WO2019036419A1 - NEW NICOTINE BINDING ANTIBODIES - Google Patents
NEW NICOTINE BINDING ANTIBODIES Download PDFInfo
- Publication number
- WO2019036419A1 WO2019036419A1 PCT/US2018/046621 US2018046621W WO2019036419A1 WO 2019036419 A1 WO2019036419 A1 WO 2019036419A1 US 2018046621 W US2018046621 W US 2018046621W WO 2019036419 A1 WO2019036419 A1 WO 2019036419A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- nicotine
- seq
- chain sequence
- heavy chain
- light chain
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/44—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material not provided for elsewhere, e.g. haptens, metals, DNA, RNA, amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/56—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
- A61K47/59—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes
- A61K47/60—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes the organic macromolecular compound being a polyoxyalkylene oligomer, polymer or dendrimer, e.g. PEG, PPG, PEO or polyglycerol
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/30—Drugs for disorders of the nervous system for treating abuse or dependence
- A61P25/34—Tobacco-abuse
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
Definitions
- the present disclosure relates generally to the field of antibody therapeutics, specifically antibodies that bind to nicotine.
- the disclosed nicotine-binding antibodies can be used in methods of aiding smoking cessation and methods of treating nicotine toxicity, including nicotine poisoning and nicotine overdose.
- Nicotine is a bitter-tasting, parasympathomimetic alkaloid compound that naturally occurs in large amounts in the leaves of tobacco plants. Nicotine is a nicotinic acetylcholine receptor (nAChR) agonist and functions physiologically as a stimulant. Nicotine is both addictive and toxic, and its ingestion and inhalation have been associated with cardiovascular disease, potential birth defects, and poisoning.
- nAChR nicotinic acetylcholine receptor
- Nicotine is a small molecule that upon inhalation or ingestion into the body quickly passes into the bloodstream and subsequently reaches the brain by crossing the blood-brain barrier. Once in the brain, the nicotine binds to nicotinic receptors, which results in the release of stimulants, such as dopamine, activating the reward system and providing the smoker with a positive and pleasurable re-enforcing experience, which leads to addiction.
- Nicotine poisoning which results from ingestion or inhalation of too much nicotine, is another nicotine-related health problem.
- the LD 50 of nicotine is 50 mg/kg for rats and 3 mg/kg for mice.
- a dose as low as 30-60 mg (0.5-1.0 mg/kg) may be lethal for adult humans, while children may become ill following ingestion of one cigarette, and ingestion of more than this may cause a child to become severely ill.
- some evidence suggests that a lethal dose may be as high as 500 mg or more (1.0-7.1 mg/kg) for a human adult.
- acute nicotine poisoning usually occurs in children who accidentally chew on nicotine gum or patches or ingest the "e-liquid" of electronic cigarettes. In rare instances, children have also been known to become ill after ingesting cigarettes. There are several hundred cases of acute nicotine poisoning reported every month in the United States alone.
- Symptoms of nicotine poisoning can include abdominal cramping, agitation, restlessness, or excitement, a burning sensation in the mouth, headache, vomiting, muscle twitching, fainting, rapid breathing and heartrate, and weakness, as well as more serious complications like convulsions and seizures, coma, and potentially death.
- the ultimate outlook for a person depends on the amount of nicotine at issue and how quickly treatment is received. The faster a person gets medical help, the better the chance for recovery.
- initial treatment of nicotine poisoning may include the administration of activated charcoal to try to reduce gastrointestinal absorption, while additional treatment may address the symptoms that result from nicotine poisoning.
- additional treatment may address the symptoms that result from nicotine poisoning.
- Described herein are antibodies that bind nicotine, compositions comprising the antibodies, and methods using them for aiding smoking cessation and treating nicotine toxicity, including nicotine poisoning and nicotine overdose.
- the present disclosure provides nicotine-binding antibodies or nicotine- binding fragments thereof, comprising the complementarity determining regions (CDRs), the variable regions, or the full heavy chain and light chain of the sequences selected from: the heavy chain sequence of SEQ ID NO 1 and the 1 ight chain sequence of SEQ ID NO : 2; the heavy chain sequence of SEQ ID NO 3 and the 1 ight chain sequence of SEQ ID NO : 4; the heavy chain sequence of SEQ ID NO 5 and the 1 ight chain sequence of SEQ ID NO : 6; the heavy chain sequence of SEQ ID NO 7 and the 1 ight chain sequence of SEQ ID NO : 8; the heavy chain sequence of SEQ ID NO: 9 and the li ght chain sequence of SEQ ID NO: 10; the heavy chain sequence of SEQ ID NO: 11 and the 1 ight chain sequence of SEQ ID NO: 12; the heavy chain sequence of SEQ ID NO: 13 and the 1 ight chain sequence of SEQ ID NO: 14; the heavy chain sequence of SEQ ID NO: 15
- the antibody or fragment may be an IgG4 or derived from an IgG4, and in some embodiments the antibody or fragment may comprise a S228P substitution in its Fc domain.
- the antibody or fragment may be a long-acting variant, such as an antibody or fragment that is conjugated to polyethylene glycol ("PEG"; i.e., the antibody or fragment is PEGylated).
- PEG polyethylene glycol
- the antibody or fragment has a K D for S-(-)-nicotine of less than about 100 nM.
- the K D for S-(-)-nicotine may be less than about 60 nM, less than about 30 nM, less than about 10 nM, or less than about 5 nM.
- the antibody or fragment is substantially not cross-reactive with cotinine or other non-nicotine molecules.
- the antibody or fragment is substantially not cross-reactive with one or more nicotine-related compounds selected from cotinine, nicotinamide, B-nicotinamide adenine dinucleotide and nornicotine.
- the antibody or fragment is substantially not cross-reactive with one or more smoking-cessation drugs selected from bupropion, varenicline, and cytosine.
- the antibody or fragment is substantially not cross-reactive with one more neurotransmitters selected from acetylcholine chloride, 3-hydroxytyramine (dopamine), serotonin, and norepinephrine.
- the present disclosure provides pharmaceutical compositions comprising a nicotine-binding antibody or nicotine-binding fragment thereof according to of any one of the embodiments above or disclosed herein and a pharmaceutically acceptable carrier.
- the pharmaceutical composition may be formulated for injection or infusion.
- the present disclosure provides methods of treating nicotine addiction or facilitating smoking cessation, comprising administering to a mammalian subject in need thereof a therapeutically effective amount of a nicotine-binding antibody or nicotine-binding fragment thereof according to of any one of the embodiments above or disclosed herein, or a pharmaceutical composition comprising the same.
- the therapeutically effective amount is effective to reduce plasma levels of nicotine and/or to reduce levels of nicotine localized in the brain.
