domain operably coupled to an IgGl Fc domain comprising mutation Y407T via a linker domain, such as a (Gly 4 Ser) 2 linker domain, with or without a leader sequence, and an interferon receptor Fc construct comprising an IFNAR2 extracellular domain operably coupled to an IgGl Fc domain comprising mutation T366Y via a linker domain, such as a (Gly 4 Ser) 2 linker domain, with or without a leader sequence.
  • a linker domain such as a (Gly 4 Ser) 2 linker domain
  • the soluble interferon receptor comprises a heterodimer comprising an interferon receptor Fc construct comprising an IFNAR1 extracellular domain operably coupled to an IgGl Fc domain comprising mutation T366Y without a linker domain, with or without a leader sequence, and an interferon receptor Fc construct comprising an
  • the soluble interferon receptor Fc construct comprises a heterodimer comprising an interferon receptor Fc construct comprising an IFNAR1 extracellular domain operably coupled to a Fc domain comprising mutation Y407T without a linker domain, with or without a leader sequence
  • an interferon receptor Fc construct comprises an IFNAR2 extracellular domain operably coupled to an IgGl Fc domain comprising mutation T366Y without a linker domain, with or without a leader sequence.
  • the soluble interferon receptor comprises a heterodimer comprising an interferon receptor Fc construct comprising an IFNAR1 extracellular domain operably coupled to an IgGl Fc domain comprising mutation T366W via a linker domain, such as a (Gly 4 Ser) 4 linker domain, with or without a leader sequence, and an interferon receptor Fc construct comprising an IFNAR2 extracellular domain operably coupled to an IgGl Fc domain comprising mutations T366S, L368A, and Y407V via a linker domain, such as a (Gly 4 Ser) 4 linker domain, with or without a leader sequence.
  • a linker domain such as a (Gly 4 Ser) 4 linker domain
  • the soluble interferon receptor comprises a heterodimer comprising an interferon receptor Fc construct comprising an IFNAR1 extracellular domain operably coupled to an IgGl Fc domain comprising mutations T366S, L368A, and Y407V via a linker domain, such as a (Gly 4 Ser) 4 linker domain, with or without a leader sequence, and an interferon receptor Fc construct comprising an IFNAR2 extracellular domain operably coupled to an IgGl Fc domain comprising mutation T366W via a linker domain, such as a (Gly 4 Ser) 4 linker domain, with or without a leader sequence.
  • a linker domain such as a (Gly 4 Ser) 4 linker domain
  • the soluble interferon receptor comprises a heterodimer comprising an interferon receptor Fc construct comprising an IFNAR1 extracellular domain operably coupled to an IgGl Fc domain comprising mutation T366W via a linker domain, such as a (Gly 4 Ser) 2 linker domain, with or without a leader sequence, and an interferon receptor Fc construct comprising an IFNAR2 extracellular domain operably coupled to an IgGl Fc domain comprising mutations T366S, L368A, and Y407V via a linker domain, such as a (Gly 4 Ser) 2 linker domain, with or without a leader sequence.
  • a linker domain such as a (Gly 4 Ser) 2 linker domain
  • the soluble interferon receptor comprises a heterodimer comprising an interferon receptor Fc construct comprising an IFNAR1 extracellular domain operably coupled to an IgGl Fc domain comprising mutations T366S, L368A, and Y407V via a linker domain, such as a (Gly 4 Ser) 2 linker domain, with or without a leader sequence, and an interferon receptor Fc construct comprising an IFNAR2 extracellular domain operably coupled to an IgGl Fc domain comprising mutation T366W via a linker domain, such as a (Gly 4 Ser) 2 linker domain, with or without a leader sequence.
  • a linker domain such as a (Gly 4 Ser) 2 linker domain
  • the soluble interferon receptor comprises a heterodimer comprising an interferon receptor Fc construct comprising an IFNAR1 extracellular domain operably coupled to an IgGl Fc domain comprising mutation T366W without a linker domain, with or without a leader sequence, and an interferon receptor Fc construct comprising an IFNAR2 extracellular domain operably coupled to an IgGl Fc domain comprising mutations T366S, L368A, and Y407V without a linker domain, with or without a leader sequence.
  • the soluble interferon receptor comprises a heterodimer comprising an interferon receptor Fc construct comprising an IFNAR1 extracellular domain operably coupled to an IgGl Fc domain comprising mutations T366S, L368A, and Y407V without a linker domain, with or without a leader sequence, and an interferon receptor Fc construct comprising an IFNAR2 extracellular domain operably coupled to an IgGl Fc domain comprising mutation T366W without a linker domain, with or without a leader sequence.
  • the soluble interferon receptor comprises a heterodimer comprising an interferon receptor Fc construct comprising a IFNAR1 operably coupled to an IgG4 Fc domain comprising mutations F296Y, E356K, R409K, and H435R via a linker domain, such as a (Gly 4 Ser) 4 linker domain, with or without a leader sequence, and an interferon receptor Fc construct comprising a IFNAR2 operably coupled to an IgG4 Fc domain comprising mutations F296Y, R409K, and K439E via a linker domain, such as a (Gly 4 Ser) 4 linker domain, with or without a leader sequence.
  • a linker domain such as a (Gly 4 Ser) 4 linker domain
  • the soluble interferon receptor comprises a heterodimer comprising an interferon receptor Fc construct comprising a IFNAR1 operably coupled to an IgG4 Fc domain comprising mutations F296Y, R409K, and K439E via a linker domain, such as a (Gly 4 Ser) 4 linker domain, with or without a leader sequence, and an interferon receptor Fc construct comprising a IFNAR2 operably coupled to an IgG4 Fc domain comprising mutations F296Y, E356K, R409K, and H435R via a linker domain, such as a (Gly 4 Ser) 4 linker domain, with or without a leader sequence.
  • a linker domain such as a (Gly 4 Ser) 4 linker domain
  • the soluble interferon receptor comprises a heterodimer comprising an interferon receptor Fc construct comprising a IFNAR1 operably coupled to an IgG4 Fc domain comprising mutations F296Y, E356K, R409K, and H435R via a linker domain, such as a (Gly 4 Ser) 2 linker domain, with or without a leader sequence, and an interferon receptor Fc construct comprising a IFNAR2 operably coupled to an IgG4 Fc domain comprising mutations F296Y, R409K, and K439E via a linker domain, such as a (Gly 4 Ser) 2 linker domain, with or without a leader sequence.
  • a linker domain such as a (Gly 4 Ser) 2 linker domain
  • the soluble interferon receptor Fc construct comprises a heterodimer comprising an interferon receptor Fc construct comprising a IFNAR1 operably coupled to an IgG4 Fc domain comprising mutations F296Y, R409K, and K439E via a linker domain, such as a (Gly 4 Ser) 2 linker domain, with or without a leader sequence, and an interferon receptor Fc construct comprising a IFNAR2 operably coupled to an IgG4 Fc domain comprising mutations F296Y, E356K, R409K, and H435R via a linker domain, such as a (Gly 4 Ser) 2 linker domain, with or without a leader sequence.
  • a linker domain such as a (Gly 4 Ser) 2 linker domain
  • the soluble interferon receptor comprises a heterodimer comprising an interferon receptor Fc construct comprising a IFNAR1 operably coupled to an IgG4 Fc domain comprising mutations F296Y, E356K, R409K, and H435R without a linker domain, with or without a leader sequence, and an interferon receptor Fc construct comprising a IFNAR2 operably coupled to an IgG4 Fc domain comprising mutations F296Y, R409K, and K439E without a linker domain, with or without a leader sequence.
  • the soluble interferon receptor Fc construct comprises a heterodimer comprising an interferon receptor Fc construct comprising a IFNAR1 operably coupled to an IgG4 Fc domain comprising mutations F296Y, R409K, and K439E without a linker domain, with or without a leader sequence, and an interferon receptor Fc construct comprising a IFNAR2 operably coupled to an IgG4 Fc domain comprising mutations F296Y, E356K, R409K, and H435R without a linker domain, with or without a leader sequence.
  • a soluble interferon receptor is a heterodimer comprising a polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 1 and a polypeptide comprising the amino acid sequence set for in SEQ ID NO: 4.
  • a soluble interferon receptor is a heterodimer comprising a polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 2 and a polypeptide comprising the amino acid sequence set for in SEQ ID NO: 3.
  • a soluble interferon receptor is a heterodimer comprising a polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 52 and a polypeptide comprising the amino acid sequence set for in SEQ ID NO: 54.
  • a soluble interferon receptor is a heterodimer comprising a polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 56 and a polypeptide comprising the amino acid sequence set for in SEQ ID NO: 58.
  • a soluble interferon receptor is a heterodimer comprising a polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 40 and a polypeptide comprising the amino acid sequence set for in SEQ ID NO: 43.
  • a soluble interferon receptor is a heterodimer comprising a polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 41 and a polypeptide comprising the amino acid sequence set for in SEQ ID NO: 42.
  • a soluble interferon receptor is a heterodimer comprising a polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 53 and a polypeptide comprising the amino acid sequence set for in SEQ ID NO: 55.
  • a soluble interferon receptor is a heterodimer comprising a polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 57 and a polypeptide comprising the amino acid sequence set for in SEQ ID NO: 59.
  • an interferon receptor Fc construct comprises a polypeptide having an amino acid sequence at least 70% identical, such as 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or at least 99.5% identical to the amino acid sequence of SEQ ID NO: 1.
  • an interferon receptor Fc construct comprises a polypeptide having an amino acid sequence at least 70% identical, such as 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or at least 99.5% identical to the amino acid sequence of SEQ ID NO: 2.
  • an interferon receptor Fc construct comprises a polypeptide having an amino acid sequence at least 70% identical, such as 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or at least 99.5% identical to the amino acid sequence of SEQ ID NO: 3.
  • an interferon receptor Fc construct comprises a polypeptide having an amino acid sequence at least 70% identical, such as 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or at least 99.5% identical to the amino acid sequence of SEQ ID NO: 4.
  • an interferon receptor Fc construct comprises a polypeptide having an amino acid sequence at least 70% identical, such as 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or at least 99.5% identical to the amino acid sequence of SEQ ID NO: 52.
  • an interferon receptor Fc construct comprises a polypeptide having an amino acid sequence at least 70% identical, such as 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or at least 99.5% identical to the amino acid sequence of SEQ ID NO: 54.
  • an interferon receptor Fc construct comprises a polypeptide having an amino acid sequence at least 70% identical, such as 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or at least 99.5% identical to the amino acid sequence of SEQ ID NO: 56.
  • an interferon receptor Fc construct comprises a polypeptide having an amino acid sequence at least 70% identical, such as 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or at least 99.5% identical to the amino acid sequence of SEQ ID NO: 58.
  • an interferon receptor Fc construct comprises a polypeptide having an amino acid sequence at least 70% identical, such as 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or at least 99.5% identical to the amino acid sequence of SEQ ID NO: 40.
  • an interferon receptor Fc construct comprises a polypeptide having an amino acid sequence at least 70% identical, such as 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or at least 99.5% identical to the amino acid sequence of SEQ ID NO: 43.
  • an interferon receptor Fc construct comprises a polypeptide having an amino acid sequence at least 70% identical, such as 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or at least 99.5% identical to the amino acid sequence of SEQ ID NO: 41.
  • an interferon receptor Fc construct comprises a polypeptide having an amino acid sequence at least 70% identical, such as 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or at least 99.5% identical to the amino acid sequence of SEQ ID NO: 42.
  • an interferon receptor Fc construct comprises a polypeptide having an amino acid sequence at least 70% identical, such as 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or at least 99.5% identical to the amino acid sequence of SEQ ID NO: 53.
  • an interferon receptor Fc construct comprises a polypeptide having an amino acid sequence at least 70% identical, such as 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or at least 99.5% identical to the amino acid sequence of SEQ ID NO: 55.
  • an interferon receptor Fc construct comprises a polypeptide having an amino acid sequence at least 70% identical, such as 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or at least 99.5% identical to the amino acid sequence of SEQ ID NO: 57.
  • an interferon receptor Fc construct comprises a polypeptide having an amino acid sequence at least 70% identical, such as 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or at least 99.5% identical to the amino acid sequence of SEQ ID NO: 59.
  • the polypeptide comprises an amino acid sequence selected from any one of SEQ ID NOs: 1-4, 52, 54, 56, 58, 40, 43, 41, 42, 43, 55, 57 or 59.
  • the foregoing interferon receptor Fc constructs have a leader sequence. In some embodiments, the foregoing interferon receptor Fc constructs do not have a leader sequence.
  • the leader and linker sequences are optional and are not limited to those described in the embodiments above.
  • the IFNAR domains e.g., IFNAR1, IFNAR2
  • the leader domain can be any of those known in the art to be useful for its intended purpose, e.g., to increase protein expression and/or secretion (e.g., MDWTWRILFLVAAATGTHA; SEQ ID NO: 13)
  • the linker can be any linker known in the art, e.g., (Gly 4 Ser)n, NLG (VDGASSPVNVSSPSVQDI; SEQ ID NO: 18), LE, thrombin- sensitive disulphide cyclopeptide linker, LEA(EAAAK) 4 ALEA(EAAAK) 4 (SEQ ID NO: 19), or an in vivo cleavable disulphide linker,
  • interferon receptor Fc constructs of this disclosure largely may be made in transformed or transfected host cells using recombinant DNA techniques. To do so, a
  • DNA molecule coding for the peptide is prepared.
  • Methods of preparing such DNA molecules are well known in the art. For instance, sequences coding for the interferon receptor Fc constructs could be excised from DNA using suitable restriction enzymes. Alternatively, the DNA molecule could be synthesized using chemical synthesis techniques, such as the
  • the invention also includes a vector capable of expressing the interferon receptor Fc constructs in an appropriate host.
  • the vector comprises the DNA molecule that codes for the interferon receptor Fc construct operably coupled to appropriate expression control sequences. Methods of affecting this operative linking, either before or after the DNA molecule is inserted into the vector, are well known.
  • Expression control sequences include promoters, activators, enhancers, operators, ribosomal nuclease domains, start signals, stop signals, cap signals, polyadenylation signals, and other signals involved with the control of transcription or translation.
  • the resulting vector having the DNA molecule thereon is used to transform or transfect an appropriate host.
  • the soluble interferon receptors of the disclosure may be made by co-transfecting or co-transforming two or more expression vectors comprising DNA that codes for an interferon receptor Fc construct into an appropriate host. This transformation or transfection may be performed using methods well known in the art.
  • any of a large number of available and well-known host cells may be used in the practice of this invention.
  • the selection of a particular host is dependent upon a number of factors recognized by the art. These include, for example, compatibility with the chosen expression vector, toxicity of the interferon receptor Fc constructs encoded by the DNA molecule, rate of transformation or transfection, ease of recovery of the interferon receptor Fc constructs, expression characteristics, bio-safety and costs. A balance of these factors must be struck with the understanding that not all hosts may be equally effective for the expression of a particular DNA sequence.
  • useful microbial hosts include bacteria (such as E.
  • the interferon receptor Fc constructs are produced in CHO cells.
  • Host cells may be cultured under conventional fermentation or culture conditions so that the desired compounds are expressed. Such fermentation and culture conditions are well known in the art.
  • interferon receptor Fc constructs are purified from culture by methods well known in the art.
  • the compounds may also be made by synthetic methods. For example, solid phase synthesis techniques may be used. Suitable techniques are well known in the art, and include those described in Merrifield (1973), Chem. Polypeptides, pp. 335-61 (Katsoyannis and
  • Glycosylation e.g., O-lined or N-linked glycosylation
  • the soluble interferon receptors of the disclosure are prepared in aglycosylated, deglycosylated, or underglycosylated form.
  • N-linked glycosylation is altered and the soluble interferon receptor is aglycosyated.
  • all asparagine residues in a soluble interferon receptor that conform to the Asn-X-Ser/Thr (X can be any other naturally occurring amino acid except Pro) consensus are mutated to residues that do not serve as acceptors of N-linked glycosylation (e.g., serine, glutamine), thereby eliminating glycosylation of the soluble interferon receptor when synthesized in a cell that glycosylates proteins.
  • N-linked glycosylation e.g., serine, glutamine
  • soluble interferon receptor lacking N-linked glycosylation sites are produced in mammalian cells.
  • the mammalian cell is a CHO cell.
  • an aglycosylated soluble interferon receptor is produced in a CHO cell.
  • a reduction or lack of N-glycosylation is achieved by, e.g., producing soluble interferon receptors in a host (e.g., bacteria such as E. coli), mammalian cells engineered to lack one or more enzymes important for glycosylation, or mammalian cells treated with agents that prevent glycosylation, such as tunicamycin (an inhibitor of Dol-PP-GlcNAc formation).
  • a host e.g., bacteria such as E. coli
  • mammalian cells engineered to lack one or more enzymes important for glycosylation or mammalian cells treated with agents that prevent glycosylation, such as tunicamycin (an inhibitor of Dol-PP-GlcNAc formation).
  • the soluble interferon receptors are produced in lower eukaryotes engineered to produce glycoproteins with complex N-glycans, rather than high mannose type sugars (see, e.g., US2007/0105127).
  • glycosylated soluble interferon receptors are treated chemically or enzymatically to remove one or more carbohydrate residues (e.g., one or more mannose, fucose, and/or N-acetylglucosamine residues) or to modify or mask one or more carbohydrate residues.
  • carbohydrate residues e.g., one or more mannose, fucose, and/or N-acetylglucosamine residues
  • modifications or masking may reduce binding of the soluble interferon receptors to mannose receptors, and/or asialoglycoprotein receptors, and/or other lectin-like receptors.
  • Chemical deglycosylation can be achieved by treating a soluble interferon receptor with trifluoromethane sulfonic acid (TFMS), as disclosed in, e.g., Sojar et al., JBC 1989;264:2552-9 and Sojar et al., Methods Enzymol
  • TFMS trifluoromethane sulfonic acid
  • Enzymatic removal of N-linked carbohydrates from soluble interferon receptor can be achieved by treating a soluble interferon receptor with protein N-glycosidase (PNGase) A or F, as disclosed in Thotakura et al. ⁇ Methods Enzymol 1987;138:350-9).
  • PNGase protein N-glycosidase
  • deglycosylating enzymes that are suitable for use include endo-alpha-N- acetyl-galactosaminidase, endoglycosidase Fl, endoglycosidase F2, endoglycosidase F3, and endoglycosidase H.
  • endo-alpha-N- acetyl-galactosaminidase endoglycosidase Fl
  • endoglycosidase F2 endoglycosidase F3
  • endoglycosidase H endoglycosidase H.
  • one or more of these enzymes can be used to deglycosylate the soluble interferon receptors of the disclosure.
  • Alternative methods for deglycosylation are disclosed in, e.g., US 8,198,063.
  • the soluble interferon receptor are partially deglycosylated.
  • Partial deglycosylation can be achieved by treating the soluble interferon receptor with an endoglycosidase (e.g., endoglycosidase H), which cleaves N-linked high mannose carbohydrate but not complex type carbohydrates, leaving a single GlcNAc residue linked to the asparagine. Soluble interferon receptor treated with endoglycosidase H will lack high mannose
  • glycosylation of a soluble interferon receptor is modified, e.g., by oxidation, reduction, dehydration, substitution, esterification, alkylation, sialylation, carbon- carbon bond cleavage, or the like, to reduce clearance of the soluble interferon receptors from blood.
  • the soluble interferon receptors are treated with periodate and sodium borohydride to modify the carbohydrate structure. Periodate treatment oxidizes vicinal diols, cleaving the carbon-carbon bond and replacing the hydroxyl groups with aldehyde groups; borohydride reduces the aldehydes to hydroxyls.
  • the carbohydrate structures of a soluble interferon receptor can be masked by addition of one or more additional moieties (e.g., carbohydrate groups, phosphate groups, alkyl groups, etc.) that interfere with recognition of the structure by a mannose or asialoglycoprotein receptor or other lectin-like receptors.
  • additional moieties e.g., carbohydrate groups, phosphate groups, alkyl groups, etc.
  • one or more potential glycosylation sites are removed by mutation of the nucleic acid encoding the soluble interferon receptor, thereby reducing glycosylation (underglycosylation) of the soluble interferon receptor when synthesized in a cell that glycosylates proteins, e.g., a mammalian cell such as a CHO cell.
  • other amino acids in the vicinity of glycosylation acceptors can be modified, disrupting a recognition motif for glycosylation enzymes without necessarily changing the amino acid that would normally be glycosylated.
  • glycosylation of a soluble interferon receptor can be altered by introducing glycosylation sites.
  • the amino acid sequence of the soluble interferon receptor can be modified to introduce the consensus sequence for N-linked glycosylation of Asn- X-Ser/Thr (X is any amino acid other than proline). Additional N-linked glycosylation sites can be added anywhere throughout the amino acid sequence of the soluble interferon receptor.
  • the glycosylation sites are introduced in position in the amino acid sequence that does not substantially reduce the activity of the soluble interferon receptor.
  • O-linked glycosylation sites has been reported to alter serum half-life of proteins, such as growth hormone, follicle- stimulating hormone, IGFBP-6, Factor IX, and many others (e.g., as disclosed in Okada et al., Endocr Rev 2011;32:2-342; Weenen et al., Clin Endocrinol Metab 2004;89:5204-12; Marinaro et al., European Journal of Endocrinology 2000;142:512-6; US 2011/0154516). Accordingly, in some embodiments, O-linked glycosylation (on serine/threonine residues) of the soluble interferon receptor is altered.
  • the soluble interferon receptors are altered to introduce O-linked glycosylation in the soluble interferon receptor as disclosed in, e.g., Okada et al. ⁇ supra), Weenen et al. ⁇ supra), US2008/0274958; and US2011/0171218.
  • one or more O-linked glycosylation consensus sites are introduced into the soluble interferon receptors, such as CXXGGT/S-C (SEQ ID NO: 29) (van den Steen et al., In Critical Reviews in Biochemistry and Molecular Biology, Michael Cox, ed., 1998;33: 151-208), NST- E/D-A (SEQ ID NO: 30), NITQS (SEQ ID NO: 31), QSTQS (SEQ ID NO: 32), D/E-FT-R/K-V (SEQ ID NO: 33), C-E/D-SN (SEQ ID NO: 34), and GGSC-K/R (SEQ ID NO: 35).
  • CXXGGT/S-C SEQ ID NO: 29
  • NST- E/D-A SEQ ID NO: 30
  • NITQS SEQ ID NO: 31
  • QSTQS SEQ ID NO: 32
  • D/E-FT-R/K-V SEQ ID NO: 33
  • O-linked glycosylation sites can be added anywhere throughout the amino acid sequence of the soluble interferon receptor.
  • the glycosylation sites are introduced in position in the amino acid sequence that does not substantially reduce the activity of the soluble interferon receptors.
  • O-linked sugar moieties are introduced by chemically modifying an amino acid in the soluble interferon receptors as described in, e.g., WO 87/05330 and Aplin et al., CRC Crit Rev Biochem 1981;259-306).
  • both N-linked and O-linked glycosylation sites are introduced into the soluble interferon receptors, preferably in positions in the amino acid sequence that do not substantially reduce the activity of the soluble interferon receptors.
  • the soluble interferon receptor may comprise an altered glycoform (e.g., an underfucosylated or fucose-free glycan).
  • a soluble interferon receptor with altered glycosylation has a serum half-life that is increased at least about 1.5-fold, such as at least 3-fold, at least 5-fold, at least 10-fold, at least about 20-fold, at least about 50-fold, at least about 100-fold, at least about 200-fold, at least about 300-fold, at least about 400-fold, at least about 500-fold, at least about 600-fold, at least about 700-fold, at least about 800-fold, at least about 900-fold, at least about 1000-fold, or 1000-fold or greater relative to the corresponding glycosylated soluble interferon receptors (e.g., a soluble interferon receptor in which potential N-linked glycosylation sites are not mutated). Routine art-recognized methods can be used to determine the serum half-life of soluble interferon receptors with altered glycosylation status.
  • Routine art-recognized methods can be used to determine the serum half-life of soluble interferon receptors with altered
  • a soluble interferon receptor with altered glycosylation retains at least 50%, such as at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5%, or 100% of the activity of the corresponding glycosylated soluble interferon receptor (e.g., a soluble interferon receptor in which potential N-linked glycosylation sites are not mutated).
  • the corresponding glycosylated soluble interferon receptor e.g., a soluble interferon receptor in which potential N-linked glycosylation sites are not mutated.
  • altering the glycosylation status of the soluble interferon receptors may increase activity, either by directly increasing activity, or by increasing bioavailability (e.g., serum half-life). Accordingly, in some embodiments, the activity of a soluble interferon receptor with altered glycosylation is increased by at least 1.3-fold, such as at least 1.5-fold, at least 2-fold, at least 2.5-fold, at least 3-fold, at least 3.5-fold, at least 4-fold, at least 4.5-fold, at least 5-fold, at least 5.5-fold, at least 6-fold, at least 6.5-fold, at least 7-fold, at least 7.5-fold, at least 8-fold, at least 8.5-fold, at least 9-fold, at least 9.5 fold, or 10-fold or greater, relative to the corresponding glycosylated soluble interferon receptor (e.g., a soluble interferon receptor in which potential N-linked glycosylation sites are not mutated).
  • the corresponding glycosylated soluble interferon receptor
  • the skilled artisan can readily determine the glycosylation status of soluble interferon receptors using art-recognized methods.
  • the glycosylation status is determined using mass spectrometry.
  • interactions with Concanavalin A can be assessed to determine whether a soluble interferon receptor is underglycosylated.
  • An underglycosylated soluble interferon receptor is expected to exhibit reduced binding to Con A-Sepharose when compared to the corresponding glycosylated soluble interferon receptor.
  • SDS-PAGE analysis can also be used to compare the mobility of an underglycosylated protein and corresponding glycosylated protein.
  • the underglycosylated protein is expected to have a greater mobility in SDS-PAGE compared to the glycosylated protein.