- the subject is a human.
- the nicotine addiction is associated with the consumption of a nicotine product selected from tobacco products and electronic cigarettes.
- at least one symptom of nicotine withdrawal is reduced, ameliorated, or eliminated.
- the nicotine-binding antibody or nicotine-binding fragment is administered a route of administration selected from the group consisting of intravenously, subcutaneously, intramuscularly, intraperitoneally, orally, nasally, pulmonarily, ocularly, vaginally, or rectally.
- the present disclosure provides uses of a nicotine-binding antibody or nicotine-binding fragment thereof according to any one of the embodiments above or disclosed herein in the manufacture of a medicament for the treatment of nicotine addiction or facilitating smoking cessation.
- the present disclosure provides nicotine-binding antibodies or nicotine-binding fragments thereof according to any one of the embodiments above or disclosed herein, for use in the treatment of nicotine addiction or facilitating smoking cessation.
- the present disclosure provides methods of treating nicotine overdose or nicotine poisoning, comprising administering to a mammalian subject in need thereof a therapeutically effective amount of a nicotine-binding antibody or nicotine-binding fragment thereof according to of any one of the embodiments above or disclosed herein, or a pharmaceutical composition comprising the same.
- the therapeutically effective amount is effective to reduce plasma levels of nicotine and/or to reduce levels of nicotine localized in the brain.
- the subject is a mammal selected from the group consisting of canines, felines, equines, bovines, and humans.
- the subject is a human child.
- the antibody or nicotine-binding fragment is administered a route of administration selected from the group consisting of intravenously, subcutaneously, intramuscularly, intraperitoneally, orally, nasally, pulmonarily, ocularly, vaginally, or rectally.
- the methods of treating nicotine poisoning or toxicity may further comprise administration of a second compound for treating nicotine overdose or nicotine poisoning, such as activated charcoal.
- the present disclosure provides uses of a nicotine-binding antibody or nicotine-binding fragment thereof according to any one of the embodiments above or disclosed herein in the manufacture of a medicament for the treatment of nicotine overdose or nicotine poisoning.
- the present disclosure provides nicotine-binding antibodies or nicotine- binding fragments thereof according to any one of the embodiments above or disclosed herein, for use in the treatment of nicotine overdose or nicotine poisoning.
- Figs 1A and IB show the results of a nicotine pharmacokinetic study in rats.
- Fig 1A shows the serum concentration of nicotine in rats that were pre-treated with the disclosed antibodies as a percent of serum levels in control rats that were not treated with antibody.
- Fig IB shows the concentration of nicotine in the brains of rats that were pre-treated with the disclosed antibodies as a percent of the brain levels of control rats that were not treated with antibody.
- Figs 2A and 2B show the results of a dose response study of exemplary nicotine-binding antibodies in rats.
- Fig 2A shows the serum concentration of nicotine (ng/ml) of rats that were pre-treated with the disclosed antibodies at a dose of 10, 20, or 40 mg/kg.
- Fig 2B shows the concentration of nicotine in the brains (ng/g) of rats that were pre-treated with the disclosed antibodies at the same doses.
- Figs 3A and 3B show the results from a dose response study of the exemplary nicotine- binding antibodies in rats.
- Fig 3A shows the serum concentration of nicotine as a percent of serum levels in control rats that were not treated with antibody.
- Fig 3B shows the concentration of nicotine in the brain as a percent of brain levels in control rats that were not treated with antibody.
- Figs 4A and 4B shows the impact of multiple doses of nicotine— simulating a heavy smoker— after pretreatment with disclosed nicotine-binding antibodies.
- rats When pretreated with 8Dl-IgG4, rats showed an increase in serum nicotine levels after 5 nicotine doses (Fig 4A) and a decrease in brain nicotine levels (Fig 4B).
- Fig 5 shows that treatment with disclosed nicotine-binding antibodies reduces nicotine self-administration in rats.
- rats were treated with 8Dl-IgG4 the mean ( ⁇ SEM) number of self-administered infusions during the last three sessions before (Baseline) was significantly higher than the number of infusions during antibody treatment at each unit nicotine dose.
- Fig 6 shows the single dose pharmacokinetics of 8Dl-IgG4 in rats when administered at a dose of 20 mg/kg.
- Fig 7 shows the pharmacokinetics of repeated dosing of 8Dl-IgG4 in rats over an extended period of time. Rats were administered a 40 mg/kg dose once per week for 4 weeks.
- Described herein are nicotine-binding antibodies, compositions comprising the antibodies, and methods using them, including for treating nicotine addiction and facilitating nicotine cessation (e.g., smoking cessation) and treating nicotine toxicity, including nicotine poisoning and nicotine overdose.
- nicotine addiction e.g., nicotine addiction
- nicotine cessation e.g., smoking cessation
- nicotine toxicity including nicotine poisoning and nicotine overdose.
- the phrases "therapeutically effective amount” and “therapeutic level” mean that drug dosage or plasma concentration in a subject that provides the specific pharmacological effect for which the drug is administered in a subject in need of such treatment, i.e. to reduce, ameliorate, or eliminate the symptoms or effects of nicotine poisoning or nicotine overdose, and/or treat nicotine addiction and/or facilitate smoking cessation. It is emphasized that a therapeutically effective amount or therapeutic level of a drug will not always be effective in treating the conditions described herein, even though such dosage is deemed to be a therapeutically effective amount by those of skill in the art. For convenience only, exemplary dosages, drug delivery amounts, therapeutically effective amounts, and therapeutic levels are provided below.
- the therapeutically effective amount may vary based on the route of administration and dosage form, the age and weight of the subject, and/or the subject's condition, including the amount of nicotine ingested and/or the subject's plasma levels of nicotine at the time of treatment and/or the amount of nicotine localized in the brain at the time of treatment.
- treatment or “treating” as used herein with reference to nicotine toxicity, nicotine poisoning, and nicotine overdose refer to reducing, ameliorating or eliminating one or more symptoms or effects of nicotine and/or reducing the subject's plasma levels of nicotine and/or reducing the amount of nicotine localized in specific tissues of the subject ⁇ e.g., brain/central nervous system, heart and vasculature, etc.).
- treatment refers to one or more of: reducing, ameliorating or eliminating one or more symptoms or effects of nicotine withdrawal; reducing the daily number of cigarettes or the daily amount of nicotine consumed by a subject; and/or reducing the subject's plasma levels of nicotine and/or reducing the amount of nicotine localized in specific tissues of the subject (e.g., brain/central nervous system, heart and vasculature, etc.).
- the terms "individual,” “subject,” and “patient” are used interchangeably herein, and refer to any individual mammal subject, e.g., bovine, canine, feline, equine, or human.
- child refers to a human subject from 0 through about 18 years of age.
- a child can be a subject that begins a course of treatment prior to turning about 18 years of age, even if the subject continues treatment beyond 18 years of age.
- Nicotine is a nitrogen-containing chemical made by several types of plants including tobacco and other members of the nightshade family. When humans, mammals and most other types of animals are exposed to nicotine, it increases their heart rate, heart muscle oxygen consumption rate, and heart stroke volume. The consumption of nicotine is also linked to raised alertness, euphoria, and a sensation of being relaxed. However, nicotine is highly addictive.
- Nicotine By binding to nicotinic acetylcholine receptors in the brain, nicotine elicits its psychoactive effects and increases the levels of several neurotransmitters in various brain structures. Nicotine has a higher affinity for nicotinic receptors in the brain than those in skeletal muscle, though at toxic doses it can induce contractions and respiratory paralysis. Nicotine's selectivity is thought to be due to a particular amino acid difference on these receptor subtypes. The structure of nicotine is shown in Formula I below.
- the methods described herein useful in treating nicotine addiction and/or facilitating smoking cessation (or the cessation of use of other tobacco or nicotine products) in a mammalian subject in need thereof use nicotine-binding antibodies, which bind nicotine and prevent it from interacting with nicotinic acetylcholine receptors.
- Nicotine poisoning or nicotine overdose can occur when an individual consumes loose tobacco, cigarettes, nicotine gum, patches, or the "e-liquid" of electronic cigarettes (e.g., the nicotine-containing liquid that is used in electronic cigarettes and other vaporizing devices). Indeed, a recent study showed that the incidence of nicotine poisoning from exposure to e- cigarettes increased 1492.9% between January 2012 and April 2015 (Kamboj et al. PEDIATRICS 137(6): e20160041 (2016)).
- nicotine poisoning or nicotine overdose more commonly results when a subject (typically a child) ingests nicotine, for example by chewing or ingesting nicotine gum, ingesting cigarettes or other tobacco leaf products, ingesting nicotine patches, or ingesting e-liquid. Additionally, nicotine can be dermally absorbed, and therefore nicotine poisoning can result from toxic levels of nicotine coming into direct contact with the skin.
- Nicotine poisoning can produce neurological symptoms (convulsions, coma, depression, confusion, fainting, headache), cardiovascular symptoms (rapid heartbeat, high blood pressure), respiratory symptoms (difficulty breathing, rapid breathing), gastrointestinal symptoms (increased salivation, abdominal cramps, vomiting), and musculoskeletal symptoms (Muscular twitching, weakness), as well as death.
- the methods described herein for treating nicotine toxicity use an antibody that binds nicotine, thereby sequestering it and preventing the nicotine from binding a cognate receptor or crossing the blood-brain barrier.
- a pharmaceutical composition comprising such an antibody is administered in a therapeutically effective amount, such as an amount effective to reduce plasma levels of nicotine and/or to reduce levels of nicotine localized in the brain.
- the disclosed methods comprise administering to a mammalian subject in need thereof a therapeutically effective amount of a nicotine-binding antibody, a nicotine-binding fragment thereof, a related construct capable of binding nicotine, or a pharmaceutical composition comprising the same.
- these agents are referred to collectively herein as "nicotine-binding antibodies.”
- Anti-nicotine antibodies have been previously developed, primarily for the purpose of facilitating smoking cessation. See, e.g., WO 2002/058635; WO 2000/032239; WO 2003/082329; U.S. Patent Application Publication 2006/111271; U.S. Patent 8,344, 111; U.S. Patent 8,232,072; U.S. Patent 6,232,082; U.S. Patent 7,547,712; U.S. Patent 7,446,205; and Carrera et al., "Investigations using immunization to attenuate the psychoactive effects of nicotine," Bioorg Med Chem 12(3):563-70 (2004).
- Nicotine is a small, haptenic molecule and typically is coupled to an immunogenic carrier, such as an immunogenic protein, to elicit an immune response and induce the production of nicotine-binding antibodies.
- an immunogenic carrier such as an immunogenic protein
- General techniques for making antibodies can be employed. See, e.g., Kohler and Milstein, Eur. J. Immunol, 5: 511-519 (1976); Harlow and Lane (eds.), ANTIBODIES: A LABORATORY MANUAL, CSH Press (1988); C.A. Janeway et al. (eds.), IMMUNOBIOLOGY, 5th Ed., Garland Publishing, New York, NY (2001).
- Anti-nicotine antibodies useful in the methods described herein can be obtained by any means, including via in vitro sources ⁇ e.g., a hybridoma or a cell line producing an antibody recombinantly) and in vivo sources ⁇ e.g., rodents, rabbits, humans, etc.).
- Human, partially humanized, fully humanized, and chimeric antibodies can be made by methods known in the art, such as using a transgenic animal (e.g., a mouse) wherein one or more endogenous immunoglobulin genes are replaced with one or more human immunoglobulin genes.
- transgenic mice wherein endogenous antibody genes are effectively replaced with human antibody genes include, but are not limited to, the HUM AB -MOUSETM , the Kirin TC MOUSETM, and the KM-MOUSETM (see, e.g., Lonberg, Nat. Biotechnol, 23(9): 1117-25 (2005), and Lonberg, Handb. Exp. Pharmacol., 181 : 69-97 (2008)).
- Nicotine-binding antibodies used in the methods disclosed herein generally will be monoclonal and/or recombinant.
- Monoclonal antibodies may obtained by methods known in the art, for example, by fusing antibody-producing cells with immortalized cells to obtain a hybridoma, and/or by generating mAbs from mRNA extracted from bone marrow, B cells, and/or spleen cells of immunized animals using combinatorial antibody library technology and/or by isolating monoclonal antibodies from serum from subjects immunized with a nicotine antigen.
- Recombinant antibodies may be obtained by methods known in the art, for example, using phage display technologies, yeast surface display technologies (Chao et al., Nat.
- an antibody consists of four polypeptides: two identical copies of a heavy (H) chain polypeptide and two copies of a light (L) chain polypeptide.
- each heavy chain contains one N-terminal variable (V H ) region and three C-terminal constant (C H I , C H 2 and C H 3) regions
- each light chain contains one N- terminal variable (V L ) region and one C-terminal constant (C L ) region.
- the variable regions of each pair of light and heavy chains form the antigen binding site of an antibody.
- antibody fragment and "nicotine-binding fragment,” as used herein, refer to one or more portions of a nicotine-binding antibody that exhibits the ability to bind nicotine.
- binding fragments include (i) Fab fragments (monovalent fragments consisting of the V L , V H , C L and C HI domains); (ii) F(ab') 2 fragments (bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region); (iii) Fd fragments (comprising the V H and C HI domains); (iv) Fv fragments (comprising the V L and V H domains of a single arm of an antibody), (v) dAb fragments (comprising a V H domain); and (vi) isolated complementarity determining regions (CDR), e.g., V H CDR3.