  • Other suitable art- recognized methods for analyzing protein glycosylation status are disclosed in, e.g., Roth et al., International Journal of Carbohydrate Chemistry 2012;1-10.
  • Pharmacokinetics, such as serum half-life, of soluble interferon receptors with different glycosylation status can be assayed using routine methods, e.g., by introducing the soluble interferon receptors in mice, e.g., intravenously, taking blood samples at pre-determined time points, and assaying and comparing levels and/or activity of the soluble interferon receptors in the samples.
  • a soluble interferon receptor is administered alone. In certain embodiments, a soluble interferon receptor is administered prior to the administration of at least one other therapeutic agent. In certain embodiments, a soluble interferon receptor is
  • a soluble interferon receptor is administered subsequent to the
  • a soluble interferon receptor is administered prior to the administration of at least one other therapeutic agent.
  • the soluble interferon receptor is combined with the other agent/compound.
  • the soluble interferon receptor and other agent are administered concurrently.
  • the soluble interferon receptor and other agent are not administered simultaneously, with the soluble interferon receptor being administered before or after the agent is administered.
  • the subject receives both the soluble interferon receptor and the other agent during a same period of prevention, occurrence of a disorder, and/or period of treatment.
  • compositions of the disclosure can be administered in combination therapy, i.e., combined with other agents.
  • the combination therapy comprises the soluble interferon receptor, in combination with at least one other agent.
  • Agents include, but are not limited to, in vitro synthetically prepared chemical compositions, antibodies, antigen binding regions, and combinations and conjugates thereof.
  • an agent can act as an agonist, antagonist, allosteric modulator, or toxin.
  • compositions comprising a soluble interferon receptor together with a pharmaceutically acceptable diluent, carrier, solubilizer, emulsifier, preservative and/or adjuvant.
  • the invention provides for pharmaceutical compositions comprising a soluble interferon receptor and a therapeutically effective amount of at least one additional therapeutic agent, together with a pharmaceutically acceptable diluent, carrier, solubilizer, emulsifier, preservative and/or adjuvant.
  • acceptable formulation materials preferably are nontoxic to recipients at the dosages and concentrations employed.
  • the formulation material(s) are for s.c. and/or I.V. administration.
  • the pharmaceutical composition can contain formulation materials for modifying, maintaining or preserving, for example, the pH, osmolality, viscosity, clarity, color, isotonicity, odor, sterility, stability, rate of dissolution or release, adsorption or penetration of the composition.
  • suitable formulation materials include, but are not limited to, amino acids (such as glycine, glutamine, asparagine, arginine or lysine); antimicrobials; antioxidants (such as ascorbic acid, sodium sulfite or sodium hydrogen- sulfite); buffers (such as borate, bicarbonate, Tris-HCl, citrates, phosphates or other organic acids); bulking agents (such as mannitol or glycine);
  • amino acids such as glycine, glutamine, asparagine, arginine or lysine
  • antimicrobials such as ascorbic acid, sodium sulfite or sodium hydrogen- sulfite
  • buffers such as borate, bicarbonate, Tris-HCl, citrates, phosphates or other organic acids
  • bulking agents such as mannitol or glycine
  • chelating agents such as ethylenediamine tetraacetic acid (EDTA)
  • complexing agents such as caffeine, polyvinylpyrrolidone, beta-cyclodextrin or hydroxypropyl-beta-cyclodextrin
  • fillers monosaccharides; disaccharides; and other carbohydrates (such as glucose, mannose or dextrins); proteins (such as gelatin); coloring, flavoring and diluting agents; emulsifying agents;
  • hydrophilic polymers such as polyvinylpyrrolidone); low molecular weight polypeptides; salt- forming counterions (such as sodium); preservatives (such as benzalkonium chloride, benzoic acid, salicylic acid, thimerosal, phenethyl alcohol, methylparaben, propylparaben, chlorhexidine, sorbic acid or hydrogen peroxide); solvents (such as glycerin, propylene glycol or polyethylene glycol); sugar alcohols (such as mannitol or sorbitol); suspending agents; surfactants or wetting agents (such as pluronics, PEG, sorbitan esters, polysorbates such as polysorbate 20, polysorbate 80, triton, tromethamine, lecithin, cholesterol, tyloxapal); stability enhancing agents (such as sucrose or sorbitol); tonicity enhancing agents (such as alkali metal halides, preferably sodium or potassium chloride,
  • the formulation comprises PBS; 20 mM NaOAC, pH 5.2, 50 mM NaCl; and/or 10 mM NAOAC, pH 5.2, 9% Sucrose.
  • a soluble interferon receptor and/or a therapeutic molecule is linked to a half-life extending vehicle known in the art.
  • vehicles include, but are not limited to, polyethylene glycol, glycogen (e.g., glycosylation of the soluble interferon receptor), and dextran.
  • glycogen e.g., glycosylation of the soluble interferon receptor
  • dextran e.g., dextran
  • the optimal pharmaceutical composition will be determined by one skilled in the art depending upon, for example, the intended route of administration, delivery format and desired dosage. See, for example, Remington's Pharmaceutical Sciences, supra. In certain embodiments, such compositions may influence the physical state, stability, rate of in vivo release and rate of in vivo clearance of the antibodies of the invention.
  • the primary vehicle or carrier in a pharmaceutical composition can be either aqueous or non-aqueous in nature.
  • a suitable vehicle or carrier can be water for injection, physiological saline solution or artificial
  • the saline comprises isotonic phosphate- buffered saline.
  • pharmaceutical compositions comprise Tris buffer of about pH 7.0-8.5, or acetate buffer of about H 4.0-5.5, which can further include sorbitol or a suitable substitute therefore.
  • a composition comprising a soluble interferon receptor, with or without at least one additional therapeutic agents can be prepared for storage by mixing the selected composition having the desired degree of purity with optional formulation agents (Remington's Pharmaceutical Sciences, supra) in the form of a lyophilized cake or an aqueous solution.
  • a composition comprising a soluble interferon receptor, with or without at least one additional therapeutic agent can be formulated as a lyophilizate using appropriate excipients such as sucrose.
  • the pharmaceutical composition can be selected for parenteral delivery. In certain embodiments, the compositions can be selected for inhalation or for delivery through the digestive tract, such as orally.
  • the preparation of such pharmaceutically acceptable compositions is within the ability of one skilled in the art.
  • the formulation components are present in concentrations that are acceptable to the site of administration.
  • buffers are used to maintain the composition at physiological pH or at a slightly lower pH, typically within a pH range of from about 5 to about 8.
  • a therapeutic composition when parenteral administration is contemplated, can be in the form of a pyrogen-free, parenterally acceptable aqueous solution comprising a desired a soluble interferon receptor, with or without additional therapeutic agents, in a pharmaceutically acceptable vehicle.
  • a vehicle for parenteral injection is sterile distilled water in which soluble interferon receptor, with or without at least one additional therapeutic agent, is formulated as a sterile, isotonic solution, properly preserved.
  • the preparation can involve the formulation of the desired molecule with an agent, such as injectable microspheres, bio-erodible particles, polymeric compounds (such as polylactic acid or polyglycolic acid), beads or liposomes, that can provide for the controlled or sustained release of the product which can then be delivered via a depot injection.
  • an agent such as injectable microspheres, bio-erodible particles, polymeric compounds (such as polylactic acid or polyglycolic acid), beads or liposomes, that can provide for the controlled or sustained release of the product which can then be delivered via a depot injection.
  • hyaluronic acid can also be used, and can have the effect of promoting sustained duration in the circulation.
  • implantable drug delivery devices can be used to introduce the desired molecule.
  • a pharmaceutical composition can be formulated for inhalation.
  • a soluble interferon receptor, with or without at least one additional therapeutic agent can be formulated as a dry powder for inhalation.
  • an inhalation solution comprising a soluble interferon receptor, with or without at least one additional therapeutic agent can be formulated with a propellant for aerosol delivery.
  • solutions can be nebulized. Pulmonary administration is further described in PCT application no. PCT/US94/001875, which describes pulmonary delivery of chemically modified proteins.
  • formulations can be administered orally.
  • a soluble interferon receptor, with or without at least one additional therapeutic agents, that is administered in this fashion can be formulated with or without those carriers customarily used in the compounding of solid dosage forms such as tablets and capsules.
  • a capsule can be designed to release the active portion of the formulation at the point in the gastrointestinal tract when bioavailability is maximized and pre- systemic degradation is minimized.
  • at least one additional agent can be included to facilitate absorption of a soluble interferon receptor and/or any additional therapeutic agents.
  • diluents, flavorings, low melting point waxes, vegetable oils, lubricants, suspending agents, tablet disintegrating agents, and binders can also be employed.
  • a pharmaceutical composition can involve an effective quantity of a soluble interferon receptor, with or without at least one additional therapeutic agents, in a mixture with non-toxic excipients which are suitable for the manufacture of tablets.
  • suitable excipients include, but are not limited to, inert diluents, such as calcium carbonate, sodium carbonate or bicarbonate, lactose, or calcium phosphate; or binding agents, such as starch, gelatin, or acacia; or lubricating agents such as magnesium stearate, stearic acid, or talc.
  • sustained-release preparations can include semipermeable polymer matrices in the form of shaped articles, e.g.
  • Sustained release matrices can include polyesters, hydrogels, polylactides (U.S. Pat. No. 3,773,919 and EP 058,481), copolymers of L-glutamic acid and gamma ethyl-L-glutamate (Sidman et al, Biopolymers, 22:547-556 (1983)), poly (2- hydroxyethyl-methacrylate) (Langer et al., J Biomed Mater Res, 15: 167-277 (1981) and Langer, Chem Tech, 12:98-105 (1982)), ethylene vinyl acetate (Langer et al, supra) or poly-D(-)-3- hydroxybutyric acid (EP 133,988).
  • sustained release compositions can also include liposomes, which can be prepared by any of several methods known in the art. See, e.g., Eppstein et al, PNAS, 82:3688-3692 (1985); EP 036,676; EP 088,046 and EP 143,949.
  • the pharmaceutical composition to be used for in vivo administration typically is sterile. In certain embodiments, this can be accomplished by filtration through sterile filtration membranes. In certain embodiments, where the composition is lyophilized, sterilization using this method can be conducted either prior to or following lyophilization and reconstitution.
  • the composition for parenteral administration can be stored in lyophilized form or in a solution.
  • parenteral compositions generally are placed into a container having a sterile access port, for example, an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle.
  • the pharmaceutical composition once the pharmaceutical composition has been formulated, it can be stored in sterile vials as a solution, suspension, gel, emulsion, solid, or as a dehydrated or lyophilized powder. In certain embodiments, such formulations can be stored either in a ready- to-use form or in a form (e.g., lyophilized) that is reconstituted prior to administration.
  • kits are provided for producing a single-dose administration unit.
  • the kit can contain both a first container having a dried protein and a second container having an aqueous formulation.
  • kits containing single and multi-chambered pre-filled syringes e.g., liquid syringes and lyosyringes are included.
  • the effective amount of a pharmaceutical composition is a pharmaceutical composition
  • a soluble interferon receptor comprising a soluble interferon receptor, with or without at least one additional therapeutic agent, to be employed therapeutically will depend, for example, upon the therapeutic context and objectives.
  • the appropriate dosage levels for treatment will thus vary depending, in part, upon the molecule delivered, the indication for which a soluble interferon receptor, with or without at least one additional therapeutic agent, is being used, the route of administration, and the size (body weight, body surface or organ size) and/or condition (the age and general health) of the patient.
  • the clinician can titer the dosage and modify the route of administration to obtain the optimal therapeutic effect.
  • a typical dosage can range from about 0.1 ⁇ g/kg to up to about 100 mg/kg or more, depending on the factors mentioned above. In certain embodiments, the dosage can range from 0.1 ⁇ g/kg up to about 100 mg/kg; or 1 ⁇ g/kg up to about 100 mg/kg; or 5 ⁇ g/kg up to about 100 mg/kg.
  • the frequency of dosing will take into account the
  • compositions can therefore be administered as a single dose, or as two or more doses (which may or may not contain the same amount of the desired molecule) over time, or as a continuous infusion via an implantation device or catheter. Further refinement of the appropriate dosage is routinely made by those of ordinary skill in the art and is within the ambit of tasks routinely performed by them. In certain embodiments, appropriate dosages can be ascertained through use of appropriate dose-response data.
  • the route of administration of the pharmaceutical composition is in accord with known methods, e.g. orally, through injection by intravenous, intraperitoneal, intracerebral (intra-parenchymal), intracerebroventricular, intramuscular, subcutaneously, intraocular, intraarterial, intraportal, or intralesional routes; by sustained release systems or by implantation devices.
  • the compositions can be administered by bolus injection or continuously by infusion, or by implantation device.
  • the composition can be administered locally via implantation of a membrane, sponge or another appropriate material onto which the desired molecule has been absorbed or encapsulated.
  • the device can be implanted into any suitable tissue or organ, and delivery of the desired molecule can be via diffusion, timed-release bolus, or continuous administration.
  • a pharmaceutical composition comprising a soluble interferon receptor, with or without at least one additional therapeutic agent, in an ex vivo manner.
  • cells, tissues and/or organs that have been removed from the patient are exposed to a pharmaceutical composition comprising a soluble interferon receptor, with or without at least one additional therapeutic agent, after which the cells, tissues and/or organs are subsequently implanted back into the patient.
  • a soluble interferon receptor and/or any additional therapeutic agents can be delivered by implanting certain cells that have been genetically engineered, using methods such as those described herein, to express and secrete the polypeptides.
  • such cells can be animal or human cells, and can be autologous, heterologous, or xenogeneic.
  • the cells can be immortalized.
  • the cells in order to decrease the chance of an immunological response, the cells can be encapsulated to avoid infiltration of surrounding tissues.
  • the encapsulation materials are typically biocompatible, semi-permeable polymeric enclosures or membranes that allow the release of the protein product(s) but prevent the destruction of the cells by the patient's immune system or by other detrimental factors from the surrounding tissues.
  • soluble interferon receptors can be assessed for their ability to inhibit IFN- ⁇ and/or IFN- ⁇ induced secreted alkaline phosphatase (SEAP) production in HEK-Blue oc/ ⁇ cells.
  • SEAP alkaline phosphatase
  • IFNoc and/or IFN- ⁇ can be added to inhibitors (e.g., soluble interferon receptors (e.g., RSLV-601-604, RSLV-602-603) as well as control molecules such as anti-IFN- , anti-IFN- ⁇ , and human IgG) in a tissue culture plate.
  • inhibitors e.g., soluble interferon receptors (e.g., RSLV-601-604, RSLV-602-603) as well as control molecules such as anti-IFN- , anti-IFN- ⁇ , and human IgG) in a tissue culture plate.
  • HEK- Blue IFN- / ⁇ cells can then be added to the plate and incubated for a predetermined amount of time at 37°C.
  • SEAP activity cell supernatant can then be added to QUANTI-Blue reagent and incubated for a predetermined amount of time at 37°C.
  • SEAP activity can be detected by measuring absorbance at 620nm.
  • the effectiveness of the soluble interferon receptors is demonstrated by comparing the results of an assay from cells treated with the soluble interferon receptors disclosed herein to the results of the assay from cells treated with a control.
  • the levels of IFN-oc and/or IFN- ⁇ are generally comparable to the levels measured following treatment with an anti-IFN-a or anti-IFN- ⁇ control.
  • the levels of IFN-oc and/or IFN- ⁇ are generally reduced relative to the levels measured following treatment with a negative control such as human IgG.
  • the soluble interferon receptors of the disclosure are particularly effective in the treatment of autoimmune disorders or abnormal immune responses.
  • the soluble interferon receptors of the present disclosure may be used to control, suppress, modulate, treat, or eliminate dysregulated immune responses resulting from excess production of interferon.
  • a soluble interferon receptors is adapted for preventing (prophylactic) or treating (therapeutic) a disease or disorder, such as an autoimmune disease, in a mammal by administering a soluble interferon receptor in a therapeutically effective amount or a sufficient amount to the mammal in need thereof, wherein the disease is prevented or treated.
  • a route of administration suitable for achieving the desired effect is contemplated by the invention (e.g., intravenous, intramuscular, subcutaneous). Treatment of the disease condition may result in a decrease in the symptoms associated with the condition, which may be long-term or short-term, or even a transient beneficial effect.
  • the disease or disorder is an autoimmune disease or cancer.
  • the autoimmune disease is insulin- dependent diabetes mellitus, multiple sclerosis, experimental autoimmune encephalomyelitis, rheumatoid arthritis, experimental autoimmune arthritis, myasthenia gravis, thyroiditis, an experimental form of uveoretinitis, Hashimoto's thyroiditis, primary myxoedema, thyrotoxicosis, pernicious anaemia, autoimmune atrophic gastritis, Addison's disease, premature menopause, male infertility, juvenile diabetes, Goodpasture's syndrome, pemphigus vulgaris, pemphigoid, sympathetic ophthalmia, phacogenic uveitis, autoimmune haemolytic anaemia, idiopathic leucopenia, primary biliary cirrhosis, active chronic
  • a soluble interferon receptor is used to prevent or treat SLE or Sjogren's syndrome.
  • the effectiveness of a soluble interferon receptor is demonstrated by comparing the level of expression of certain known IFN regulated genes in mammals treated with a soluble interferon receptor disclosed herein to mammals treated with control formulations.
  • the expression level of one, two, three, four, five or more IFN regulated genes is measured.
  • the expression level of three or more IFN regulated genes e.g., HERC5, EPSTI, CMPK2
  • the IFN regulated genes include those described by Bennett et al., J. Exp. Med., Vol. 197, No. 6, 711- 723, March 2003. and Kennedy et al. Lupus Science and Medicine, 2015; 2:e00080. Doi: 10.1136/lupus-2014-000080., both of which are incorporated herein by reference.
  • a human subject in need of treatment is selected or identified (e.g., a patient who fulfills the American College of Rheumatology criteria for SLE, or a patient who fulfills the American-European Consensus Sjogren's Classification Criteria).
  • the subject can be in need of, e.g., reducing a cause or symptom of SLE or Sjogren's syndrome.
  • the identification of the subject can occur in a clinical setting, or elsewhere, e.g., in the subject's home through the subject's own use of a self-testing kit.
  • a suitable first dose of a soluble interferon receptor is administered to the subject.
  • the soluble interferon receptor is formulated as described herein.
  • the subject's condition is evaluated, e.g., by measuring IFN regulated gene expression. For example, the expression of one or more of HERC5, EPSTI, and CMPK2, which are interferon stimulated genes, can be assessed. Other relevant criteria can also be measured.
  • the number and strength of doses are adjusted according to the subject's needs. The progress of treatment may be monitored by assaying for a change in IFN regulated gene expression.
  • a decrease and/or improvement can be noted in the expression of the subject's IFN regulated gene expression relative to the IFN regulated gene expression prior to the treatment, or relative to the levels measured in a similarly afflicted but untreated/control subject.
  • the expression of HERC5, EPSTI, and/or CMPK2, which are interferon stimulated genes would be decreased relative to the expression of these three genes prior to treatment, or relative to the levels of these genes in a similarly afflicted by untreated/control subject.
  • the IFN regulated gene expression is measured by drawing whole blood from a subject, extracting the RNA and analyzing the expression of the interferon regulated genes (for example, HERC5, EPSTI, and/or CMPK2) by using techniques well-known in the art, such as PCR.
  • Methods for assaying for IFN regulated gene expression are described in Kennedy et al. Lupus Science and Medicine, 2015; 2:e00080. Doi: 10.1136/lupus-2014-000080 and Furie et al., Arthritis & Rheumatology, Vo. 69, No. 2, Feb 2017, 376-386, both of which are incorporated herein by reference.
  • a rodent subject in need of treatment is selected or identified.
  • the identification of the subject can occur in a laboratory setting or elsewhere.
  • a suitable first dose of a soluble interferon receptor is administered to the subject.
  • the a soluble interferon receptor is formulated as described herein.
  • the subject's condition is evaluated, e.g., by measuring IFN regulated gene expression. Other relevant criteria can also be measured.
  • the number and strength of doses are adjusted according to the subject's needs.
  • the progress of treatment may be monitored by assaying for a change in IFN regulated gene expression.
  • the subject's IFN regulated gene expression are lowered and/or improved relative to the IFN regulated gene expression prior to the treatment, or relative to the levels measured in a similarly afflicted but untreated/control subject.
  • IFN regulated genes that may be upregulated in an autoimmune disorder (e.g., SLE) include, IFP35 IFN inducible, IRF7B, MX1, MX2, XIAP ass. factor, GS3686, P69 2'5' oligoA synthetase, hep-C ass. microtubular agg. prot, RIGE/TSA1 sim to mouse Ly6, agrin prec, IFI-56 IFN inducible, EST sim.
  • IFN ind 17kD protein cig 5, ISG 15, TRIP 14 2'5' oligoA synthetase-like, cig49, MCP-1 monocyte chemoattractant, Six rpt ass with PCTAIRE, MMTRA IB phospholipid scramblase, FACL 1 fatty acid coenzyme-A ligase, TRAIL, 2'5' oligoA synthetase E18 isoform, GBP-1 guanylate binding protein 1, Cl-INH CC1 inhibitor, CD64 rec for Fc fragment of IgG, C2 complement component, hPD-ECGF end.
  • IFN regulated genes that may be downregulated in an
  • autoimmune disorder include TCRyT-cell receptor delta, LEU 1 leukemia ass.
  • the effectiveness of a soluble interferon receptor is demonstrated by assessing the Cutaneous Lupus Erythematosus Disease Area and Severity Index (CLASI), British Isles Lupus Assessment Group (BILAG) index, Systemic Lupus Erythematosus (SLE) Responder Index (SRI-4), and/or the Functional Assessment of Chronic Illness Therapy (FACIT) fatigue scale in mammals treated with a soluble interferon receptor disclosed herein when compared to mammals treated with control formulations.
  • CLASI Cutaneous Lupus Erythematosus Disease Area and Severity Index
  • BILAG British Isles Lupus Assessment Group
  • SLE Systemic Lupus Erythematosus
  • FACIT Functional Assessment of Chronic Illness Therapy
  • a mammal treated with a soluble interferon receptor will demonstrate an improvement in the CLASI severity index, BILAG index, SRI-4 index, and/or the FACIT fatigue scale when compared to the mammal's CLASI severity index, BILAG index, SRI-4 index, and/or the FACIT fatigue scale prior to the treatment, or when compared to a mammal treated with a control formulation.
  • the effectiveness of a soluble interferon receptor is demonstrated by assessing a reduction in steroid use in mammals treated with a soluble interferon receptor disclosed herein when compared to mammals treated with control formulations.
  • a mammal treated with a soluble interferon receptor will demonstrate a reduction in steroid use when compared to the mammal's steroid use prior to the treatment, or when compared to a mammal treated with a control formulation.
  • a human subject in need of treatment is selected or identified (e.g., a patient who fulfills the American College of Rheumatology criteria for SLE, or a patient who fulfills the American-European Consensus Sjogren's Classification Criteria).
  • the subject can be in need of, e.g., reducing a cause or symptom of SLE or Sjogren's syndrome.
  • the identification of the subject can occur in a clinical setting, or elsewhere, e.g., in the subject's home through the subject's own use of a self-testing kit.
  • a suitable first dose of a soluble interferon receptor is administered to the subject.
  • the soluble interferon receptor is formulated as described herein.
  • the subject's condition is evaluated, e.g., by CLASI severity index, BILAG index, SRI-4 index, the FACIT fatigue scale, and/or a reduction in steroid use. Other relevant criteria can also be measured.
  • the number and strength of doses are adjusted according to the subject's needs.
  • an improvement in one or more of the following outcomes can be noted: (1) an improvement in the CLASI severity index relative to the CLASI severity index prior to treatment, or relative to a similarly afflicted but untreated/control subject, (2) an improvement in the BILAG index relative to the BILAG index prior to treatment, or relative to a similarly afflicted but untreated/control subject, (3) an improvement in the SRI-4 index relative to the SRI-4 index prior to treatment, or relative to a similarly afflicted but untreated/control subject, (4) an improvement can be noted in the FACIT fatigue scale relative to the FACIT fatigue scale prior to treatment, or relative to a similarly afflicted but untreated/control subject, (5) a reduction in steroid use relative to steroid use prior to treatment, or relative to a similarly affected but untreated/control subject.
  • a rodent subject in need of treatment is selected or identified.
  • the identification of the subject can occur in a laboratory setting or elsewhere.
  • a suitable first dose of a soluble interferon receptor is administered to the subject.
  • the a soluble interferon receptor is formulated as described herein.
  • the subject's condition is evaluated, e.g., by CLASI severity index, BILAG index, SRI-4 index, the FACIT fatigue scale, and/or a reduction in steroid use. Other relevant criteria can also be measured.
  • the number and strength of doses are adjusted according to the subject's needs.
  • an improvement in one or more of the following outcomes can be noted: (1) an improvement in the CLASI severity index relative to the CLASI severity index prior to treatment, or relative to a similarly afflicted but untreated/control subject, (2) an improvement in the BILAG index relative to the BILAG index prior to treatment, or relative to a similarly afflicted but untreated/control subject, (3) an improvement in the SRI-4 index relative to the SRI- 4 index prior to treatment, or relative to a similarly afflicted but untreated/control subject, (4) an improvement can be noted in the FACIT fatigue scale relative to the FACIT fatigue scale prior to treatment, or relative to a similarly afflicted but untreated/control subject, (5) a reduction in steroid use relative to steroid use prior to treatment, or relative to a similarly affected but untreated/control subject.
  • Another aspect of the present invention is to use gene therapy methods for treating or preventing disorders, diseases, and conditions with one or more soluble interferon receptors.
  • the gene therapy methods relate to the introduction of interferon receptor Fc construct nucleic acid (DNA, RNA and antisense DNA or RNA) sequences into an animal in need thereof to achieve expression of the polypeptide or polypeptides of the present disclosure.
  • This method can include introduction of one or more polynucleotides encoding a interferon receptor Fc construct of the present disclosure operably coupled to a promoter and any other genetic elements necessary for the expression of the polypeptide by the target tissue.
  • interferon receptor Fc construct genes are introduced into cells in order to achieve in vivo synthesis of a therapeutically effective genetic product.
  • Gene therapy includes both conventional gene therapies where a lasting effect is achieved by a single treatment, and the administration of gene therapeutic agents, which involves the one time or repeated administration of a therapeutically effective DNA or mRNA.
  • the oligonucleotides can be modified to enhance their uptake, e.g. , by substituting their negatively charged phosphodiester groups by uncharged groups.
  • the disclosure also relates to the following embodiments which feature heterodimers of the disclosure and use thereof.
  • the term embodiment is abbreviated as ⁇ ' followed by an ordinal.
  • El is equivalent to Embodiment 1.
  • a heterodimer comprising a first polypeptide and a second polypeptide, wherein the first polypeptide comprises an interferon receptor 1 (IFNAR1) domain operatively coupled with or without a linker domain to a variant Fc domain, and wherein the second polypeptide comprises an interferon receptor 2 (IFNAR2) domain operatively coupled with or without a linker domain to a variant Fc domain.
  • IFNAR1 interferon receptor 1
  • IFNAR2 interferon receptor 2
  • heterodimer of claim El wherein the variant Fc domain of the first or second polypeptide comprises one or more amino acid substitutions which increase the formation of heterodimers as compared to wild-type.
  • variant Fc domain of the first or second polypeptide comprises one or more amino acid substitutions selected from the group consisting of T350V, L351Y, F405A, and Y407V.
  • variant Fc domain of the first or second polypeptide comprises one or more amino acid substitutions selected from the group consisting of T350V, T366L, K392L, and T394W.
  • Fc domain of the first or second polypeptide comprises a human immunoglobulin Fc domain, such as a human IgGl Fc domain.
  • Fc domain of the first or second polypeptide comprises a hinge domain, a CH2 domain and a CH3 domain.
  • the heterodimer of claim E5, wherein the Fc domain comprises an amino acid sequence having one or more of the amino acid substitutions P238S, P331S, SCC, SSS (residues 220, 226, and 229), G236R, L328R, L234A, and L235A.
  • variant Fc domain of the first or second polypeptide further comprises one or more amino acid substitutions selected from the group consisting of C220S, P238S, and P331S.
  • variant Fc domain further comprises one or more amino acid substitutions selected from the group consisting of C220S, P238S, and P331S.
  • E10 The heterodimer of claim El, wherein the interferon receptor 1 (IFNAR1) domain of the first polypeptide is operatively coupled to the variant Fc domain via a linker domain.
  • IFNAR1 interferon receptor 1
  • variant Fc domain of the first polypeptide comprises one or more amino acid substitutions selected from the group consisting of T350V, L351Y, F405A, and Y407V
  • variant Fc domain of the second polypeptide comprises one or more amino acid substitutions selected from the group consisting of T350V, T366L, K392L, and T394W.
  • variant Fc domain of the first polypeptide comprises one or more amino acid substitutions selected from the group consisting of T350V, T366L, K392L, and T394W
  • variant Fc domain of the second polypeptide comprises one or more amino acid substitutions selected from the group consisting of T350V, L351Y, F405A, and Y407V.
  • the first polypeptide comprises an interferon receptor 2 (IFNAR2) domain operatively coupled with or without a linker domain to a variant Fc domain comprising one or more amino acid substitutions selected from the group consisting of T350V, L351Y, F405A, and Y407V, and
  • IFNAR2 interferon receptor 2
  • the second polypeptide comprises an interferon receptor 1 (IFNAR1) domain operatively coupled with or without a linker domain to a variant Fc domain comprising one or more amino acid substitutions selected from the group consisting of T350V, T366L, K392L, and T394W.
  • IFNAR1 interferon receptor 1
  • a heterodimer comprising a first polypeptide and a second polypeptide
  • the first polypeptide comprises an interferon receptor 1 (IFNAR1) domain operatively coupled with or without a linker domain to a variant Fc domain comprising one or more amino acid substitutions selected from the group consisting of T350V, L351Y, F405A, and Y407V
  • the second polypeptide comprises an interferon receptor 2 (IFNAR2) domain operatively coupled with or without a linker domain to a variant Fc domain comprising one or more amino acid substitutions selected from the group consisting of T350V, T366L, K392L, and T394W.
  • the first polypeptide comprises an interferon receptor 2 (IFNAR2) domain operatively coupled via a Gly-Ser linker domain to a variant Fc domain
  • IFNAR2 interferon receptor 2
  • the variant Fc domain of the first polypeptide comprises one or more amino acid substitutions selected from the group consisting of T350V, L351Y, F405A, and Y407V
  • the variant Fc domain of the first polypeptide further comprises one or more mutation selected from the group consisting of C220S, P238S, and P331S;
  • the second polypeptide comprises an interferon receptor 1 (IFNAR1) operatively coupled via a Gly-Ser linker domain to a variant Fc domain
  • IFNAR1 interferon receptor 1
  • the variant Fc domain of the second polypeptide comprises one or more amino acid substitutions selected from the group consisting of T350V, T366L, K392L, and T394W
  • the variant Fc domain of the second polypeptide further comprises one or more mutation selected from the group consisting of C220S, P238S, and P331S.
  • the first polypeptide comprises an interferon receptor 1 (IFNAR1) domain operatively coupled via a Gly-Ser linker domain to a variant Fc domain
  • IFNAR1 interferon receptor 1
  • the variant Fc domain of the first polypeptide comprises one or more amino acid substitutions selected from the group consisting of T350V, L351Y, F405A, and Y407V
  • the variant Fc domain of the first polypeptide further comprises one or more mutation selected from the group consisting of C220S, P238S, and P331S;
  • the second polypeptide comprises an interferon receptor 2 (IFNAR2) operatively coupled via a Gly-Ser linker domain to a variant Fc domain
  • IFNAR2 interferon receptor 2
  • the variant Fc domain of the second polypeptide comprises one or more amino acid substitutions selected from the group consisting of T350V, T366L, K392L, and T394W
  • the variant Fc domain of the second polypeptide further comprises one or more mutation selected from the group consisting of C220S, P238S, and P331S.
  • composition comprising the heterodimer of any of the preceding claims and a pharmaceutically acceptable carrier.
  • a recombinant expression vector comprising a nucleic acid according to claim E24.
  • a recombinant expression vector comprising a nucleic acid according to claim E25.
  • a method of making the heterodimer of claim El comprising: providing a host cell comprising a nucleic acid sequence that encodes the first polypeptide and a nucleic acid that encodes the second polypeptide; and maintaining the host cell under conditions in which the first and second polypeptides are expressed.
  • the heterodimer of claim El for use in a method for treating or preventing a condition associated with an abnormal immune response.
  • heterodimer of claim El wherein the heterodimer binds interferon a to a similar extent as a control anti-IFNoc antibody.
  • soluble interferon receptors are shown in Fig. 1 with amino acid sequences of each presented in Table 1.
  • the following interferon receptor extracellular domain (ECD) -immunoglobulin Fc fusion proteins were constructed: RSLV-601, RSLV-602, RSLV-603, RSLV-604, RSLV-606, RSLV-608, RSLV-611, and RSLV-613 (Fig. 1). Constructs were generated through direct synthesis using commercially available services. Amino acid sequences were provided to GeneArt; and codon utilization was optimized for and the genes were synthesized and inserted into the mammalian cell expression vector pcDNA3.1 +
  • RSLV-601 (SEQ ID NO: 1) has the configuration: Leader Sequence
  • RSLV-602 (SEQ ID NO:2) has the configuration: Leader Sequence
  • RSLV-603 (SEQ ID NO:3) has the configuration: Leader Sequence
  • RSLV-604 (SEQ ID NO:4) has the configuration: Leader Sequence
  • RSLV-606 (SEQ ID NO: 52) has the configuration: Leader Sequence
  • RSLV-608 (SEQ ID NO: 56) has the configuration: Leader Sequence
  • RSLV-611 (SEQ ID NO: 54) has the configuration: Leader Sequence
  • RSLV-613 (SEQ ID NO:58) has the configuration: Leader Sequence
  • the interferon receptor Fc constructs of the invention can also be generated using conventional cloning techniques well-known in the art, for example, by preparing modular cassettes of each component of the interferon receptor Fc constructs (e.g., INFAR ECD, linker domain, Fc) with compatible restriction enzyme sites to allow for shuttling and domain swapping.
  • a polynucleotide encoding each component of the interferon receptor Fc constructs e.g., INFAR ECD, linker domain, immunoglobulin Fc
  • PCR polymerase chain reaction
  • the full length nucleotide sequences of human INFAR ECD, linker domain, and immunoglobulin Fc can be amplified from random primed and oligo dT primed cDNA derived from commercially available human pancreatic total RNA using sequence specific 5' and 3' primers based on published sequences of the component being amplified.
  • Linkers e.g., (Gly 4 Ser) 4
  • Linkers can be generated by overlap PCR using routine methods, or through direct synthesis using commercially available services, and designed to have overhangs or be blunt to facilitate subsequent cloning to allow for fusion with other domains of interest.
  • pairs of expression vectors containing the interferon receptor ECD - Fc constructs from Example 1 were co-transfected into CHO-S cells.
  • RSLV-601 and RSLV-604; RSLV-602 and RSLV-603; RSLV-606 and RSLV-611; and RSLV- 608 and RSLV-613 were co-transfected into CHO-S cells.
  • Plasmids obtained from GeneArt were transformed into DH10B competent E. coli and the cultures expanded under ampicillin selection. Plasmid DNA subsequently was isolated from the cultures using QIAGEN plasmid plus maxi kits.
  • Transfections were performed using the FreeStyle MAX CHO Expression System obtained from Life Technologies.
  • CHO-S cells were seeded at a density of 5xl0 5 cells/ml in 100ml of FreeStyle CHO expression medium supplemented with 8mM L-glutamine; the flasks subsequently were placed on an orbital shaker rotating at 120-135 rpm and incubated overnight in an 8% CO2 incubator at 37°C.
  • the CHO-S cells were harvested then re-seeded at a density of lxlO 6 cells/ml in 100 ml of FreeStyle CHO Expression Medium supplemented with 8mM L-glutamine. 1: 1 co-transfections were performed.
  • RSLV-601 and 62 ⁇ g of RSLV-604; and 62 ⁇ g of RSLV-602 and 62 ⁇ g or RSLV-603 were added into OptiPRO SFM with a final volume of 2ml, and mixed by repeated inversion.
  • 125 ⁇ 1 of FreeStyle MAX transfection reagent was mixed with 1875 ⁇ of OptiPRO SFM and mixed by repeated inversion.
  • the transfection mixture then was slowly added to the 100ml culture of CHO-S cells while gently swirling the flask. Similarly, 37.5 ⁇ g RSLV-606 and 37.5 ⁇ g RSLV-611; and 37.5 ⁇ g RSLV-608 and 37.5 ⁇ g RSLV-613, were co- transfected into 60 ml of CHO-S cultures.
  • the cultures were incubated on an orbital shaker platform (120-135 rpm) at 37°C in an 8% C02 incubator. After 7 days of growth, cells were harvested by centrifugation (1000 rpm for 10 min) and the conditioned medium was recovered and filtered by passage through a 0.22um membrane.
  • Each clarified culture medium (co-transfected RSLV-601/604, RSLV-602/603, RSLV- 606/611, and RSLV-608/613) was purified by passing over a protein-A column (Bio-Rad BioScale Mini Protein A, Catalog # 7324600) and washed with 10 column volumes of PBS buffer at pH 7.2. The bound material was eluted with 5 column volumes of citrate buffer at pH 3.6 with each fraction neutralized with TRIS at pH 11. The fractions containing protein were pooled and equilibrated into PBS by dialysis using a 10k MWCO dialysis unit.
  • Blot 1 was then exposed sequentially to: 0.1 g/ml of polyclonal goat anti human IFNAR1 antibody (R&D Systems, Catalog#AF245), and a 1: 10,000 dilution of Dylight 800 conjugated donkey anti goat IgG (Rockland, Catalog#605-745-002).
  • Blot 2 was exposed sequentially to ⁇ g/ml of polyclonal sheep anti human IFNAR2 (R&D Systems, Catalog* AF4015), and a 1:50,000 dilution of Alexa Fluor 680 -conjugated AffiniPure Donkey Anti-Sheep IgG (Jackson, Catalog#713-625-147). The blots were imaged using a Licor Odyssey.
  • a major band was detected in the starting material and in fractions 2-5 of the purified RSLV 602-603 soluble interferon receptor (data not shown).
  • the theoretical mass of the RSLV- 602-603 soluble interferon receptor is 130,754 Daltons and ran higher than predicted on SDS- PAGE possibly due to glycosylation.
  • a major band was detected in the starting material and in fractions 2-4 of the purified RSLV 601-604 soluble interferon receptor (data not shown).
  • the theoretical mass of the RSLV-601-604 soluble interferon receptor is 130,754 Daltons and ran higher than predicted on SDS-PAGE possibly due to glycosylation.
  • the soluble interferon receptors were assessed for their ability to inhibit IFNa induced secreted alkaline phosphatase (SEAP) production in HEK-Blue ⁇ / ⁇ cells.
  • SEAP alkaline phosphatase
  • HEK-Blue IFN- ⁇ / ⁇ cells (Invivogen, Catalog#hkb-ifnab) produce and secrete SEAP in response to stimulation by IFN-a or IFN- ⁇ .
  • IFN-a activity replicate titrations of inhibitors (RSLV 601-604, RSLV 602-603, and anti-human IFNa control) were prepared in a 96 well plate. A fixed concentration of IFNa (0.2 ng/ml final concentration) was added to the wells.
  • HEK- Blue IFN- ⁇ / ⁇ cells were then added to the plate at 50,000 cells/well and plates were incubated 20-24 hours at 37°C in 5% CO2.
  • RSLV 601-604 had an IC50 value of 0.534 nM
  • RSLV 602-603 had an IC50 value of 0.461 nM
  • the anti-IFNa control had an IC50 value of 0.138 nM.
  • the soluble interferon receptors were assessed for their ability to inhibit ⁇ induced secreted alkaline phosphatase (SEAP) production in HEK-Blue ⁇ / ⁇ cells.
  • SEAP alkaline phosphatase
  • HEK- Blue IFN- ⁇ / ⁇ cells (Invivogen, Catalog#hkb-ifnab) produce and secrete SEAP in response to stimulation by IFN-a or IFN- ⁇ .
  • IFN- ⁇ activity replicate titrations of inhibitors (RSLV 601-604, RSLV 602-603, and anti-human ⁇ control) were prepared in a 96 well plate. A fixed concentration of ⁇ (5 pg/ml final concentration) was added to the wells.
  • HEK- Blue IFN- ⁇ / ⁇ cells were then added to the plate at 50,000 cells/well and plates were incubated 20-24 hours at 37°C in 5% CO2.
  • RSLV 601-604 had an IC50 value of 0.020 nM
  • RSLV 602-603 had an IC50 value of 0.015 nM
  • the anti-IFN control had an ICso value of 0.059 nM.
  • linker length on the ability of the soluble interferon receptors to inhibit IFN-a was assayed according to the methods described in Example 3.
  • the inhibitors used in the assay were RSLV 601-604, RSLV 606-611, RSLV 608-613, and anti-human IFNa control.
  • RSLV 601-604 has a (Gly 4 Ser) 4 linker;
  • RSLV 606-611 has a (Gly 4 Ser) 2 linker, and
  • RSLV 608- 613 does not include a linker domain.
  • the inhibition assays of IFNa activity were performed twice. As shown in Fig. 4, all constructs were able to inhibit IFNa induced SEAP production, although the constructs without linkers or shortened linkers appear to be more potent.
  • RSLV 601-604 had an IC50 value of 1.051 nM
  • RSLV 606-611 had an IC50 value of 0.835 nM
  • RSLV 608-613 had an IC50 value of 0.375.
  • Anti-human IFNa control had an IC50 value of 0.640 nM.
  • linker length on the ability of the soluble interferon receptors to inhibit IFN- ⁇ was assayed according to the methods described in Example 4.
  • the inhibitors used in the assay were RSLV 601-604, RSLV 606-611, RSLV 608-613, and anti-human IFNa control.
  • RSLV 601-604 has a (Gly 4 Ser) 4 linker;
  • RSLV 606-611 has a (Gly 4 Ser) 2 linker, and
  • RSLV 608- 613 does not include a linker domain.
  • RSLV 601-604 had an ICso value of 0.011 nM
  • RSLV 606-611 had an ICso value of 0.015 nM
  • RSLV 608-613 had an ICso value of 0.010.
  • Anti-human IFN control had an ICso value of 0.043 nM.
  • interferon (IFN) gene expression was assessed whether interferon (IFN) gene expression could be inhibited by the soluble interferon receptor constructs.
  • PBMC peripheral blood mononuclear cells
  • SLE systemic lupus erythematosus
  • ISM interferon signature metric
  • PBMC from a single healthy volunteer were thawed according to the following protocol: RPMI complete media was made by adding 10% heat- inactivated FBS and 1% pen/strep.
  • RPMI complete media was made by adding 10% heat- inactivated FBS and 1% pen/strep.
  • Nine ml of RPMI complete was aliquoted into a 15-ml conical for each cryovial to be thawed.
  • Each cyrovial was partially submerged in a 37°C water bath and moved back and forth to partially thaw the vial.
  • the vial was then removed from the water bath and the exterior was sprayed with 70% ethanol.
  • the cryovial was then uncapped and 1 ml of RPMI complete was added to the vial dropwise.
  • the thawed PMBC were then transferred to the 9 ml aliquot of RPMI complete.
  • PBMC cells in RPMI complete were then centrifuged at 300xg for 7-10 minutes at room temperature. The supernantent was removed from the cells and the cells were suspended in RPMI complete to 2xl0 6 cells/ml. the cells were then transferred to a 25 ml tissue culture flask and allowed to rest overnight in 5% C0 2 at 37°C.
  • PBMC peripheral blood mononuclear cells
  • SLE patient sera was pre-incubated with the RSLV inhibitor by adding 15 ⁇ g RSLV 608-613 (27 ⁇ of RSLV-608-613 at 555 ⁇ g/ml) or 15 ⁇ RSLV 601-604 (50 ⁇ of RSLV 601-604 at 306 ⁇ g/ml) to 200 ⁇ SLE patient sera in duplicate wells of a 24-well plate.
  • 27 ⁇ 1 of RPMI complete was added to 200 ⁇ 1 of SLE patient sera to duplicate wells of a 24-well plate.
  • PBMC peripheral blood mononuclear cells
  • RNA from the stimulated PBMC was prepared using the RNeasy® Plus Mini Kit from Qiagen® according to the manufacturer's protocol.
  • PBMC were harvested from each well of the 24-well plate into 1.5ml Eppendorf tubes and centrifuged for 2 minutes at lOOOxg to pellet the cells. The supernatant was aspirated from the tubes and the pelleted cells were retained. Any remaining PBMC in the wells of the 24-well plate were lysed with 350 ml buffer RLT plus. The cell lysates were then added to the appropriate cell pellet and vortexed for 30 seconds.
  • the homogenized lysate was transferred to a gDNA Eliminator spin column and placed in a 2 ml collection tube.
  • the tubes were centrifuges for 30 seconds at > 8000xg (> 10,000 rpm). The flow-though was saved and the column was discarded. 350 ⁇ of 70% ethanol was added to the flow-through and mixed well by pipetting. 700 ⁇ 1 of the sample, including any precipitate was immediately transferred to a RNeasy spin column and placed in a 2ml collection tube. The tubes were centrifuged for 15 seconds at > 8,000xg and the flow-though was discarded.
  • buffer RW1 700 ⁇ 1 of buffer RW1 was added to the RNeasy Mini spin column (in a 2 ml collection tube), the lids were closed, and the tubes were centrifuged for 15 seconds at > 8,000xg. The flow-through was discarded. 500 ⁇ of buffer RPE was added to the RNeasy Mini spin column (in a 2 ml collection tube), the lids were closed, and the tubes were centrifuged for 15 seconds at >
  • the cDNA reaction mixture was prepare for all reactions to be run.
  • the mix for a single reaction consists of: 4 ⁇ 1 5X VILO Reaction Mix, 2 ⁇ 1 10X Superscript Enzyme Mix, and ⁇ molecular grade water.
  • Enough Reaction mix lacking the 10X Enzyme mix was prepared for use with one RNA sample from each sample (patient sample with or without the RSLV inhibitor, IFN positive RNA control, and IFN negative RNA control).
  • the cDNA reaction plate was placed on ice, and for each reaction 16 ⁇ 1 of the appropriate reaction mix was added to the desired well of a 96 well QPCR plate. 4 ⁇ of RNA was added to each reaction well and mixed by pipetting up and down several times.
  • QPCR (Taqman) was used to measure the levels of three interferon-inducible genes (HERC5, EPSTIl, and CMPK2) and three reference genes (HPRTl, GUSB, and TFRC) present in the cDNAs prepared above. 1 ⁇ of 1 mM ROX reference dye (provided with Brilliant Multiplex Masters Mix) was added to to 500 ⁇ water to produce a 2 ⁇ stock solution. QPCR reaction mix was prepared for all reactions.
  • the QPCR reaction mix was divided into seven aliquots with enough reaction mix for each of the six primer/probe sets (sequences shown below) plus an additional aliquot of mix for a set of no RT controls.
  • a single primer/probe set was added to each aliquot.
  • the stock concentration of the primer probe sets was 40X. Therefore, 0.625 ⁇ of primer/probe was used for each 25 ⁇ reaction.
  • a primer and probe set was prepared for each of the six genes, and a single primer/probe set was prepared for the no RT control wells. 20 ⁇ 1 of each reaction mixture was transferred to the wells of a QPCR 96 well plate.
  • each cDNA sample was loaded into the QPCR wells containing each primer/probe mix, and mixed thoroughly by pipetting up and down. All wells were capped with QPCR strip caps, and the plate was spun briefly at 1000 rpm. The plate was loaded into an Mx3005p QPCR instrument and run according to the following cycling conditions: 95 °C for 10 minutes, followed by 40 cycles of: 95 °C for 15 seconds and 60°C for 1 minute. The following detection settings were used: data was collected using FAM, and ROX filter sets at the end of each 60°C step (filter gain settings: ROX x 1, FAM x 8).
  • CMPK2 Primer 1 AGG ACA GCC TTA AGT GAA TCT G CMPK2 Primer 2 GCC CAA AAC AGA TCC AGA AAG
  • EPSTI1 Primer 2 GTG AAT TAC TGG AAC TGA AAC GG
  • Cycle threshold (Ct) values for each QPCR reaction were obtained using MxPro version 4.10 software. Threshold fluorescence values were set automatically by the software with amplification -based threshold, adaptive baseline, and moving average options checked. For each sample the log 2 scaled relative expression of IFN- regulated genes was calculated as the mean Ct of the 3 IFN-regulated genes (CMPK2, HERC5, and EPSTI1) minus the mean Ct of the 3 reference genes (GUSB, HPRT1, and TFRC). This quantity was multiplied by -1 to give the correct directionality to the value.
  • RSLV-601-604 inhibited SLE sera induced interferon gene expression in PBMC from each of the six SLE patients.
  • RSLV 608-613 also inhibited SLE patient sera induced interferon gene stimulation (Fig. 7)
  • IgGl Fc (aa GQESESAESAKGGGGSGGGGSGGGGSGGGGSEPKSSDKTHTCPPC 216-447) with PAPELLGGSSVFLFPPKPKDTLMI SRTPEVTCVWDVSHEDPEVK mutations FNWYVDGVEVHNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEY C220S, P238S, KCKVSNKALPAS IEKTI SKAKGQPREPQVYVYPPSRDELTKNQVS P331S, and ZWl LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFALVSK Chain A LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK mutations
  • IFNAR1 MMWLLGATTLVLVAVAPWVLSAAAGGKNLKSPQKVEVDI IDDNF ACCESSION ILRWNRSDESVGNVTFSFDYQKTGMDNWIKLSGCQNITSTKCNFS NP_000620 SLKLNVYEEIKLRIRAEKENTSSWYEVDSFTPFRKAQIGPPEVHL
  • IFNAR1 MMWLLGATTLVLVAVAPWVLSAAAGGKNLKSPQKVEVDI IDDNF
  • KCTLLPPGQESESAESAK IgGl Fc (aa EPKSSDKTHTCPPCPAPELLGGSSVFLFPPKPKDTLMI SRTPEVT 216-447) with CVWDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRWSV mutations LTVLHQDWLNGKEYKCKVSNKALPAS IEKTI SKAKGQPREPQVYV C220S, P238S, YPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP P331S, T350V, PVLDSDGSFALVSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS L351Y, F405A, LSLSPGK
  • EPKSSDKTHTCPPCPAPELLGGSSVFLFPPKPKDTLMI SRTPEVT (aa216- CVWDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRWSV 447) with LTVLHQDWLNGKEYKCKVSNKALPAS IEKTI SKAKGQPREPQVYV mutations LPPSRDELTKNQVSLLCLVKGFYPSDIAVEWESNGQPENNYLTWP C220S, P238S, PVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS P331S, T350V, LSLSPGK
  • IFNAR1 (aa28- KNLKSPQKVEVDI IDDNFILRWNRSDESVGNVTFSFDYQKTGMDN 436) WIKLSGCQNITSTKCNFSSLKLNVYEEIKLRIRAEKENTSSWYEV
  • IFNAR2 (aa27- I SYDSPDYTDESCTFKI SLRNFRS ILSWELKNHS IVPTHYTLLYT 243) IMSKPEDLKWKNCANTTRSFCDLTDEWRSTHEAYVTVLEGFSGN
  • IgGl Fc SCC EPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMI SRTPEVT hinge
  • IFNAR2 I SYDSPDYTDESCTFKI SLRNFRS ILSWELKNHS IVPTHYTLLYT (without IMSKPEDLKWKNCANTTRSFCDLTDEWRSTHEAYVTVLEGFSGN signal TTLFSCSHNFWLAIDMSFEPPEFEIVGFTNHINVMVKFPS IVEEE sequence) LQFDLSLVIEEQSEGIVKKHKPEIKGNMSGNFTYI IDKLIPNTNY
  • IFNAR2 (aa27- I SYDSPDYTDESCTFKI SLRNFRS ILSWELKNHS IVPTHYTLLYT 243) - IMSKPEDLKWKNCANTTRSFCDLTDEWRSTHEAYVTVLEGFSGN (Gly4Ser) 2- TTLFSCSHNFWLAIDMSFEPPEFEIVGFTNHINVMVKFPS IVEEE IgGl Fc (aa LQFDLSLVIEEQSEGIVKKHKPEIKGNMSGNFTYI IDKLIPNTNY 216-447) with CVSVYLEHSDEQAVIKSPLKCTLLPPGQESESAESAKGGGGSGGG mutations GSEPKSSDKTHTCPPCPAPELLGGSSVFLFPPKPKDTLMI SRTPE C220S, P238S, VTCVWDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRW P331S, T350V, SVLTVLHQDWLNGKEYKCKVSNKALPAS IE
  • IFNAR2 (aa27- I SYDSPDYTDESCTFKI SLRNFRS ILSWELKNHS IVPTHYTLLYT 243) - IgGl Fc IMSKPEDLKWKNCANTTRSFCDLTDEWRSTHEAYVTVLEGFSGN (aa 216- TTLFSCSHNFWLAIDMSFEPPEFEIVGFTNHINVMVKFPS IVEEE 447) with LQFDLSLVIEEQSEGIVKKHKPEIKGNMSGNFTYI IDKLIPNTNY mutations CVSVYLEHSDEQAVIKSPLKCTLLPPGQESESAESAKEPKSSDKT C220S, P238S, HTCPPCPAPELLGGSSVFLFPPKPKDTLMI SRTPEVTCVWDVSH P331S, T350V, EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRWSVLTVLHQDW T366L, K392L, LNGKEYKCKVSNKALPAS IEKTI SKAKGQ
  • PCPAPELLGGSSVFLFPPKPKDTLMI SRTPEVTCVWDVSHEDPE VKFNWYVDGVEVHNAKTKPREEQYNSTYRWSVLTVLHQDWLNGK EYKCKVSNKALPAS IEKTI SKAKGQPREPQVYVYPPSRDELTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFALV SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
  • IFNARl (aa28- KNLKSPQKVEVDI IDDNFILRWNRSDESVGNVTFSFDYQKTGMDN 436) - WIKLSGCQNITSTKCNFSSLKLNVYEEIKLRIRAEKENTSSWYEV
  • IFNARl (aa28- KNLKSPQKVEVDI IDDNFILRWNRSDESVGNVTFSFDYQKTGMDN 436)- IgGl Fc WIKLSGCQNITSTKCNFSSLKLNVYEEIKLRIRAEKENTSSWYEV (aa 216- DSFTPFRKAQIGPPEVHLEAEDKAIVIHI SPGTKDSVMWALDGLS 447) with FTYSLVIWKNSSGVEERIENIYSRHKIYKLSPETTYCLKVKAALL mutations TSWKIGVYSPVHCIKTTVENELPPPENIEVSVQNQNYVLKWDYTY C220S, P238S, ANMTFQVQWLHAFLKRNPGNHLYKWKQIPDCENVKTTQCVFPQNV P331S, T350V, FQKGIYLLRVQASDGNNTSFWSEEIKFDTEIQAFLLPPVFNIRSL L351Y, F405A, SDSFHIYIGAPKQ
  • RSLV-606 MDWTWRILFLVAAATGTHAKNLKSPQKVEVDI IDDNFILRWNRSD Leader- ESVGNVTFSFDYQKTGMDNWIKLSGCQNITSTKCNFSSLKLNVYE IFNAR1 (aa28- EIKLRIRAEKENTSSWYEVDSFTPFRKAQIGPPEVHLEAEDKAIV 436) - IHI SPGTKDSVMWALDGLSFTYSLVIWKNSSGVEERIENIYSRHK
  • RSLV-608 MDWTWRILFLVAAATGTHAKNLKSPQKVEVDI IDDNFILRWNRSD Leader- ESVGNVTFSFDYQKTGMDNWIKLSGCQNITSTKCNFSSLKLNVYE IFNAR1 (aa28- EIKLRIRAEKENTSSWYEVDSFTPFRKAQIGPPEVHLEAEDKAIV 436)- Fc IHI SPGTKDSVMWALDGLSFTYSLVIWKNSSGVEERIENIYSRHK (aa216- IYKLSPETTYCLKVKAALLTSWKIGVYSPVHCIKTTVENELPPPE 447) with NIEVSVQNQNYVLKWDYTYANMTFQVQWLHAFLKRNPGNHLYKWK mutations QIPDCENVKTTQCVFPQNVFQKGIYLLRVQASDGNNTSFWSEEIK C220S, P238S, FDTEIQAFLLPPVFNIRSLSDSFHIYIGAPKQSGNTP
  • IFNAR1 (aa28- KNLKSPQKVEVDI IDDNFILRWNRSDESVGNVTFSFDYQKTGMDN 436) - WIKLSGCQNITSTKCNFSSLKLNVYEEIKLRIRAEKENTSSWYEV