- CDR complementarity determining regions
- scFv single chain Fv constructs. See e.g., Bird et al., Science, 242:423-26 (1988); Huston et al., Proc. Natl. Acad. Sci. USA, 85:5879-83 (1988).
- nicotine-binding domain immunoglobulin fusion proteins comprising (i) a nicotine-binding domain polypeptide (such as a heavy chain variable region, a light chain variable region, or a heavy chain variable region fused to a light chain variable region via a linker peptide) fused to an immunoglobulin hinge region polypeptide, (ii) an immunoglobulin heavy chain C H2 constant region fused to the hinge region, and (iii) an immunoglobulin heavy chain C H3 constant region fused to the Cm constant region, where the hinge region may be modified by replacing one or more cysteine residues with, for example, serine residues, to prevent dimerization. See, e.g., U.S. Patent Application 2003/0118592; U.S. Patent Application U.S. 2003/0133939.
- a nicotine-binding antibody as disclosed herein is a human IgGl antibody or a human IgG4 antibody. In some embodiments, the nicotine-binding antibody is mammalian, human, humanized, or chimeric.
- nicotine-binding antibodies as disclosed herein comprise one or more mutations that make the antibody more suitable in a therapeutic context.
- Heavy and light chain sequences of exemplary novel IgGl nicotine-binding antibodies are disclosed in Table 1 below.
- Heavy and light chain sequences of exemplary novel IgG4 nicotine-binding antibodies are disclosed in Table 2 below.
- CDRs Heavy and light chain complementarity determining regions
- Constant regions are denoted in italicized, underlined text.
- 5Dl-IgG4 OLOLRESGPGLVKPSETLSLTCSVSGGSISSSSYYWGWIROPPGKGLE 29 Heavy WIGSIYYTGRTYY PSLESRVTISVDTSKNOFSLKLSSVTAADTAVYY
- IgG4 LEWIASVYYTGSTFYDPSLRSRVTISIDTPRNOFSLRVSSVDAGDMGV
- CDRs Heavy and light chain complementarity determining regions
- Constant regions are denoted in italicized, underlined text.
- nicotine-binding antibodies and nicotine- binding fragments thereof comprising the same CDR sequences and/or the same framework region sequences and/or the same variable region sequences as one or more of the novel antibodies disclosed in Tables 1 and 2.
- novel nicotine-binding antibodies disclosed in Tables 1 and 2 are IgGl and IgG4 antibodies, respectively, other nicotine-binding antibodies within the scope of this disclosure may be IgG2, IgG3, IgAl, IgA2, IgE, IgH, or IgM, for example.
- IgG4 antibodies are good candidates for antibody-based therapy when, as here, reduced effector functions are desirable.
- IgG4 antibodies are dynamic molecules able to undergo a process known as Fab arm exchange (FAE).
- FEE Fab arm exchange
- Therapeutic IgG4 antibodies engage in Fab-arm exchange with endogenous human IgG4 in vivo, NATURE BIOTECH 27(8): 767-71 (2009).
- FAE can be prevented by introducing a S228P mutation into the hinge region of the antibody.
- a nicotine-binding antibody as disclosed herein comprises a S228P substitution.
- the novel antibodies disclosed in Table 2 comprise such a S228P substitution.
- a nicotine-binding antibody as disclosed herein does not comprise a S228P substitution.
- a nicotine-binding antibody as disclosed herein comprises one or more additional or alternative substitutions, insertions, or deletions beyond the aforementioned S228P substitution.
- a nicotine-binding antibody of the present disclosure comprises heavy and light chains with at least about 85%, about 86%>, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or about 100% identity to one or more of the heavy and light chain sequences disclosed in Tables 1 and 2, respectively.
- a nicotine-binding antibody of the present disclosure comprises heavy and light chains with at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%), 99%), or 100% identity to one or more of the heavy and light chain sequences disclosed in Tables 1 and 2, respectively.
- the antibodies disclosed herein bind nicotine with a high affinity.
- Table 3 the novel antibodies of Tables 1 and 2 can bind to free S-nicotine with a K D in the nanomolar range.
- the K D values reported below were determined by Surface Plasmon Resonance Biosensor. Other methodology for determining binding affinity also can be used, such as equilibrium dialysis.
- the nicotine-binding antibodies or fragments thereof disclosed herein have a K D of less than 100 nM.
- the nicotine-binding antibodies or fragments thereof have a K D for nicotine of less than about 1.5xl0 "7 , less than about l .OxlO "7 , less than about 0.5xl0 "7 , less than about 9.5xl0 "8 , less than about 9.0xl0 "8 , less than about 8.5xl0 "8 , less than about 8.0xl0 "8 , less than about 7.5xl0 "8 , less than about 7.0xl0 “8 , less than about 6.5xl0 “8 , less than about 6.0xl0 "8 , less than about 5.5xl0 "8 , less than about 5.0xl0 "8 , less than about 4.5xl0 "8 , less than about 4.0xl0 "8 , less than about 3.5xl0 "8
- the nicotine-binding antibodies or fragments thereof have a K D for nicotine of less than 1.5xl0 "7 less than l .OxlO "7 , less than 0.5xl0 "7 less than 9.5xl0 "8 , less than 9.0xl0 "8 , less than 8.5xl0 "8 less than 8.0x10 ' less than 7.5x10 ' less than 7.0x10 ' less than 6.5x10 ' less than 6.0xl0 "8 less than 5.5x10 ' less than 5.0x10 ' less than 4.5x10 ' less than 4.0x10 ' less than 3.5xl0 "8 less than 3.0x10 ' less than 2.5x10 ' less than 2.0x10 ' less than 1.5x10 ' less than l .OxlO "8 less than 0.5x10 ' less than 9.5x10 ' less than 9.0x10 ' less than 8.5x10 ' less than 8.0xl0 "9 less than 7.5x10
- the disclosed nicotine-binding antibodies or fragments thereof have a KD for nicotine between 100 nM and 0.01 nM, between 90 nM and 0.05 nM, between 80 nM and 0.1 nM, between 70 nM and 0.5 nM, between 70 nM and 1.0 nM, between 60 nM and 30 nM, or any value in between.
- the disclosed nicotine- binding antibodies or fragments thereof have a K D for nicotine of less than 100 nM, less than 60 nM, less than 30 nM, less than 10 nM, less than 5 nM, or less than 1 nM.
- Nicotine has two enantiomers: S-(-)-nicotine and R-(+)-nicotine, with the S-enantiomer known to be the most physiologically active.