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Immunology (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Toxicology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Cell Biology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicinal Preparation (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
PCT/US2018/047614 2017-08-22 2018-08-22 SOLUBLE INTERFERON RECEPTORS AND USES THEREOF Ceased WO2019040674A1 (en)

Priority Applications (13)

Application Number Priority Date Filing Date Title
JP2020532857A JP7374091B2 (ja) 2017-08-22 2018-08-22 可溶性インターフェロン受容体およびその使用
SG11202001311VA SG11202001311VA (en) 2017-08-22 2018-08-22 Soluble interferon receptors and uses thereof
AU2018321359A AU2018321359B2 (en) 2017-08-22 2018-08-22 Soluble interferon receptors and uses thereof
CN201880067266.4A CN111315767B (zh) 2017-08-22 2018-08-22 可溶性干扰素受体及其用途
MX2020002070A MX2020002070A (es) 2017-08-22 2018-08-22 Receptores solubles de interferon y usos de los mismos.
CA3073537A CA3073537A1 (en) 2017-08-22 2018-08-22 Soluble interferon receptors and uses thereof
BR112020003670-6A BR112020003670A2 (pt) 2017-08-22 2018-08-22 receptores de interferon solúveis e usos dos mesmos
EP18773305.0A EP3672986A1 (en) 2017-08-22 2018-08-22 Soluble interferon receptors and uses thereof
KR1020207007881A KR102777015B1 (ko) 2017-08-22 2018-08-22 가용성 인터페론 수용체 및 그의 용도
IL272749A IL272749A (en) 2017-08-22 2020-02-18 Soluble interferon receptors and their uses
JP2023036377A JP2023060304A (ja) 2017-08-22 2023-03-09 可溶性インターフェロン受容体およびその使用
AU2024201211A AU2024201211A1 (en) 2017-08-22 2024-02-23 Soluble interferon receptors and uses thereof
JP2025016404A JP2025072475A (ja) 2017-08-22 2025-02-03 可溶性インターフェロン受容体およびその使用

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201762548737P 2017-08-22 2017-08-22
US62/548,737 2017-08-22

Publications (1)

Publication Number Publication Date
WO2019040674A1 true WO2019040674A1 (en) 2019-02-28

Family

ID=63643063

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2018/047614 Ceased WO2019040674A1 (en) 2017-08-22 2018-08-22 SOLUBLE INTERFERON RECEPTORS AND USES THEREOF

Country Status (12)

Country Link
US (2) US10947295B2 (https=)
EP (1) EP3672986A1 (https=)
JP (3) JP7374091B2 (https=)
KR (1) KR102777015B1 (https=)
CN (1) CN111315767B (https=)
AU (2) AU2018321359B2 (https=)
BR (1) BR112020003670A2 (https=)
CA (1) CA3073537A1 (https=)
IL (1) IL272749A (https=)
MX (2) MX2020002070A (https=)
SG (1) SG11202001311VA (https=)
WO (1) WO2019040674A1 (https=)

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN110357969A (zh) * 2019-05-27 2019-10-22 北京志道生物科技有限公司 一种GLP1-EGFa异源二聚体蛋白、功能及方法
WO2020138868A1 (ko) * 2018-12-24 2020-07-02 서울대학교산학협력단 타입 1 인터페론 중화 fc-융합 단백질 및 이의 용도
WO2020142740A1 (en) * 2019-01-04 2020-07-09 Resolve Therapeutics, Llc Treatment of sjogren's disease with nuclease fusion proteins
WO2021253360A1 (en) * 2020-06-18 2021-12-23 Proviva Therapeutics (Hong Kong) Limited Activatable procytokines
US12077790B2 (en) 2016-07-01 2024-09-03 Resolve Therapeutics, Llc Optimized binuclease fusions and methods
US12129288B2 (en) 2017-08-22 2024-10-29 Sanabio, Llc Polynucleotides heterodimers of soluble interferon receptors and uses thereof

Families Citing this family (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
IL297601A (en) * 2020-04-29 2022-12-01 Teneobio Inc Multispecific heavy chain antibodies with modified heavy chain constant regions
WO2021231802A2 (en) * 2020-05-13 2021-11-18 Vanderbilt University Methods of treating sjögren's syndrome
CN115873126A (zh) * 2021-11-26 2023-03-31 深圳科兴药业有限公司 人生长激素融合蛋白及其制备和用途
US20240067691A1 (en) * 2022-08-18 2024-02-29 Regeneron Pharmaceuticals, Inc. Interferon receptor agonists and uses thereof

Citations (89)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3773919A (en) 1969-10-23 1973-11-20 Du Pont Polylactide-drug mixtures
US3941763A (en) 1975-03-28 1976-03-02 American Home Products Corporation PGlu-D-Met-Trp-Ser-Tyr-D-Ala-Leu-Arg-Pro-Gly-NH2 and intermediates
US4179337A (en) 1973-07-20 1979-12-18 Davis Frank F Non-immunogenic polypeptides
EP0036676A1 (en) 1978-03-24 1981-09-30 The Regents Of The University Of California Method of making uniformly sized liposomes and liposomes so made
US4301144A (en) 1979-07-11 1981-11-17 Ajinomoto Company, Incorporated Blood substitute containing modified hemoglobin
EP0058481A1 (en) 1981-02-16 1982-08-25 Zeneca Limited Continuous release pharmaceutical compositions
EP0088046A2 (de) 1982-02-17 1983-09-07 Ciba-Geigy Ag Lipide in wässriger Phase
US4496689A (en) 1983-12-27 1985-01-29 Miles Laboratories, Inc. Covalently attached complex of alpha-1-proteinase inhibitor with a water soluble polymer
EP0133988A2 (de) 1983-08-02 1985-03-13 Hoechst Aktiengesellschaft Regulatorische Peptide enthaltende pharmazeutische Präparate mit protrahierter Freisetzung und Verfahren zu deren Herstellung
EP0143949A1 (en) 1983-11-01 1985-06-12 TERUMO KABUSHIKI KAISHA trading as TERUMO CORPORATION Pharmaceutical composition containing urokinase
US4640835A (en) 1981-10-30 1987-02-03 Nippon Chemiphar Company, Ltd. Plasminogen activator derivatives
US4670417A (en) 1985-06-19 1987-06-02 Ajinomoto Co., Inc. Hemoglobin combined with a poly(alkylene oxide)
WO1987005330A1 (en) 1986-03-07 1987-09-11 Michel Louis Eugene Bergh Method for enhancing glycoprotein stability
WO1988007089A1 (en) 1987-03-18 1988-09-22 Medical Research Council Altered antibodies
US4791192A (en) 1986-06-26 1988-12-13 Takeda Chemical Industries, Ltd. Chemically modified protein with polyethyleneglycol
WO1996014339A1 (en) 1994-11-05 1996-05-17 The Wellcome Foundation Limited Antibodies
US5525491A (en) 1991-02-27 1996-06-11 Creative Biomolecules, Inc. Serine-rich peptide linkers
WO1996027011A1 (en) 1995-03-01 1996-09-06 Genentech, Inc. A method for making heteromultimeric polypeptides
WO1998005787A1 (en) 1996-08-02 1998-02-12 Bristol-Myers Squibb Company A method for inhibiting immunoglobulin-induced toxicity resulting from the use of immunoglobulins in therapy and in vivo diagnosis
US5739277A (en) 1995-04-14 1998-04-14 Genentech Inc. Altered polypeptides with increased half-life
WO1998023289A1 (en) 1996-11-27 1998-06-04 The General Hospital Corporation MODULATION OF IgG BINDING TO FcRn
US5834250A (en) 1988-10-28 1998-11-10 Genentech, Inc. Method for identifying active domains and amino acid residues in polypeptides and hormone variants
WO1998050431A2 (en) 1997-05-02 1998-11-12 Genentech, Inc. A method for making multispecific antibodies having heteromultimeric and common components
US5869046A (en) 1995-04-14 1999-02-09 Genentech, Inc. Altered polypeptides with increased half-life
US5876969A (en) 1992-01-31 1999-03-02 Fleer; Reinhard Fusion polypeptides comprising human serum albumin, nucleic acids encoding same, and recombinant expression thereof
WO1999025044A1 (en) 1997-11-07 1999-05-20 Nathan Cohen Microstrip patch antenna with fractal structure
US5932462A (en) 1995-01-10 1999-08-03 Shearwater Polymers, Inc. Multiarmed, monofunctional, polymer for coupling to molecules and surfaces
WO1999051642A1 (en) 1998-04-02 1999-10-14 Genentech, Inc. Antibody variants and fragments thereof
WO1999058572A1 (en) 1998-05-08 1999-11-18 Cambridge University Technical Services Limited Binding molecules derived from immunoglobulins which do not trigger complement mediated lysis
WO2000009560A2 (en) 1998-08-17 2000-02-24 Abgenix, Inc. Generation of modified molecules with increased serum half-lives
WO2000032767A1 (en) 1998-12-03 2000-06-08 MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. RECOMBINANT SOLUBLE Fc RECEPTORS
WO2000042072A2 (en) 1999-01-15 2000-07-20 Genentech, Inc. Polypeptide variants with altered effector function
US6096871A (en) 1995-04-14 2000-08-01 Genentech, Inc. Polypeptides altered to contain an epitope from the Fc region of an IgG molecule for increased half-life
US6121022A (en) 1995-04-14 2000-09-19 Genentech, Inc. Altered polypeptides with increased half-life
US6194551B1 (en) 1998-04-02 2001-02-27 Genentech, Inc. Polypeptide variants
US6242195B1 (en) 1998-04-02 2001-06-05 Genentech, Inc. Methods for determining binding of an analyte to a receptor
US6277375B1 (en) 1997-03-03 2001-08-21 Board Of Regents, The University Of Texas System Immunoglobulin-like domains with increased half-lives
WO2002044215A2 (en) 2000-12-01 2002-06-06 Cockbain, Julian Hybrid antibodies
WO2002060955A2 (en) 2001-01-29 2002-08-08 Idec Pharmaceuticals Corporation Modified antibodies and methods of use
WO2002060919A2 (en) 2000-12-12 2002-08-08 Medimmune, Inc. Molecules with extended half-lives, compositions and uses thereof
US6475983B1 (en) * 1991-04-17 2002-11-05 Medisup International N.V. Water-soluble polypeptides having a high affinity for α and β interferons
WO2002096948A2 (en) 2001-01-29 2002-12-05 Idec Pharmaceuticals Corporation Engineered tetravalent antibodies and methods of use
US6528624B1 (en) 1998-04-02 2003-03-04 Genentech, Inc. Polypeptide variants
US20030108548A1 (en) 1993-06-01 2003-06-12 Bluestone Jeffrey A. Methods and materials for modulation of the immunosuppressive activity and toxicity of monoclonal antibodies
WO2003074569A2 (en) 2002-03-01 2003-09-12 Immunomedics, Inc. Bispecific antibody point mutations for enhancing rate of clearance
US6660843B1 (en) 1998-10-23 2003-12-09 Amgen Inc. Modified peptides as therapeutic agents
WO2004016750A2 (en) 2002-08-14 2004-02-26 Macrogenics, Inc. FcϜRIIB-SPECIFIC ANTIBODIES AND METHODS OF USE THEREOF
WO2004029207A2 (en) 2002-09-27 2004-04-08 Xencor Inc. Optimized fc variants and methods for their generation
WO2004035752A2 (en) 2002-10-15 2004-04-29 Protein Design Labs, Inc. ALTERATION OF FcRn BINDING AFFINITIES OR SERUM HALF-LIVES OF ANTIBODIES BY MUTAGENESIS
US6737056B1 (en) 1999-01-15 2004-05-18 Genentech, Inc. Polypeptide variants with altered effector function
WO2004044859A1 (en) 2002-11-14 2004-05-27 Gary Michael Wilson Warning unit
WO2004063351A2 (en) 2003-01-09 2004-07-29 Macrogenics, Inc. IDENTIFICATION AND ENGINEERING OF ANTIBODIES WITH VARIANT Fc REGIONS AND METHODS OF USING SAME
WO2004074455A2 (en) 2003-02-20 2004-09-02 Applied Molecular Evolution Fc REGION VARIANTS
WO2004099249A2 (en) 2003-05-02 2004-11-18 Xencor, Inc. Optimized fc variants and methods for their generation
WO2005018572A2 (en) 2003-08-22 2005-03-03 Biogen Idec Ma Inc. Improved antibodies having altered effector function and methods for making the same
WO2005040217A2 (en) 2003-10-17 2005-05-06 Cambridge University Technical Services Limited Antibodies having a mutated amino acid residue at position 268 (ch2 region) in constant regions
WO2005047327A2 (en) 2003-11-12 2005-05-26 Biogen Idec Ma Inc. NEONATAL Fc RECEPTOR (FcRn)-BINDING POLYPEPTIDE VARIANTS, DIMERIC Fc BINDING PROTEINS AND METHODS RELATED THERETO
WO2005070963A1 (en) 2004-01-12 2005-08-04 Applied Molecular Evolution, Inc Fc region variants
WO2005077981A2 (en) 2003-12-22 2005-08-25 Xencor, Inc. Fc POLYPEPTIDES WITH NOVEL Fc LIGAND BINDING SITES
WO2005092925A2 (en) 2004-03-24 2005-10-06 Xencor, Inc. Immunoglobulin variants outside the fc region
WO2005123780A2 (en) 2004-04-09 2005-12-29 Protein Design Labs, Inc. Alteration of fcrn binding affinities or serum half-lives of antibodies by mutagenesis
WO2006019447A1 (en) 2004-07-15 2006-02-23 Xencor, Inc. Optimized fc variants
WO2006047350A2 (en) 2004-10-21 2006-05-04 Xencor, Inc. IgG IMMUNOGLOBULIN VARIANTS WITH OPTIMIZED EFFECTOR FUNCTION
WO2006085967A2 (en) 2004-07-09 2006-08-17 Xencor, Inc. OPTIMIZED ANTI-CD20 MONOCONAL ANTIBODIES HAVING Fc VARIANTS
US20060235208A1 (en) 2002-09-27 2006-10-19 Xencor, Inc. Fc variants with optimized properties
WO2006138610A2 (en) * 2005-06-17 2006-12-28 Regeneron Pharmaceuticals, Inc. Interferon-alpha/beta binding fusion proteins and therapeutic uses thereof
US7176278B2 (en) 2001-08-30 2007-02-13 Biorexis Technology, Inc. Modified transferrin fusion proteins
US20070105127A1 (en) 2000-06-28 2007-05-10 Glycofi, Inc. Method for producing modified glycoproteins
US20070111281A1 (en) 2005-05-09 2007-05-17 Glycart Biotechnology Ag Antigen binding molecules having modified Fc regions and altered binding to Fc receptors
US20070231329A1 (en) 2003-03-03 2007-10-04 Xencor, Inc. Fc Variants Having Increased Affinity for FcyRIIb
US7317091B2 (en) 2002-03-01 2008-01-08 Xencor, Inc. Optimized Fc variants
US20080057056A1 (en) 2003-03-03 2008-03-06 Xencor, Inc. Fc Variants with Increased Affinity for FcyRIIC
US20080274958A1 (en) 2006-07-21 2008-11-06 Neose Technologies, Inc. Glycosylation of peptides via o-linked glycosylation sequences
WO2009089004A1 (en) 2008-01-07 2009-07-16 Amgen Inc. Method for making antibody fc-heterodimeric molecules using electrostatic steering effects
US20090182127A1 (en) 2006-06-22 2009-07-16 Novo Nordisk A/S Production of Bispecific Antibodies
WO2011014789A1 (en) 2009-07-31 2011-02-03 Citizenglobal Inc. Systems and methods for receiving, processing and organizing of content including video
WO2011053982A2 (en) 2009-11-02 2011-05-05 University Of Washington Therapeutic nuclease compositions and methods
US20110154516A1 (en) 2007-10-15 2011-06-23 Stafford Darrel W Human factor ix variants with an extended half life
US20110171218A1 (en) 2009-12-02 2011-07-14 Acceleron Pharma Inc. Compositions and methods for increasing serum half-life
WO2011124718A1 (en) 2010-04-09 2011-10-13 Novozymes A/S Albumin derivatives and variants
US8158579B2 (en) 2006-07-24 2012-04-17 Biorexis Pharmaceutical Corporation Fusion protein of an exendin to modified transferrin
US8198063B1 (en) 2006-09-12 2012-06-12 Pro Zyme, Inc Rapid deglycosylation of glycoproteins
US20120149876A1 (en) 2010-11-05 2012-06-14 Zymeworks Inc. Stable Heterodimeric Antibody Design with Mutations in the Fc Domain
US8586713B2 (en) 2009-06-26 2013-11-19 Regeneron Pharmaceuticals, Inc. Readily isolated bispecific antibodies with native immunoglobulin format
US9300829B2 (en) 2014-04-04 2016-03-29 Canon Kabushiki Kaisha Image reading apparatus and correction method thereof
US9401875B2 (en) 2012-06-01 2016-07-26 Nippon Telegraph And Telephone Corporation Packet transfer processing method and packet transfer processing device
US9574010B2 (en) 2011-11-04 2017-02-21 Zymeworks Inc. Stable heterodimeric antibody design with mutations in the Fc domain
US20170158779A1 (en) 2012-06-25 2017-06-08 Zymeworks Inc. Process and methods for efficient manufacturing of highly pure asymmetric antibodies in mammalian cells
US20180009908A1 (en) 2015-01-22 2018-01-11 Eli Lilly And Company IgG Bispecific Antibodies and Processes for Preparation