- the disclosed nicotine- binding antibodies exhibit selectivity for one enantiomer over the other.
- a nicotine-binding antibody selectively binds to S-(-)-nicotine with a higher affinity than it binds to R-(+)-nicotine, while in some embodiments a nicotine-binding antibody may bind S-(-)-nicotine and substantially not bind to R-(+)-nicotine.
- 8Dl-IgG4 and 12F5-IgG4 preferentially bind to S-(-)-nicotine.
- 8Dl-IgG4 has a K D for R-(+)-nicotine of 92 nM and 12F5-IgG4 has a K D for R-(+)-nicotine of 1.2 ⁇ .
- These disclosed antibodies exhibit greater binding affinity and selectivity for S-(-)-nicotine than has previously been reported for previously described nicotine-binding antibodies, such as the Nicl2 mAb, which is disclosed in U. S. 8,344, 1 1 1 and Tars et al., J. Mol. Bio., 415 : 1 18-127 (2012).
- a nicotine-binding antibody may selectively bind to R-(+)-nicotine with a higher affinity than it binds to S-(-)-nicotine, while in some embodiments a nicotine-binding antibody may bind to R-(+)-nicotine and substantially not bind to S-(-)-nicotine.
- a nicotine-binding antibody may bind to both enantiomers of nicotine with comparable affinity.
- the disclosed nicotine-binding antibodies have a strong binding affinity for nicotine (one or both enantiomers) and a comparatively weak binding affinity for other molecules that may be present in a subject being treated, including molecules that are chemically- and/or structurally-related to nicotine, metabolites or byproducts of nicotine (e.g., cotinine), molecules that are ligands of or that bind to nicotinic receptors, drugs (e.g., small molecule drugs) used to aid smoking cessation (e.g., bupropion, varenicline, and cytisine) and/or treat nicotine addiction and/or nicotine toxicity, and/or other endogenous or exogenous molecules that may be present in a subject' s blood, including neurotransmitters and other molecules that may be administered to diagnose or treat a condition in the subject or to maintain or support normal physiology.
- the disclosed nicotine- binding antibodies do not cross-react with molecules that are not nicotine,
- the percent of cross reactivity (% cross reactivity to mAb (IC 50 , Nicotine/ICso, compound 100%)) of the disclosed antibodies against several exemplary molecules is shown in Table 4 below.
- cotinine, nicotinamide, B-nicotinamide adenine dinucleotide, and nornicotine are nicotine-related molecules
- bupropion, varenicline and cytisine are smoking-cessation drugs
- acetylcholine chloride, 3-hydroxytyramine (dopamine), serotonin, and norepinephrine are neurotransmitters.
- a cross-reactivity of less than 0.1%>, less than 0.05%>, less than 0.01%>, or less than 0.005%, or less than 0.001%, or less than 0.0005%, or less than 0.0001% is considered to be substantially not cross-reactive.
- Binding affinity for nicotine over cotinine is particularly advantageous because cotinine is the major human metabolite of nicotine and has a longer half-life than nicotine, so it often accumulates at high concentrations relative to nicotine in smokers and other individuals who consume nicotine-based products. Indeed, this is a reason that cotinine is used for testing to determine if someone is a smoker.
- a nicotine-binding antibody that also exhibits substantial binding affinity for cotinine would be less effective for treating nicotine poisoning or facilitating smoking cessation, since the antibody would bind to cotinine as well as nicotine, limiting its efficacy at binding (and sequestering) nicotine.
- the binding selectivity of the specific antibodies disclosed herein is a significant advantageous property that supports their efficacy in clinical applications.
- Binding affinity for nicotine over bupropion, varenicline and/or cytisine also is advantageous because those drugs are commonly used for smoking cessation.
- the binding selectivity of the specific antibodies disclosed herein and their lack of binding affinity for bupropion, varenicline and cytisine indicates that they could be used in combination with bupropion, varenicline and/or cysteine, since the antibodies would not bind those drugs.
- the methods disclosed herein include administering an antibody as disclosed herein that does not exhibit binding affinity to bupropion, varenicline and/or cytisine (such as any of the antibodies set forth in the Table 4) in a combination therapy with a smoking cessation drug (such as bupropion, varenicline and/or cytisine), wherein the antibodies and drugs may be administered substantially simultaneously or sequentially in any order.
- a smoking cessation drug such as bupropion, varenicline and/or cytisine
- Such embodiments may be particularly advantageous in methods for facilitating smoking cessation, quitting smoking (or quitting using other nicotine products), maintaining abstinence from smoking (or use of other nicotine products), or decreasing consumption of nicotine products.
- the nicotine-binding antibody or fragment is a long-acting variant that has been modified in order to extend its half-life in vivo (after administration).
- Various techniques are known in the art for extending the circulating half-life of peptides, such as antibodies.
- the antibody carries mutations in the Fc region with enhanced FcRn-mediated recycling such as "YTE" (M252Y/S254T/T256E), see e.g., Dall'Acqua et al., J Biol Chem., 281 :23514-24 (2006), or "Xtend” Fc domain mutations from Xencor (US 2014/0056879 Al).
- the antibody or fragment thereof is conjugated to polyethylene glycol (PEG; i.e., the antibody is PEGylated) or a similar polymer that prolongs half-life.
- PEG polyethylene glycol
- the antibody is fused to an albumin-binding peptide, an albumin-binding protein domain, human serum albumin, or an inert polypeptide.
- Exemplary inert polypeptides that have been used to increase the circulating half-life of peptides include, but are not limited to, XTEN® (also known as recombinant PEG or "rPEG”), a homo- amino acid polymer (HAP; HAPylation), a proline-alanine serine polymer (PAS; PASylation), or an elastin-like peptide (ELP; ELPylation).
- HAP homo- amino acid polymer
- PAS proline-alanine serine polymer
- ELPylation elastin-like peptide
- "fused to” includes genetic fusion, directly or through a linker, resulting in a single polypeptide containing multiple domains, unless otherwise specified.
- the nicotine-binding antibody or a nicotine-binding fragment thereof can be formulated in a pharmaceutical composition suitable for administration to the target subject by the intended route of administration, as discussed in more detail below.
- compositions suitable for use in the methods described herein can include the disclosed nicotine-binding antibodies or fragments thereof and a pharmaceutically acceptable carrier or diluent.
- the composition may be formulated for intravenous, subcutaneous, intraperitoneal, intramuscular, oral, nasal, pulmonary, ocular, vaginal, or rectal administration.
- nicotine-binding antibodies are formulated for intravenous, subcutaneous, intraperitoneal, or intramuscular administration, such as in a solution, suspension, emulsion, liposome formulation, etc.
- the pharmaceutical composition can be formulated to be an immediate-release composition, sustained-release composition, delayed-release composition, etc., using techniques known in the art.
- Pharmacologically acceptable carriers for various dosage forms are known in the art.
- excipients, lubricants, binders, and disintegrants for solid preparations are known; solvents, solubilizing agents, suspending agents, isotonicity agents, buffers, and soothing agents for liquid preparations are known.
- the pharmaceutical compositions include one or more additional components, such as one or more preservatives, antioxidants, colorants, sweetening/flavoring agents, adsorbing agents, wetting agents and the like.
- the disclosed nicotine-binding antibodies or fragments thereof may be formulated for administration by injection or infusion.
- the nicotine-binding antibody or fragment thereof is formulated for administration by a non-oral route since nicotine poisoning may induce vomiting, thus limiting the effectiveness of oral administration for that particular indication.
- the methods of treating nicotine overdose or nicotine poisoning described herein comprise administering to a mammalian subject in need thereof a nicotine-binding antibody or nicotine-binding fragment thereof as disclosed herein, or a pharmaceutical composition comprising the same.
- the methods comprise administering a nicotine-binding antibody or nicotine-binding fragment thereof to a subject that has ingested or consumed a toxic amount of nicotine.
- the methods may comprise administering both a nicotine-binding antibody or nicotine-binding fragment thereof and another compound that is useful for treating nicotine poisoning, such as activated charcoal.
- the antibody or fragment and the second compound can be administered sequentially or simultaneously, from the same or different compositions.
- the treatment may include administering activated charcoal and/or other supportive treatments to address the symptoms and/or effects of nicotine poisoning.
- the therapeutically effective amount of the nicotine-binding antibody or fragment thereof is effective to reduce plasma levels of nicotine, and/or to reduce levels of nicotine localized in the brain, and/or to reduce, ameliorate, or eliminate one or more symptoms or effects of nicotine poisoning or overdose.
- the specific amount administered may depend on one or more of the age and/or weight of the subject, the amount of nicotine believed to have been ingested, and/or the subject' s plasma level of nicotine at the time of treatment, and/or the subject's brain level of nicotine at the time of treatment.
- the nicotine-binding antibody is administered at a dose of from about 50 to about 1000 mg/kg, about 150 mg/kg to about 850 mg/kg, about 250 mg/kg to about 750 mg/kg, about 350 mg/kg to about 650 mg/kg, or about 450 mg/kg to about 550 mg/kg. In some embodiments, the nicotine-binding antibody is administered at a dose of from 50 to 1000 mg/kg, 150 mg/kg to 850 mg/kg, 250 mg/kg to 750 mg/kg, 350 mg/kg to 650 mg/kg, or 450 mg/kg to 550 mg/kg.
- the nicotine-binding antibody is administered at a dose of about 50 mg/kg, about 100 mg/kg, about 150 mg/kg, about 200 mg/kg, about 250 mg/kg, about 300 mg/kg, about 350 mg/kg, about 400 mg/kg, about 450 mg/kg, about 500 mg/kg, about 550 mg/kg, about 600, about 650 mg/kg, about 700 mg/kg, about 750 mg/kg, about 800 mg/kg, about 850 mg/kg, about 900 mg/kg, about 950 mg/kg, or about 1000 mg/kg.
- the nicotine-binding antibody is administered at a dose of 50 mg/kg, 100 mg/kg, 150 mg/kg, 200 mg/kg, 250 mg/kg, 300 mg/kg, 350 mg/kg, 400 mg/kg, 450 mg/kg, 500 mg/kg, 550 mg/kg, 600, 650 mg/kg, 700 mg/kg, 750 mg/kg, 800 mg/kg, 850 mg/kg, 900 mg/kg, 950 mg/kg, or 1000 mg/kg.
- the nicotine-binding antibody is administered at a dose of about 3000 mg, about 3500 mg, about 4000 mg, about 4500 mg, about 5000 mg, about 5500 mg, about 6000, about 6500 mg, about 7000 mg, about 7500 mg, about 8000 mg, about 8500 mg, about 9000 mg, about 9500 mg, about 10000 mg, about 10500 mg, about 11000 mg, about 11500 mg, or about 12000 mg.
- the nicotine-binding antibody is administered at a dose of 3000 mg, 3500 mg, 4000 mg, 4500 mg, 5000 mg, 5500 mg, 6000, 6500 mg, 7000 mg, 7500 mg, 8000 mg, 8500 mg, 9000 mg, 9500 mg, 10000 mg, 10500 mg, 11000 mg, 11500 mg, or 12000 mg.
- the nicotine-binding antibody is administered at a dose of up to about 10 g.
- other antibody-related constructs such as antibody fragments, they can be used at comparable doses adjusted for their different molecular weights and/or binding affinities.
- the dose of a fragment can be chosen to achieve comparable Cmax and/or AUC parameters as the corresponding full-length antibody, or to achieve binding of a comparable amount of nicotine.
- the nicotine-binding antibody is administered as a dose based on the molar ratio of antibody to nicotine.
- the ratio of antibody:nicotine is 10: 1, 9: 1, 8: 1, 7: 1, 6: 1, 5: 1, 4: 1, 3 : 1, 2: 1, 1 : 1, 1 :2, 1 :3, 1 :4, 1 :5, 1 :6, 1 :7, 1 :8, 1 :9, or 1 : 10.
- the disclosed nicotine-binding antibodies possess two nicotine binding sites per antibody, while a Fab of the disclosed nicotine-binding antibodies may only have one nicotine binding site. Accordingly, the dose may be adjusted based on the number of nicotine binding sites per molecule.
- an "equimolar dose amount" adjusted for the number of nicotine binding sites would be equivalent to a 50% higher dose amount (in mg/kg) for the full length antibody versus the Fab.
- the method comprises administering a single dose of a pharmaceutical composition comprising a nicotine-binding antibody or nicotine-binding fragment thereof, or a single dose of a pharmaceutical composition comprising a nicotine- binding antibody or nicotine-binding fragment thereof and another compound.
- the method comprises administering repeated doses of the pharmaceutical composition(s) until the symptoms or effects of nicotine poisoning or nicotine overdose are reduced, ameliorated, or eliminated.
- a subject with nicotine poisoning or overdose may be evaluated for the presence and/or severity of signs and symptoms associated with nicotine poisoning, including, but not limited to, seizures, coma, shortness of breath, and increased heart rate, and treated with one or more pharmaceutical composition(s) as described herein until one or more of the signs/symptoms is reduced, ameliorated, or eliminated after treatment.
- samples are taken to monitor nicotine levels in the subject's plasma or brain.