Family Cites Families (157)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
FR2560212B1 (fr) 1984-02-24 1989-12-29 Unicet Anticorps monoclonaux contre l'interferon a2 et hybridomes produisant de tels anticorps
US4965188A (en) 1986-08-22 1990-10-23 Cetus Corporation Process for amplifying, detecting, and/or cloning nucleic acid sequences using a thermostable enzyme
US4683202A (en) 1985-03-28 1987-07-28 Cetus Corporation Process for amplifying nucleic acid sequences
US4683195A (en) 1986-01-30 1987-07-28 Cetus Corporation Process for amplifying, detecting, and/or-cloning nucleic acid sequences
US4800159A (en) 1986-02-07 1989-01-24 Cetus Corporation Process for amplifying, detecting, and/or cloning nucleic acid sequences
US5453269A (en) 1986-04-14 1995-09-26 The General Hospital Corporation Heterobifunctional antibodies having dual specificity for fibrin and thrombolylic agents and methods of use
US5559212A (en) 1988-04-06 1996-09-24 Alfacell Corporation Frog embryo and egg-derived tumor cell anti-proliferation protein
IL88377A (en) 1988-11-14 1996-09-12 Yeda Res & Dev Cloning and expression of a protein which modulates cellular response to type I interferon
US5225538A (en) 1989-02-23 1993-07-06 Genentech, Inc. Lymphocyte homing receptor/immunoglobulin fusion proteins
US5889151A (en) 1989-10-20 1999-03-30 Societe Leb-Tech Purified human alpha interferon receptor
FR2653445B1 (fr) 1989-10-20 1994-07-29 Centre Nat Rech Scient Fragment d'adnc codant pour le gene du recepteur de l'interferon alpha et procede de preparation d'une proteine correspondante.
US5840840A (en) 1990-04-17 1998-11-24 The United States Of America As Represented By The Department Of Health And Human Services Selective RNase cytotoxic reagents
US5637481A (en) 1993-02-01 1997-06-10 Bristol-Myers Squibb Company Expression vectors encoding bispecific fusion proteins and methods of producing biologically active bispecific fusion proteins in a mammalian cell
MX9204374A (es) 1991-07-25 1993-03-01 Idec Pharma Corp Anticuerpo recombinante y metodo para su produccion.
US5994514A (en) 1991-08-14 1999-11-30 Genentech, Inc. Immunoglobulin variants
DK0601052T3 (da) 1991-08-30 1996-11-18 Genentech Inc Terapeutisk fremgangsmåde til behandling af IDDM
US5470582A (en) 1992-02-07 1995-11-28 Syntex (U.S.A.) Inc. Controlled delivery of pharmaceuticals from preformed porous polymeric microparticles
EP0563487A1 (en) 1992-03-31 1993-10-06 Laboratoire Europeen De Biotechnologie S.A. Monoclonal antibodies against the interferon receptor, with neutralizing activity against type I interferon
EP0671926B1 (en) 1992-08-11 2002-11-13 President And Fellows Of Harvard College Immunomodulatory peptides
US5423269A (en) 1992-11-24 1995-06-13 Gunderson, Inc. Railroad well car body including side sill reinforcing walkway structure
GB9300686D0 (en) 1993-01-15 1993-03-03 Imp Cancer Res Tech Compounds for targeting
IL107378A (en) 1993-10-24 2005-05-17 Yeda Res & Dev SOLUBLE INTERFERON alpha-RECEPTOR, ITS PREPARATION AND USE
US6348343B2 (en) 1995-02-24 2002-02-19 Genentech, Inc. Human DNase I variants
US5780027A (en) 1995-07-14 1998-07-14 Meiogen Biotechnology Corporation Methods of treatment of down syndrome by interferon antagonists
BR9606706A (pt) 1995-10-16 1999-04-06 Unilever Nv Análogo de fragmento de anticorpo biespecífico ou bivalente uso processo para produzir o mesmo
US6482626B2 (en) 1996-02-05 2002-11-19 Genentech, Inc. Human DNase
US6716974B1 (en) 1996-05-31 2004-04-06 Maine Medical Center Research Institute Therapeutic and diagnostic methods and compositions based on jagged/notch proteins and nucleic acids
US6391607B1 (en) 1996-06-14 2002-05-21 Genentech, Inc. Human DNase I hyperactive variants
US7247302B1 (en) 1996-08-02 2007-07-24 Bristol-Myers Squibb Company Method for inhibiting immunoglobulin-induced toxicity resulting from the use of immunoglobulins in therapy and in vivo diagnosis
DK0932417T3 (da) 1996-10-17 2003-04-14 Immunomedics Inc Non-antigent toxinkonjugat og fusionsprotein af internaliserende receptorsystem
US6653104B2 (en) 1996-10-17 2003-11-25 Immunomedics, Inc. Immunotoxins, comprising an internalizing antibody, directed against malignant and normal cells
US20030068623A1 (en) 1997-06-16 2003-04-10 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
US20020192659A1 (en) 1997-09-17 2002-12-19 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
US6280991B1 (en) 1997-10-15 2001-08-28 Wisconsin Alumni Research Foundation Engineered cytotoxic ribonclease
US5840296A (en) 1997-10-15 1998-11-24 Raines; Ronald T. Engineered cytotoxic ribonuclease A
NZ504771A (en) 1997-12-19 2002-09-27 Applied Research Systems IFNAR2/ INFcomplex for prolonging the in vivo effects of type I interferon (INF)
US20030175778A1 (en) 1998-06-05 2003-09-18 Jian Ni Interferon Receptor HKAEF92
AU2342900A (en) 1998-09-23 2000-05-01 Cleveland Clinic Foundation, The Novel interferon stimulated and repressed genes
AUPP670698A0 (en) 1998-10-23 1998-11-19 Monash University A method of regulation
US6239257B1 (en) 1998-12-30 2001-05-29 Alfacell Corporation Family of proteins belonging to the pancreatic ribonuclease a superfamily
IL147270A0 (en) 1999-07-02 2002-08-14 Genentech Inc Fusion peptides comprising a peptide ligand domain and a multimerization domain
US6175003B1 (en) 1999-09-10 2001-01-16 Alfacell Corporation Nucleic acids encoding ribonucleases and methods of making them
WO2001026608A2 (en) 1999-10-14 2001-04-19 Ledbetter Jeffrey A Dna vaccines encoding antigen linked to a domain that binds cd40
WO2001077394A1 (en) 2000-04-10 2001-10-18 Mount Sinai School Of Medicine Of New York University Screening methods for identifying viral proteins with interferon antagonizing functions and potential antiviral agents
EP1351707B9 (en) 2001-01-09 2012-01-25 Baylor Research Institute Methods for treating autoimmune diseases in a subject and in vitro diagnostic assays
US20030133939A1 (en) 2001-01-17 2003-07-17 Genecraft, Inc. Binding domain-immunoglobulin fusion proteins
US7754208B2 (en) 2001-01-17 2010-07-13 Trubion Pharmaceuticals, Inc. Binding domain-immunoglobulin fusion proteins
US7829084B2 (en) 2001-01-17 2010-11-09 Trubion Pharmaceuticals, Inc. Binding constructs and methods for use thereof
US7087726B2 (en) 2001-02-22 2006-08-08 Genentech, Inc. Anti-interferon-α antibodies
RU2003129528A (ru) 2001-03-07 2005-04-10 Мерк Патент ГмбХ (DE) Способ экспрессии белков, содержащих в качестве компонента гибридный изотип антитела
JP4586310B2 (ja) 2001-07-04 2010-11-24 株式会社Ihi セラミックス複合部材の製造方法
US20060040262A1 (en) 2002-12-27 2006-02-23 Morris David W Novel compositions and methods in cancer
IL147414A0 (en) 2001-12-31 2002-08-14 Yeda Res & Dev Ifnar2 mutants, their production and use
US7662925B2 (en) 2002-03-01 2010-02-16 Xencor, Inc. Optimized Fc variants and methods for their generation
US20060240419A1 (en) 2002-05-17 2006-10-26 Yusuke Nakamura Method of detecting gene polymorphism
CA2489446A1 (en) 2002-06-14 2003-12-24 Wisconsin Alumni Research Foundation Ribonuclease zymogen design
EP1578367A4 (en) 2002-11-01 2012-05-02 Genentech Inc COMPOSITIONS AND METHODS FOR THE TREATMENT OF IMMUNE DISEASES
US7067298B2 (en) 2003-03-31 2006-06-27 Ambion, Inc. Compositions and methods of using a synthetic Dnase I
US7666417B2 (en) 2003-04-22 2010-02-23 Fred Hutchinson Cancer Research Center Methods and compositions for treating autoimmune diseases or conditions
AU2004232362C1 (en) 2003-04-23 2008-05-29 E. R. Squibb & Sons, L.L.C. Compositions and methods for the therapy of inflammatory bowel disease
US9051373B2 (en) 2003-05-02 2015-06-09 Xencor, Inc. Optimized Fc variants
US20040266993A1 (en) 2003-06-30 2004-12-30 Evans Glen A. Non-immunoglobulin binding polypeptides
US7754209B2 (en) 2003-07-26 2010-07-13 Trubion Pharmaceuticals Binding constructs and methods for use thereof
PT1675956E (pt) 2003-10-21 2010-11-04 Merck Serono Sa Sequência mínima de adn que actua como um isolador de cromatina e sua utilização na expressão de proteína
US9296820B2 (en) 2003-11-05 2016-03-29 Roche Glycart Ag Polynucleotides encoding anti-CD20 antigen binding molecules with increased Fc receptor binding affinity and effector function
WO2005063815A2 (en) 2003-11-12 2005-07-14 Biogen Idec Ma Inc. Fcϝ receptor-binding polypeptide variants and methods related thereto
RU2370276C2 (ru) 2003-12-31 2009-10-20 Мерк Патент Гмбх Fc-ЭРИТРОПОЭТИН СЛИТЫЙ БЕЛОК С УЛУЧШЕННОЙ ФАРМАКОКИНЕТИКОЙ
US7544487B2 (en) 2004-02-13 2009-06-09 Immunomedics, Inc. Fusion proteins containing recombinant cytotoxic RNAses
JP2008505853A (ja) 2004-04-13 2008-02-28 クインテセンス バイオサイエンシーズ インコーポレーティッド 細胞傷害性薬剤としての非天然のリボヌクレアーゼ複合体
AU2005334481A1 (en) 2004-08-11 2007-01-25 Trubion Pharmaceuticals, Inc. Binding domain fusion proteins
JP2006071409A (ja) 2004-09-01 2006-03-16 Kansai Tlo Kk シェーグレン症候群診断キット
US20060074225A1 (en) 2004-09-14 2006-04-06 Xencor, Inc. Monomeric immunoglobulin Fc domains
CN101056654A (zh) 2004-10-07 2007-10-17 苏黎士大学 用于预防和治疗银屑病的i型干扰素阻断剂
DE102005009219A1 (de) 2005-02-25 2006-08-31 Martin-Luther-Universität Halle-Wittenberg Ribonuclease-Tandemenzyme und Verfahren zu ihrer Herstellung
US20110123440A1 (en) 2005-03-29 2011-05-26 Genevieve Hansen Altered Antibody FC Regions and Uses Thereof
EP1896579A2 (en) 2005-06-16 2008-03-12 Wisconsin Alumni Research Foundation Cytotoxic ribonuclease variants
EP1910541B1 (en) 2005-06-16 2010-10-20 Wisconsin Alumni Research Foundation Cytotoxic ribonuclease variants
RU2423381C2 (ru) 2005-07-25 2011-07-10 Трабьон Фармасьютикалз, Инк. Снижение количества в-клеток с использованием cd37-специфических и cd20-специфических связывающих молекул
US20080279850A1 (en) 2005-07-25 2008-11-13 Trubion Pharmaceuticals, Inc. B-Cell Reduction Using CD37-Specific and CD20-Specific Binding Molecules
US8980246B2 (en) 2005-09-07 2015-03-17 Sillajen Biotherapeutics, Inc. Oncolytic vaccinia virus cancer therapy
US7608395B2 (en) 2005-09-15 2009-10-27 Baylor Research Institute Systemic lupus erythematosus diagnostic assay
US9168286B2 (en) 2005-10-13 2015-10-27 Human Genome Sciences, Inc. Methods and compositions for use in treatment of patients with autoantibody positive disease
US7807409B2 (en) 2005-10-21 2010-10-05 Roche Palo Alto Llc Method for the recombinant expression of a polypeptide
WO2007084992A2 (en) 2006-01-19 2007-07-26 The University Of Chicago Prognosis and therapy predictive markers and methods of use
PT1999154E (pt) 2006-03-24 2013-01-24 Merck Patent Gmbh Domínios proteicos heterodiméricos modificados
AU2007238034A1 (en) 2006-04-14 2007-10-25 Trubion Pharmaceuticals Inc. Binding proteins comprising immunoglobulin hinge and Fc regions having altered Fc effector functions
US20100015661A1 (en) 2006-04-21 2010-01-21 Mab-Factory Gmbh Antibody-rnase-conjugate
WO2007136789A2 (en) 2006-05-19 2007-11-29 Medimmune, Inc. Methods of preventing, treating or ameliorating enhanced respiratory disease via innate immune mechanisms
GB0611444D0 (en) 2006-06-09 2006-07-19 Medical Res Council Technology Rnase H2 complex and genes therefor
NZ573646A (en) 2006-06-12 2012-04-27 Wyeth Llc Single-chain multivalent binding proteins with effector function
EP1905841A1 (en) 2006-09-25 2008-04-02 Max Delbrück Centrum für Molekulare Medizin (MDC) Berlin-Buch; Trex1 as a marker for lupus erythematosus
WO2008066774A2 (en) 2006-11-22 2008-06-05 The Regents Of The University Of California INTERFERON-β PRODUCTION MODULATING LISTERIA STRAINS AND METHODS FOR USING SAME
EP2144930A1 (en) 2007-04-18 2010-01-20 ZymoGenetics, Inc. Single chain fc, methods of making and methods of treatment
CA2686861A1 (en) 2007-05-03 2008-11-13 Medimmune, Llc Interferon alpha-induced pharmacodynamic markers
EP2158318A2 (en) 2007-05-14 2010-03-03 Biogen Idec MA, Inc. Single-chain fc (scfc) regions, binding polypeptides comprising same, and methods related thereto
US20090258005A1 (en) 2007-05-29 2009-10-15 Trubion Pharmaceuticals Inc. Therapeutic compositions and methods
JP2010531137A (ja) 2007-06-12 2010-09-24 ワイス・エルエルシー 抗cd20治療用組成物および方法
JP2010532764A (ja) 2007-07-06 2010-10-14 トゥルビオン・ファーマシューティカルズ・インコーポレーテッド C末端に配置された特異的結合性ドメインを有する結合性ペプチド
WO2009015345A1 (en) 2007-07-25 2009-01-29 Amgen Inc. Pharmaceutical compositions comprising fc fusion proteins
BRPI0814465B1 (pt) 2007-07-26 2021-11-23 Novagen Holding Corporation Proteína de fusão, dímero, método para produzir uma proteína de fusão, linhagem de célula, usos de uma proteína de fusão e de uma composição farmacêutica e composição farmacêutica
CA2705542A1 (en) 2007-11-13 2009-05-22 Sapphire Energy, Inc. Production of fc-fusion polypeptides in eukaryotic algae
RU2531754C2 (ru) 2008-04-11 2014-10-27 ЭМЕРДЖЕНТ ПРОДАКТ ДИВЕЛОПМЕНТ СИЭТЛ,ЭлЭлСи,US Связывающееся с cd37 иммунотерапевтическое средство и его комбинация с бифункциональным химиотерапевтическим средством
MX2011000861A (es) 2008-07-23 2011-06-21 Hanmi Holdings Co Ltd Un complejo polipeptidico que consiste en un polimero no-peptidil que posee tres terminaciones funcionales.
CN102224258A (zh) 2008-09-26 2011-10-19 弗·哈夫曼-拉罗切有限公司 用于治疗、诊断和监测狼疮的方法
BRPI0920743A2 (pt) 2008-10-01 2016-09-20 Quintessence Biosciences Inc ribonucleases terapeuticas
WO2010123501A1 (en) 2009-04-22 2010-10-28 Massachusetts Institute Of Technology Innate immune suppression enables repeated delivery of long rna molecules
US10837020B2 (en) 2009-04-22 2020-11-17 Massachusetts Institute Of Technology Innate immune suppression enables repeated delivery of long RNA molecules
EP3248618A1 (en) 2009-04-22 2017-11-29 Massachusetts Institute Of Technology Innate immune suppression enables repeated delivery of long rna molecules
ES2602971T3 (es) 2010-03-02 2017-02-23 Kyowa Hakko Kirin Co., Ltd. Composición de anticuerpo modificado
HRP20241208T1 (hr) 2010-04-20 2024-11-22 Genmab A/S Heterodimerni proteini koji sadrže fc fragment protutijela i postupci za njihovu proizvodnju
SMT202000031T1 (it) 2010-06-09 2020-03-13 Genmab As Anticorpi contro cd38 umano
JP2013537416A (ja) 2010-08-13 2013-10-03 メディミューン リミテッド 変異型Fc領域を含むモノマーポリペプチド及び使用方法
TWI452136B (zh) 2010-11-17 2014-09-11 中外製藥股份有限公司 A multiple specific antigen-binding molecule that replaces the function of Factor VIII in blood coagulation
WO2012068630A1 (en) 2010-11-26 2012-05-31 The University Of Melbourne Methods and compositions comprising antagonists of type 1 interferon-mediated signalling for reducing a neuroinflammatory response in the central nervous system following a stroke
US20120201746A1 (en) 2010-12-22 2012-08-09 Abbott Laboratories Half immunoglobulin binding proteins and uses thereof
TWI529163B (zh) 2011-01-25 2016-04-11 陶氏農業科學公司 用於製備4-胺基-5-氟-3-鹵素-6-(經取代之)吡啶甲酸酯的方法
WO2012104344A1 (en) 2011-02-01 2012-08-09 Genmab A/S Human antibodies and antibody-drug conjugates against cd74
EA201370187A1 (ru) 2011-02-23 2013-12-30 Амген Инк. Клеточная культуральная среда для уфс воздействия и относящиеся к ней способы
MX363013B (es) 2011-02-25 2019-03-04 Recombinetics Inc Animales genéticamente modificados y métodos para su obtención.
AU2012245116A1 (en) 2011-04-20 2013-11-07 Genmab A/S Bispecific antibodies against HER2 and CD3
US20140170148A1 (en) 2011-04-20 2014-06-19 Genmab A/S Bispecific antibodies against her2
CN103796678B (zh) 2011-04-20 2018-02-27 健玛保 针对her2的双特异性抗体
RS61447B1 (sr) 2011-04-21 2021-03-31 Glaxo Group Ltd Modulacija ekspresije virusa hepatitisa b (hbv)
ES2666303T3 (es) 2011-04-29 2018-05-03 University Of Washington Composiciones terapéuticas de nucleasa y métodos
WO2013003475A1 (en) 2011-06-27 2013-01-03 Cellscript, Inc. Inhibition of innate immune response
US20140178479A1 (en) 2011-08-12 2014-06-26 Perosphere, Inc. Concentrated Felbamate Formulations for Parenteral Administration
WO2013059299A1 (en) 2011-10-17 2013-04-25 The Uab Research Foundation Antibodies for interferon subtypes and interferon/interferon receptor ternary complex and uses thereof
SG11201401422VA (en) 2011-10-27 2014-09-26 Genmab As Production of heterodimeric proteins
AU2013258834B2 (en) 2012-05-10 2017-09-07 Zymeworks Bc Inc. Heteromultimer constructs of immunoglobulin heavy chains with mutations in the Fc domain
KR102320059B1 (ko) 2012-06-13 2021-11-01 아스트라제네카 아베 항-i형 인터페론 수용체(ifnar) 항체에 대한 고정 투여 계획
GB2503883A (en) 2012-07-09 2014-01-15 King S College London Variant IgE with reduced affinity to CD23
AU2013289883B2 (en) 2012-07-13 2018-11-01 Zymeworks Bc Inc. Bispecific asymmetric heterodimers comprising anti-CD3 constructs
UY35148A (es) 2012-11-21 2014-05-30 Amgen Inc Immunoglobulinas heterodiméricas
US10150800B2 (en) * 2013-03-15 2018-12-11 Zyngenia, Inc. EGFR-binding modular recognition domains
ES2821753T3 (es) 2013-03-15 2021-04-27 Lilly Co Eli Procedimientos de producción de Fab y de anticuerpos biespecíficos
US9861681B2 (en) 2013-04-18 2018-01-09 The United States of America as represented by the Secretary of the Army, on behalf of the United States Army Medical Research Institute of Infectious Diseases Therapeutic compositions for neutralizing type I interferons, and methods of use
HUE056580T2 (hu) * 2013-05-30 2022-02-28 Kiniksa Pharmaceuticals Ltd Onkosztatin-M-receptor antigénjét kötõ fehérjék
KR102332303B1 (ko) 2013-05-31 2021-11-26 자임워크스 인코포레이티드 감소되거나 침묵화된 효과기 기능을 갖는 이종다량체
HRP20192080T1 (hr) 2013-10-31 2020-02-07 Resolve Therapeutics, Llc Terapeutske fuzije nukleaza-albumine i postupci
CN113248613B (zh) * 2014-01-15 2024-08-23 豪夫迈·罗氏有限公司 具有修饰的FCRN结合性质的Fc区变体
KR20150140177A (ko) 2014-06-05 2015-12-15 한미약품 주식회사 단백질 및 펩타이드의 면역원성을 감소시키는 방법
WO2016069889A1 (en) 2014-10-31 2016-05-06 Resolve Therapeutics, Llc Therapeutic nuclease-transferrin fusions and methods
WO2016087650A1 (en) 2014-12-05 2016-06-09 Merck Patent Gmbh Domain-exchanged antibody
WO2016087648A1 (en) 2014-12-05 2016-06-09 Universität Für Bodenkultur Wien Immunoglobulins with incorporated heterologous ch3 domains resulting in a prolonged half-life
ES3057390T3 (en) 2015-05-13 2026-03-02 Zymeworks Bc Inc Antigen-binding constructs targeting her2
CN106883297B (zh) * 2015-12-16 2019-12-13 苏州康宁杰瑞生物科技有限公司 基于ch3结构域的异二聚体分子、其制备方法及用途
CN107007606B (zh) 2016-02-04 2021-10-26 南京舒鹏生物科技有限公司 一种用于干燥综合症预防及治疗的药物及其组合
WO2017165464A1 (en) 2016-03-21 2017-09-28 Elstar Therapeutics, Inc. Multispecific and multifunctional molecules and uses thereof
US20200297862A1 (en) 2016-04-25 2020-09-24 Zymeworks Inc. Methods of using bispecific antigen-binding constructs targeting her2
CA2965652A1 (en) 2016-04-29 2017-10-29 Pfizer Inc. Interferon beta antibodies
CA3029627A1 (en) 2016-07-01 2018-01-04 Resolve Therapeutics, Llc Optimized binuclease fusions and methods
WO2018037092A1 (en) 2016-08-26 2018-03-01 Sanofi Multispecific antibodies facilitating selective light chain pairing
US10072296B2 (en) 2016-09-19 2018-09-11 The Charlotte Mecklenburg Hospital Authority Compositions and methods for sjögren's syndrome
JP6349003B1 (ja) 2017-03-17 2018-06-27 東洋ビーネット株式会社 耐熱性ルシフェラーゼ
CA3073537A1 (en) 2017-08-22 2019-02-28 Sanabio, Llc Soluble interferon receptors and uses thereof
WO2020142740A1 (en) 2019-01-04 2020-07-09 Resolve Therapeutics, Llc Treatment of sjogren's disease with nuclease fusion proteins
CA3165342A1 (en) 2020-06-29 2022-01-06 James Arthur Posada Treatment of sjogren's syndrome with nuclease fusion proteins