- treatment is repeated with additional doses of the pharmaceutical composition(s) if signs/symptoms/effects persist and/or if nicotine plasma or brain levels remain elevated, and can be continued (repeated) until one or more symptoms or effects of nicotine poisoning or nicotine overdose are reduced, ameliorated, or eliminated, and/or until plasma levels and/or brain levels are reduced.
- treating a subject with nicotine poisoning or overdose may comprise extracorporeal detoxification of the subject's blood.
- the disclosed nicotine-binding antibodies or nicotine-binding fragments thereof can be attached to an affinity column through which the subject's blood can be circulated. This process can remove circulating nicotine from the subject's blood.
- the antibodies described herein are useful in methods of treating nicotine addiction and/or facilitating smoking cessation (or the cessation of use of other nicotine products) in a mammalian subject in need thereof.
- the subject is a human subject addicted to nicotine or desiring to quit smoking (or quit using other nicotine products) or maintain abstinence from smoking or consumption of other nicotine products.
- the disclosed nicotine-binding antibodies or nicotine-binding fragments thereof attenuate nicotine's effects and do not induce withdrawal symptoms at predicted therapeutic doses, and have been demonstrated to aid in smoking cessation and the maintenance of abstinence in pre-clinical studies.
- the results have been noteworthy, as the negative affective consequences of early nicotine withdrawal are recognized as significant contributors to relapse to tobacco smoking during quit attempts, and the maintenance of compulsive nicotine use.
- the enhancement by nicotine of the reward value of other environmental rewarding stimuli is considered critical in the maintenance of nicotine dependence.
- blockade of nicotine-induced reward enhancement without inducing strong withdrawal effects are desirable properties of nicotine-binding antibodies and nicotine- binding fragments thereof as a putative anti-smoking medications that may play an important role in preventing relapse within the quit process and in the maintenance of abstinence.
- the ligand-binding approach of the disclosed nicotine-binding antibodies and nicotine-binding fragments thereof is complementary to the pharmacodynamic mechanisms of non-nicotine pharmacotherapies, such as varenicline and bupropion.
- the mechanism of the disclosed antibodies and fragments may be that when a smoker quits and then slips or relapses, the attenuation of nicotine's reinforcing effects helps to prevent resumption of regular smoking. Further, in clinical trials, a greater number of quit attempts per subject were made in the high antibody group, as compared to placebo, consistent with this postulated relapse-prevention mechanism.
- the methods generally involve administering a therapeutically effective amount of a nicotine-binding antibody or nicotine-binding fragment thereof as described herein (or a pharmaceutical composition comprising the same) to the subject.
- the methods comprise administering a nucleic acid encoding the nicotine-binding antibody in a construct that expresses the antibody in vivo.
- the nucleic acid can be provided in a suitable vector, such as an adeno-associated virus (AAV) gene transfer vector.
- AAV adeno-associated virus
- Other exemplary vectors that are suitable for use in such methods are known in the art. See, e.g., Lukashev and Zamyatnin, Biochem., 81(7): 700-8 (2016)).
- Exemplary vectors may include one or more enhancers (e.g., a cytomegalovirus (CMV) enhancer), promoters (e.g., chicken ⁇ -actin promoter), and/or other elements enhancing the properties of the expression cassette.
- enhancers e.g., a cytomegalovirus (CMV) enhancer
- promoters e.g., chicken ⁇ -actin promoter
- other elements enhancing the properties of the expression cassette e.g., a cytomegalovirus (CMV) enhancer
- CMV cytomegalovirus
- promoters e.g., chicken ⁇ -actin promoter
- a subject in need of treatment for nicotine addiction or facilitation of smoking cessation is a human subject who consumes nicotine products, such as smoking tobacco, chewing tobacco, electronic cigarettes, and/or other nicotine delivery devices. Such a subject may or may not be physically addicted to nicotine and/or psychologically addicted to consuming nicotine products.
- Typical subjects in need of smoking cessation treatment smoke or use tobacco or other nicotine products daily, such as smoking at least 1 or more cigarettes a day, such as at least about 5, at least about 10, at least about 15, at least about 20 or more, cigarettes per day, including fewer than 10, 10-20, 20-30, 30-40, or 40 or more (or the equivalent use of other tobacco or nicotine products).
- a therapeutically effective amount of a nicotine-binding antibody is an amount effective to reduce plasma levels of nicotine, to reduce levels of nicotine localized in the brain, or both.
- Nicotine exerts many of its significant effects after it crosses the blood brain barrier.
- the methods and uses described herein reduce or prevent nicotine from crossing the blood-brain-barrier.
- administration of a nicotine- binding antibody as described herein binds up or sequesters nicotine circulating in the bloodstream of the subject, thereby reducing or preventing the nicotine from crossing the blood- brain-barrier.
- the methods described herein reduce or prevent the physiological and psychological effects of nicotine that originate in the brain. Because the subject will experience a lessening or cessation of these effects, he/she will lose the desire to consume nicotine products.
- the disclosed nicotine-binding antibody may exert an effect by affecting the ability of nicotine to stimulate the peripheral nervous system.
- the specific amount of a nicotine-binding antibody or nicotine-binding fragment thereof that is administered may depend on one or more of the age and/or weight of the subject, the amount of nicotine routinely consumed ⁇ e.g., smoked, chewed, or inhaled), and/or the level of nicotine in the subject's brain or plasma at the time of treatment.
- the nicotine-binding antibody is administered at a dose of from about 50 to about 1000 mg/kg, about 150 mg/kg to about 850 mg/kg, about 250 mg/kg to about 750 mg/kg, about 350 mg/kg to about 650 mg/kg, or about 450 mg/kg to about 550 mg/kg.
- the nicotine-binding antibody is administered at a dose of from 50 to 1000 mg/kg, 150 mg/kg to 850 mg/kg, 250 mg/kg to 750 mg/kg, 350 mg/kg to 650 mg/kg, or 450 mg/kg to 550 mg/kg.
- the nicotine-binding antibody is administered at a dose of about 50 mg/kg, about 100 mg/kg, about 150 mg/kg, about 200 mg/kg, about 250 mg/kg, about 300 mg/kg, about 350 mg/kg, about 400 mg/kg, about 450 mg/kg, about 500 mg/kg, about 550 mg/kg, about 600, about 650 mg/kg, about 700 mg/kg, about 750 mg/kg, about 800 mg/kg, about 850 mg/kg, about 900 mg/kg, about 950 mg/kg, or about 1000 mg/kg.
- the nicotine-binding antibody is administered at a dose of 50 mg/kg, 100 mg/kg, 150 mg/kg, 200 mg/kg, 250 mg/kg, 300 mg/kg, 350 mg/kg, 400 mg/kg, 450 mg/kg, 500 mg/kg, 550 mg/kg, 600, 650 mg/kg, 700 mg/kg, 750 mg/kg, 800 mg/kg, 850 mg/kg, 900 mg/kg, 950 mg/kg, or 1000 mg/kg.