Patent Citations (104)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3773919A (en) 1969-10-23 1973-11-20 Du Pont Polylactide-drug mixtures
US4179337A (en) 1973-07-20 1979-12-18 Davis Frank F Non-immunogenic polypeptides
US3941763A (en) 1975-03-28 1976-03-02 American Home Products Corporation PGlu-D-Met-Trp-Ser-Tyr-D-Ala-Leu-Arg-Pro-Gly-NH2 and intermediates
EP0036676A1 (en) 1978-03-24 1981-09-30 The Regents Of The University Of California Method of making uniformly sized liposomes and liposomes so made
US4301144A (en) 1979-07-11 1981-11-17 Ajinomoto Company, Incorporated Blood substitute containing modified hemoglobin
EP0058481A1 (en) 1981-02-16 1982-08-25 Zeneca Limited Continuous release pharmaceutical compositions
US4640835A (en) 1981-10-30 1987-02-03 Nippon Chemiphar Company, Ltd. Plasminogen activator derivatives
EP0088046A2 (de) 1982-02-17 1983-09-07 Ciba-Geigy Ag Lipide in wässriger Phase
EP0133988A2 (de) 1983-08-02 1985-03-13 Hoechst Aktiengesellschaft Regulatorische Peptide enthaltende pharmazeutische Präparate mit protrahierter Freisetzung und Verfahren zu deren Herstellung
EP0143949A1 (en) 1983-11-01 1985-06-12 TERUMO KABUSHIKI KAISHA trading as TERUMO CORPORATION Pharmaceutical composition containing urokinase
US4496689A (en) 1983-12-27 1985-01-29 Miles Laboratories, Inc. Covalently attached complex of alpha-1-proteinase inhibitor with a water soluble polymer
US4670417A (en) 1985-06-19 1987-06-02 Ajinomoto Co., Inc. Hemoglobin combined with a poly(alkylene oxide)
WO1987005330A1 (en) 1986-03-07 1987-09-11 Michel Louis Eugene Bergh Method for enhancing glycoprotein stability
US4791192A (en) 1986-06-26 1988-12-13 Takeda Chemical Industries, Ltd. Chemically modified protein with polyethyleneglycol
US5648260A (en) 1987-03-18 1997-07-15 Scotgen Biopharmaceuticals Incorporated DNA encoding antibodies with altered effector functions
WO1988007089A1 (en) 1987-03-18 1988-09-22 Medical Research Council Altered antibodies
US5624821A (en) 1987-03-18 1997-04-29 Scotgen Biopharmaceuticals Incorporated Antibodies with altered effector functions
US5834250A (en) 1988-10-28 1998-11-10 Genentech, Inc. Method for identifying active domains and amino acid residues in polypeptides and hormone variants
US5525491A (en) 1991-02-27 1996-06-11 Creative Biomolecules, Inc. Serine-rich peptide linkers
US6475983B1 (en) * 1991-04-17 2002-11-05 Medisup International N.V. Water-soluble polypeptides having a high affinity for α and β interferons
US5876969A (en) 1992-01-31 1999-03-02 Fleer; Reinhard Fusion polypeptides comprising human serum albumin, nucleic acids encoding same, and recombinant expression thereof
US20030108548A1 (en) 1993-06-01 2003-06-12 Bluestone Jeffrey A. Methods and materials for modulation of the immunosuppressive activity and toxicity of monoclonal antibodies
WO1996014339A1 (en) 1994-11-05 1996-05-17 The Wellcome Foundation Limited Antibodies
US5932462A (en) 1995-01-10 1999-08-03 Shearwater Polymers, Inc. Multiarmed, monofunctional, polymer for coupling to molecules and surfaces
US5731168A (en) 1995-03-01 1998-03-24 Genentech, Inc. Method for making heteromultimeric polypeptides
WO1996027011A1 (en) 1995-03-01 1996-09-06 Genentech, Inc. A method for making heteromultimeric polypeptides
US5869046A (en) 1995-04-14 1999-02-09 Genentech, Inc. Altered polypeptides with increased half-life
US5739277A (en) 1995-04-14 1998-04-14 Genentech Inc. Altered polypeptides with increased half-life
US6998253B1 (en) 1995-04-14 2006-02-14 Genentech, Inc. Altered polypeptides with increased half-life
US6121022A (en) 1995-04-14 2000-09-19 Genentech, Inc. Altered polypeptides with increased half-life
US6096871A (en) 1995-04-14 2000-08-01 Genentech, Inc. Polypeptides altered to contain an epitope from the Fc region of an IgG molecule for increased half-life
WO1998005787A1 (en) 1996-08-02 1998-02-12 Bristol-Myers Squibb Company A method for inhibiting immunoglobulin-induced toxicity resulting from the use of immunoglobulins in therapy and in vivo diagnosis
WO1998023289A1 (en) 1996-11-27 1998-06-04 The General Hospital Corporation MODULATION OF IgG BINDING TO FcRn
US6821505B2 (en) 1997-03-03 2004-11-23 Board Of Regents, The University Of Texas System Immunoglobin-like domains with increased half lives
US6277375B1 (en) 1997-03-03 2001-08-21 Board Of Regents, The University Of Texas System Immunoglobulin-like domains with increased half-lives
WO1998050431A2 (en) 1997-05-02 1998-11-12 Genentech, Inc. A method for making multispecific antibodies having heteromultimeric and common components
US20070178552A1 (en) 1997-05-02 2007-08-02 Genentech, Inc. Method for Making Multispecific Antibodies Having Heteromultimeric and Common Components
WO1999025044A1 (en) 1997-11-07 1999-05-20 Nathan Cohen Microstrip patch antenna with fractal structure
WO1999051642A1 (en) 1998-04-02 1999-10-14 Genentech, Inc. Antibody variants and fragments thereof
US6242195B1 (en) 1998-04-02 2001-06-05 Genentech, Inc. Methods for determining binding of an analyte to a receptor
US6194551B1 (en) 1998-04-02 2001-02-27 Genentech, Inc. Polypeptide variants
US6528624B1 (en) 1998-04-02 2003-03-04 Genentech, Inc. Polypeptide variants
US6538124B1 (en) 1998-04-02 2003-03-25 Genentech, Inc. Polypeptide variants
WO1999058572A1 (en) 1998-05-08 1999-11-18 Cambridge University Technical Services Limited Binding molecules derived from immunoglobulins which do not trigger complement mediated lysis
WO2000009560A2 (en) 1998-08-17 2000-02-24 Abgenix, Inc. Generation of modified molecules with increased serum half-lives
US6660843B1 (en) 1998-10-23 2003-12-09 Amgen Inc. Modified peptides as therapeutic agents
WO2000032767A1 (en) 1998-12-03 2000-06-08 MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. RECOMBINANT SOLUBLE Fc RECEPTORS
WO2000042072A2 (en) 1999-01-15 2000-07-20 Genentech, Inc. Polypeptide variants with altered effector function
US6737056B1 (en) 1999-01-15 2004-05-18 Genentech, Inc. Polypeptide variants with altered effector function
US20070105127A1 (en) 2000-06-28 2007-05-10 Glycofi, Inc. Method for producing modified glycoproteins
WO2002044215A2 (en) 2000-12-01 2002-06-06 Cockbain, Julian Hybrid antibodies
WO2002060919A2 (en) 2000-12-12 2002-08-08 Medimmune, Inc. Molecules with extended half-lives, compositions and uses thereof
US7083784B2 (en) 2000-12-12 2006-08-01 Medimmune, Inc. Molecules with extended half-lives, compositions and uses thereof
WO2002096948A2 (en) 2001-01-29 2002-12-05 Idec Pharmaceuticals Corporation Engineered tetravalent antibodies and methods of use
WO2002060955A2 (en) 2001-01-29 2002-08-08 Idec Pharmaceuticals Corporation Modified antibodies and methods of use
US7176278B2 (en) 2001-08-30 2007-02-13 Biorexis Technology, Inc. Modified transferrin fusion proteins
US7317091B2 (en) 2002-03-01 2008-01-08 Xencor, Inc. Optimized Fc variants
WO2003074569A2 (en) 2002-03-01 2003-09-12 Immunomedics, Inc. Bispecific antibody point mutations for enhancing rate of clearance
WO2004016750A2 (en) 2002-08-14 2004-02-26 Macrogenics, Inc. FcϜRIIB-SPECIFIC ANTIBODIES AND METHODS OF USE THEREOF
WO2004029207A2 (en) 2002-09-27 2004-04-08 Xencor Inc. Optimized fc variants and methods for their generation
US20060235208A1 (en) 2002-09-27 2006-10-19 Xencor, Inc. Fc variants with optimized properties
WO2004035752A2 (en) 2002-10-15 2004-04-29 Protein Design Labs, Inc. ALTERATION OF FcRn BINDING AFFINITIES OR SERUM HALF-LIVES OF ANTIBODIES BY MUTAGENESIS
WO2004044859A1 (en) 2002-11-14 2004-05-27 Gary Michael Wilson Warning unit
WO2004063351A2 (en) 2003-01-09 2004-07-29 Macrogenics, Inc. IDENTIFICATION AND ENGINEERING OF ANTIBODIES WITH VARIANT Fc REGIONS AND METHODS OF USING SAME
WO2004074455A2 (en) 2003-02-20 2004-09-02 Applied Molecular Evolution Fc REGION VARIANTS
US20070248603A1 (en) 2003-03-03 2007-10-25 Xencor, Inc. Fc Variants with Increased Affinity for FcyRlla
US20070231329A1 (en) 2003-03-03 2007-10-04 Xencor, Inc. Fc Variants Having Increased Affinity for FcyRIIb
US20070286859A1 (en) 2003-03-03 2007-12-13 Xencor, Inc. Fc Variants Having Decreased Affinity for FcyRl
US20070243188A1 (en) 2003-03-03 2007-10-18 Xencor, Inc. Fc Variants Having Decreased Affinity for FcyRlla
US20070237766A1 (en) 2003-03-03 2007-10-11 Xencor, Inc. Fc Variants Having Increased Affinity for FcyRllla
US20080057056A1 (en) 2003-03-03 2008-03-06 Xencor, Inc. Fc Variants with Increased Affinity for FcyRIIC
US20070237765A1 (en) 2003-03-03 2007-10-11 Xencor, Inc. Fc Variants Having Increased Affinity for FcyRl
US20070237767A1 (en) 2003-03-03 2007-10-11 Xencor, Inc. Fc Variants Having Decreased Affinity for FcyRllla
WO2004099249A2 (en) 2003-05-02 2004-11-18 Xencor, Inc. Optimized fc variants and methods for their generation
WO2005018572A2 (en) 2003-08-22 2005-03-03 Biogen Idec Ma Inc. Improved antibodies having altered effector function and methods for making the same
WO2005040217A2 (en) 2003-10-17 2005-05-06 Cambridge University Technical Services Limited Antibodies having a mutated amino acid residue at position 268 (ch2 region) in constant regions
WO2005047327A2 (en) 2003-11-12 2005-05-26 Biogen Idec Ma Inc. NEONATAL Fc RECEPTOR (FcRn)-BINDING POLYPEPTIDE VARIANTS, DIMERIC Fc BINDING PROTEINS AND METHODS RELATED THERETO
WO2005077981A2 (en) 2003-12-22 2005-08-25 Xencor, Inc. Fc POLYPEPTIDES WITH NOVEL Fc LIGAND BINDING SITES
WO2005070963A1 (en) 2004-01-12 2005-08-04 Applied Molecular Evolution, Inc Fc region variants
WO2005092925A2 (en) 2004-03-24 2005-10-06 Xencor, Inc. Immunoglobulin variants outside the fc region
WO2005123780A2 (en) 2004-04-09 2005-12-29 Protein Design Labs, Inc. Alteration of fcrn binding affinities or serum half-lives of antibodies by mutagenesis
WO2006085967A2 (en) 2004-07-09 2006-08-17 Xencor, Inc. OPTIMIZED ANTI-CD20 MONOCONAL ANTIBODIES HAVING Fc VARIANTS
WO2006019447A1 (en) 2004-07-15 2006-02-23 Xencor, Inc. Optimized fc variants
WO2006047350A2 (en) 2004-10-21 2006-05-04 Xencor, Inc. IgG IMMUNOGLOBULIN VARIANTS WITH OPTIMIZED EFFECTOR FUNCTION
US20070111281A1 (en) 2005-05-09 2007-05-17 Glycart Biotechnology Ag Antigen binding molecules having modified Fc regions and altered binding to Fc receptors
WO2006138610A2 (en) * 2005-06-17 2006-12-28 Regeneron Pharmaceuticals, Inc. Interferon-alpha/beta binding fusion proteins and therapeutic uses thereof
US20090182127A1 (en) 2006-06-22 2009-07-16 Novo Nordisk A/S Production of Bispecific Antibodies
US20080274958A1 (en) 2006-07-21 2008-11-06 Neose Technologies, Inc. Glycosylation of peptides via o-linked glycosylation sequences
US8158579B2 (en) 2006-07-24 2012-04-17 Biorexis Pharmaceutical Corporation Fusion protein of an exendin to modified transferrin
US8198063B1 (en) 2006-09-12 2012-06-12 Pro Zyme, Inc Rapid deglycosylation of glycoproteins
US20110154516A1 (en) 2007-10-15 2011-06-23 Stafford Darrel W Human factor ix variants with an extended half life
WO2009089004A1 (en) 2008-01-07 2009-07-16 Amgen Inc. Method for making antibody fc-heterodimeric molecules using electrostatic steering effects
US8586713B2 (en) 2009-06-26 2013-11-19 Regeneron Pharmaceuticals, Inc. Readily isolated bispecific antibodies with native immunoglobulin format
WO2011014789A1 (en) 2009-07-31 2011-02-03 Citizenglobal Inc. Systems and methods for receiving, processing and organizing of content including video
WO2011053982A2 (en) 2009-11-02 2011-05-05 University Of Washington Therapeutic nuclease compositions and methods
US20110171218A1 (en) 2009-12-02 2011-07-14 Acceleron Pharma Inc. Compositions and methods for increasing serum half-life
WO2011124718A1 (en) 2010-04-09 2011-10-13 Novozymes A/S Albumin derivatives and variants
US20120149876A1 (en) 2010-11-05 2012-06-14 Zymeworks Inc. Stable Heterodimeric Antibody Design with Mutations in the Fc Domain
US9562109B2 (en) 2010-11-05 2017-02-07 Zymeworks Inc. Stable heterodimeric antibody design with mutations in the Fc domain
US9574010B2 (en) 2011-11-04 2017-02-21 Zymeworks Inc. Stable heterodimeric antibody design with mutations in the Fc domain
US9401875B2 (en) 2012-06-01 2016-07-26 Nippon Telegraph And Telephone Corporation Packet transfer processing method and packet transfer processing device
US20170158779A1 (en) 2012-06-25 2017-06-08 Zymeworks Inc. Process and methods for efficient manufacturing of highly pure asymmetric antibodies in mammalian cells
US9300829B2 (en) 2014-04-04 2016-03-29 Canon Kabushiki Kaisha Image reading apparatus and correction method thereof
US20180009908A1 (en) 2015-01-22 2018-01-11 Eli Lilly And Company IgG Bispecific Antibodies and Processes for Preparation

Non-Patent Citations (95)

* Cited by examiner, † Cited by third party
Title
"Methods In Enzymology", ACADEMIC PRESS, INC.
"Remington's Pharmaceutical Sciences", 1990, MACK PUBLISHING COMPANY
"Remington's Pharmaceutical Sciences", 1995, MACK PUBLISHING COMPANY
"Sequences of Proteins of Immunological Interest (Table of Contents, Introduction and Constant Region Sequences sections", vol. 1, 1991, NIH, pages: 647 - 723
A.L. LEHNINGER: "Biochemistry", WORTH PUBLISHERS, INC.
ACHORD ET AL., CELL, vol. 15, 1978, pages 269 - 78
ACHORD ET AL., PEDIAT. RES, vol. 11, 1977, pages 816 - 22
ALTSCHUL ET AL., J MOL BIOL, vol. 215, 1990, pages 403 - 10
APLIN ET AL., CRC CRIT REV BIOCHEM, 1981, pages 259 - 306
ARAI ET AL., PROTEIN ENG, vol. 14, 2001, pages 529 - 32
ASHLESHA DESHPANDE ET AL: "Kinetic analysis of cytokine-mediated receptor assembly using engineered FC heterodimers", PROTEIN SCIENCE, WILEY, US, vol. 22, no. 8, 1 August 2013 (2013-08-01), pages 1100 - 1108, XP002745726, ISSN: 0961-8368, [retrieved on 20130606], DOI: 10.1002/PRO.2285 *
ATWELL ET AL., J. MOL. BIOL., vol. 270, 1997, pages 26 - 35
BATZER ET AL., NUCLEIC ACID RES, vol. 19, 1991, pages 5081
BENNETT ET AL., J. EXP. MED., vol. 197, no. 6, March 2003 (2003-03-01), pages 711 - 723
CAREY; SUNDBERG: "Advanced Organic Chemistry", vol. A and B, 1992, PLENUM PRESS
CHEN ET AL., MOL PHARM, vol. 8, 2011, pages 457 - 65
CHOTHIA ET AL., NATURE, vol. 342, 1989, pages 878 - 883
CHOTHIA; LESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917
CONRAD: "Curr Protoc Mol Biol", 2001
CROUSE ET AL., NAT REV IMMUNOL, vol. 15, 2015, pages 231 - 242
CURTSINGER ET AL., J IMMUNOL, vol. 174, 2005, pages 4465 - 4469
DAVIS ET AL., BIOCHEM INTL, vol. 10, 1985, pages 394 - 414
DAVIS ET AL., PROTEIN ENG. DES. SEL., vol. 23, 2010, pages 195 - 202
DEWEERD ET AL., J. BIOL. CHEM., vol. 282, no. 28, 2007, pages 20053 - 20057
DEWEERD ET AL.: "Type I Interferon Receptors: Biochemistry and Biological Functions", J. OF BIOL. CHEM., vol. 282, no. 28, 2007, pages 20053 - 20057, XP055395926, DOI: doi:10.1074/jbc.R700006200
DOEDENS ET AL., J. IMMUNOL., 17 August 2016 (2016-08-17)
EPPSTEIN ET AL., PNAS, vol. 82, 1985, pages 3688 - 3692
ERICKSON ET AL., THE PROTEINS, vol. 2, 1976, pages 257 - 527
FINN ET AL.: "The Proteins", vol. 2, 1976, pages: 105 - 253
FUKUDA: "Curr Protoc Mol Biol", 2001
FURIE ET AL., ARTHRITIS & RHEUMATOLOGY, vol. 69, no. 2, February 2017 (2017-02-01), pages 376 - 386
GEORGE ET AL., PROTEIN ENGINEERING, vol. 15, 2002, pages 871 - 9
GUNASEKARAN ET AL., J. BIOL. CHEM., vol. 285, 2010, pages 19637 - 19646
GUNASEKARAN, K. ET AL., J. BIOL. CHEM., vol. 285, 2010, pages 19637 - 196zL6
HICKMAN ET AL., BBRC, vol. 57, 1974, pages 55 - 61
HOUBA ET AL., BIOCONJUG CHEM, vol. 7, 1996, pages 606 - 11
HUANG ET AL., RAPID COMMUNICATIONS IN MASS SPECTROMETRY, vol. 16, 2002, pages 1199 - 204
IVASHKIV; DONLIN, NAT REV IMMUNOL, vol. 14, no. 1, 2014, pages 36 - 49
JI-HEE HA ET AL: "Immunoglobulin Fc Heterodimer Platform Technology: From Design to Applications in Therapeutic Antibodies and Proteins", FRONTIERS IN IMMUNOLOGY, vol. 7, 6 October 2016 (2016-10-06), pages 1 - 16, XP055377975, DOI: 10.3389/fimmu.2016.00394 *
KABAT ET AL.: "Sequences of Proteins of Immunological Interest", vol. l, 1991, US DEPT OF HEALTH AND HUMAN SERVICES, NIH, article "Introduction", pages: xiii - xcvi
KENNEDY ET AL., LUPUS SCIENCE AND MEDICINE, vol. 2, 2015, pages e000080
KENNEDY ET AL., LUPUS SCIENCE AND MEDICINE, vol. 2, 2015, pages e00080
KENNEDY ET AL., SCIENCE AND MEDICINE, vol. 2, 2015, pages e00080
KHAMASHTA ET AL., ANN RHEUM DIS, vol. 0, 2016, pages 1 - 8
KOLUMAM ET AL., J EXP MED, vol. 202, 2005, pages 637 - 650
KREUDENSTEIN ET AL., MABS, vol. 5, no. 5, September 2013 (2013-09-01), pages 646 - 654
KREUDENSTEIN ET AL., MABS, vol. 5, no. 5, September 2016 (2016-09-01), pages 646 - 654
KREUDENSTEIN, T.S. ET AL., MABS, vol. 5, 2013, pages 646 - 654
LABRIJN ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 110, 2013, pages 5145 - 5150
LANGER ET AL., J BIOMED MATER RES, vol. 15, 1981, pages 167 - 277
LANGER, CHEM TECH, vol. 12, 1982, pages 98 - 105
LE BON ET AL., J IMMUNOL, vol. 176, no. 4, 2006, pages 2074 - 2078
LEWIS ET AL., NATURE BIOTECHNOLOGY, vol. 32, no. 2, 2014, pages 191 - 198
LI ET AL., J. MOL. BIOL., vol. 429, 2017, pages 2571 - 2589
LI, H. ET AL., I MOL BIOI, vol. 429, 2017, pages 2571 - 2589
LINDAHL ET AL., J INFECT DIS, vol. 133, 1976, pages A66 - A68
LINDAHL ET AL., PROC NATL ACAD SCI USA, vol. 17, 1976, pages 1284 - 1287
MARINARO ET AL., EUROPEAN JOURNAL OF ENDOCRINOLOGY, vol. 142, 2000, pages 512 - 6
MERRIFIELD, J. AM. CHEM. SOC., vol. 85, 1963, pages 2149
MERRIFIELD: "Chem. Polypeptides", 1973, pages: 335 - 61
MONTOYA ET AL., BLOOD, vol. 99, 2002, pages 3263 - 3271
MOORE ET AL., MABS, vol. 3, 2011, pages 546 - 557
MOORE, G.L. ET AL., MABS, vol. 3, 2011, pages 546 - 557
NEEDLEMAN; WUNSCH, I MOL BIOL, vol. 48, 1970, pages 443
OHTSUKA ET AL., JBC, vol. 260, 1985, pages 2605 - 8
OKADA ET AL., ENDOCR REV, vol. 32, 2011, pages 2 - 342
PEARSON; LIPMAN, PNAS, vol. 85, 1988, pages 2444
PIEHLER ET AL., IMMUNOLOGICAL REVIEWS, vol. 250, 2012, pages 317 - 334
PIEHLER, J. ET AL., IMMUNOLOGICAL REVIEWS, vol. 250, 2012, pages 317 - 334
RIDGEWAY ET AL., PROT. ENG., vol. 9, 1996, pages 617 - 621
RIGWAY B ET AL., PROTEIN ENG., vol. 9, 1996, pages 617 - 621
ROSSOLINI ET AL., MOL CELL PROBES, vol. 8, 1994, pages 91 - 8
ROTH ET AL., INTERNATIONAL JOURNAL OF CARBOHYDRATE CHEMISTRY, 2012, pages 1 - 10
SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 1989
SIDMAN ET AL., BIOPOLYMERS, vol. 22, 1983, pages 547 - 556
SMITH; WATERMAN, ADV APPL MATH, vol. 2, 1981, pages 482
SOJAR ET AL., JBC, vol. 264, 1989, pages 2552 - 9
SOJAR ET AL., METHODS ENZYMOL, vol. 138, 1987, pages 341 - 50
SPIESS ET AL., MOLECULAR IMMUNOLOGY, vol. 67, October 2015 (2015-10-01), pages 95 - 106
STAHL ET AL., PNAS, vol. 73, 1976, pages 4045 - 9
STEWART; YOUNG, SOLID PHASE PEPTIDE SYNTHESIS, 1969
STROP ET AL., J. MOL. BIOL., vol. 420, 2012, pages 204 - 219
SWANSON ET AL., J EXP MED, vol. 207, 2010, pages 1485 - 1500
T.E. CREIGHTON: "Proteins: Structures and Molecular Properties", 1993, W.H. FREEMAN AND COMPANY
THOMAS SPRETER VON KREUDENSTEIN ET AL: "Improving biophysical properties of a bispecific antibody scaffold to aid developability : Quality by molecular design", MABS, vol. 5, no. 5, 1 September 2013 (2013-09-01), US, pages 646 - 654, XP055526096, ISSN: 1942-0862, DOI: 10.4161/mabs.25632 *
THORPE ET AL., EUR J BIOCHEM, vol. 147, 1985, pages 197 - 206
THOTAKURA ET AL., METHODS ENZYMOL, vol. 138, 1987, pages 350 - 9
VAN DEN STEEN ET AL., CRITICAL REVIEWS IN BIOCHEMISTRY AND MOLECULAR BIOLOGY, vol. 33, 1998, pages 151 - 208
VAN DER NEUT KOLFSCHOTEN ET AL., SCIENCE, vol. 317, 2007, pages 1554 - 1557
VON KREUDENSTEIN ET AL., MABS, vol. 5, 2013, pages 646 - 654
WEENEN ET AL., J CLIN ENDOCRINOL METAB, vol. 89, 2004, pages 5204 - 12
WIJESUNDARA ET AL., FRONT IMMUNOL, vol. 29, no. 412, 2014
ZACHARA ET AL., CURR PROTOC MOL BIOL, 2011
ZALIPSKY ET AL., ADVANCED DRUG REVIEWS, vol. 16, 1995, pages 157 - 182
ZALIPSKY; J. M. HARRIS ET AL.: "Polyethylene Glycol Chemistry: Biotechnical and Biomedical Applications", 1992, PLENUS PRESS, article "Use of Functionalized Poly(Ethylene Glycols) for Modification of Polypeptides"

Cited By (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12077790B2 (en) 2016-07-01 2024-09-03 Resolve Therapeutics, Llc Optimized binuclease fusions and methods
US12129288B2 (en) 2017-08-22 2024-10-29 Sanabio, Llc Polynucleotides heterodimers of soluble interferon receptors and uses thereof
WO2020138868A1 (ko) * 2018-12-24 2020-07-02 서울대학교산학협력단 타입 1 인터페론 중화 fc-융합 단백질 및 이의 용도
EP3904375A4 (en) * 2018-12-24 2022-09-28 Seoul National University R & DB Foundation Type 1 interferon neutralizing fc-fusion protein and use thereof
US12421297B2 (en) 2018-12-24 2025-09-23 Seoul National University R&Db Foundation Type 1 interferon neutralizing FC-fusion protein and use thereof
WO2020142740A1 (en) * 2019-01-04 2020-07-09 Resolve Therapeutics, Llc Treatment of sjogren's disease with nuclease fusion proteins
CN110357969A (zh) * 2019-05-27 2019-10-22 北京志道生物科技有限公司 一种GLP1-EGFa异源二聚体蛋白、功能及方法
WO2021253360A1 (en) * 2020-06-18 2021-12-23 Proviva Therapeutics (Hong Kong) Limited Activatable procytokines

Also Published As

Publication number Publication date
AU2018321359B2 (en) 2023-11-30
US20210155673A1 (en) 2021-05-27
SG11202001311VA (en) 2020-03-30
JP2025072475A (ja) 2025-05-09
US20190194293A1 (en) 2019-06-27
CN111315767B (zh) 2025-03-18
AU2024201211A1 (en) 2024-03-14
CN111315767A (zh) 2020-06-19
US10947295B2 (en) 2021-03-16
JP2023060304A (ja) 2023-04-27
KR102777015B1 (ko) 2025-03-10
AU2018321359A1 (en) 2020-03-05
BR112020003670A2 (pt) 2020-09-01
CA3073537A1 (en) 2019-02-28
JP7374091B2 (ja) 2023-11-06
KR20200039778A (ko) 2020-04-16
MX2020002070A (es) 2020-03-24
JP2020533020A (ja) 2020-11-19
EP3672986A1 (en) 2020-07-01
IL272749A (en) 2020-04-30
US12129288B2 (en) 2024-10-29
MX2024010429A (es) 2024-09-05

Similar Documents

Publication Publication Date Title
US12129288B2 (en) Polynucleotides heterodimers of soluble interferon receptors and uses thereof
US12338466B2 (en) Therapeutic nuclease compositions and methods
US12077790B2 (en) Optimized binuclease fusions and methods
EP3202898A1 (en) Therapeutic nuclease compositions and methods
HK40033325A (en) Soluble interferon receptors and uses thereof
HK40113640A (en) Optimized binuclease fusions and methods
HK40005595A (en) Therapeutic nuclease compositions and methods
HK40005410A (en) Optimized binuclease fusions and methods
HK1196067B (en) Therapeutic nuclease compositions and methods
HK1196067A (en) Therapeutic nuclease compositions and methods
HK1242370A1 (en) Therapeutic nuclease compositions and methods

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18773305

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3073537

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2020532857

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112020003670

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2018321359

Country of ref document: AU

Date of ref document: 20180822

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20207007881

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2018773305

Country of ref document: EP

Effective date: 20200323

ENP Entry into the national phase

Ref document number: 112020003670

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20200221

WWG Wipo information: grant in national office

Ref document number: 201880067266.4

Country of ref document: CN

WWW Wipo information: withdrawn in national office

Ref document number: 2018773305

Country of ref document: EP

WWW Wipo information: withdrawn in national office

Ref document number: 272749

Country of ref document: IL