- the nicotine-binding antibody is administered at a dose of about 3000 mg, about 3500 mg, about 4000 mg, about 4500 mg, about 5000 mg, about 5500 mg, about 6000, about 6500 mg, about 7000 mg, about 7500 mg, about 8000 mg, about 8500 mg, about 9000 mg, about 9500 mg, about 10000 mg, about 10500 mg, about 11000 mg, about 1 1500 mg, or about 12000 mg.
- the nicotine-binding antibody is administered at a dose of 3000 mg, 3500 mg, 4000 mg, 4500 mg, 5000 mg, 5500 mg, 6000, 6500 mg, 7000 mg, 7500 mg, 8000 mg, 8500 mg, 9000 mg, 9500 mg, 10000 mg, 10500 mg, 11000 mg, 11500 mg, or 12000 mg.
- the nicotine-binding antibody is administered at a dose of up to about 10 g.
- other antibody-related constructs such as antibody fragments, they can be used at comparable doses adjusted for their different molecular weights and/or binding affinities.
- the dose of a fragment can be chosen to achieve comparable Cmax and/or AUC parameters as the corresponding full-length antibody, or to achieve binding of a comparable amount of nicotine.
- the methods comprise administering a single dose of a nicotine- binding antibody(s) or nicotine-binding fragment(s) thereof (or composition comprising the same).
- the method comprises administering repeated doses, such as for a predetermined period of time of until the symptoms or effects of nicotine addiction are reduced, ameliorated, or eliminated or until the subject has ceased smoking or otherwise consuming nicotine.
- treatment is repeated with additional doses of the variant(s) if signs/symptoms/effects persist or if the subject continues to have nicotine cravings or experiences them anew.
- the methods comprise administering a nicotine-binding antibody(s) or nicotine-binding fragment(s) thereof (or composition comprising the same) three or more times a day, twice a day, or once a day.
- the methods comprise administering a nicotine-binding antibody(s) or nicotine-binding fragment(s) thereof (or composition comprising the same) once every other day, three times a week, twice a week, once a week, once every other week, once every three weeks, once a month, or less frequently.
- the nicotine-degrading enzyme variant may be a long-acting nicotine-binding antibody as described above.
- treatment may continue for 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or 21 or more days; 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, or 18 or weeks months; or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 or more months; or 1, 2, or 3 or more years or until the subject no long experiences nicotine cravings or other nicotine withdrawal symptoms, or has ceased smoking or using other tobacco products.
- the methods disclosed herein include administering an antibody as disclosed herein that does not exhibit binding affinity to smoking cessation drug (such as bupropion, varenicline and/or cytisine) in a combination therapy with a smoking cessation drug (such as bupropion, varenicline and/or cytisine, respectively), wherein the antibodies and drugs may be administered substantially simultaneously or sequentially in any order.
- smoking cessation drug such as bupropion, varenicline and/or cytisine
- Such embodiments may be particularly advantageous in methods for facilitating smoking cessation, quitting smoking (or quitting using other nicotine products), maintaining abstinence from smoking (or use of other nicotine products), or decreasing consumption of nicotine products.
- Example 1 Treatment of a Pediatric Patient with an Anti-Nicotine Antibody
- This example illustrates methods using anti-nicotine antibodies in the treatment of nicotine poisoning or nicotine overdose.
- a child known to have or suspected of having ingested nicotine is administered a therapeutically effective amount of a pharmaceutical composition comprising a nicotine-binding antibody, by intravenous, intramuscular, or subcutaneous injection.
- the child is evaluated for the presence and/or severity of signs and symptoms associated with nicotine poisoning, including, but not limited to, seizures, coma, shortness of breath, and increased heart rate, and the child is treated until one or more signs/symptoms is reduced, ameliorated, or eliminated.
- another dose of the pharmaceutical composition is administered if signs/symptoms persist and/or if nicotine plasma levels remain elevated.
- This example illustrates methods of using a variant as described herein to treat nicotine addiction and/or facilitate smoking cessation in a human adult.
- An adult human subject who regularly smokes cigarettes but wishes to quit is administered a therapeutically effective amount of a pharmaceutical compositions comprising a nicotine-binding antibody (e.g., the antibodies disclosed in Tables 1 and 2, or a long-acting version thereof) by intravenous, intramuscular, or subcutaneous injection.
- a pharmaceutical compositions comprising a nicotine-binding antibody (e.g., the antibodies disclosed in Tables 1 and 2, or a long-acting version thereof) by intravenous, intramuscular, or subcutaneous injection.
- the subject is evaluated for levels of nicotine circulating in plasma, as well as for the presence and/or severity of signs and symptoms associated with nicotine withdrawal, such as headache, irritability, anxiety, and sleeplessness, as well as the number of cigarettes smoked in a given day.
- the subject is treated with repeated administrations of the antibody until levels of nicotine circulating in plasma reach a target (reduced) level, and/or until one or more signs/symptoms of nicotine withdrawal are reduced, ameliorated, or eliminated, and/or until the subject has reduced the level of consumption of nicotine products (e.g., is smoking fewer cigarettes per day), and/or until the subject has ceased consumption of nicotine products (e.g., has quit smoking).
- Figs 1A and IB show the blood and brain concentrations, respectively, as a percent of levels in control rats not pre-treated with antibody.
- Each antibody reduced the levels of nicotine in the brain compared to control animals that were not pre-treated with antibody.
- the 8D1 IgG4 antibody produced an 80% decrease in the level of nicotine localized in the brain.
- Rats were used since their nicotine metabolism is generally similar to humans in rate and range of metabolites. Rats were pre-treated with 10, 20, or 40 mg/kg of 12F5 IgG4 or 8D1 IgG4. Subsequently, 0.03 mg/kg of nicotine was administered intravenously in less than 10 seconds. Three minutes later, the animals were sacrificed and the amount of nicotine in their serum and brains was quantified.
- Figs 2A and 2B show the serum and brain concentrations, respectively. While both antibodies reduced the levels of nicotine in the brain, a 40 mg/kg dose of the 8D1 IgG4 antibody decreased the amount of nicotine localized in the brain by more than 95%.
- Figs 3 A and 3B show the same data, but as a percentage of levels in control rats not pre-treated with antibody.
- the 0.03 mg/kg dose of nicotine is equivalent to 2 cigarettes (mg/kg basis) and was administered as a rapid bolus (10s) in contrast to 5-10 minutes to smoke one cigarette. Serum levels of antibody were measured using ELISA and rats that had less than 5 ⁇ g/mL serum antibody level (due to incomplete administration) were excluded from the analyses.
- the excluded animals had an average serum antibody level of 0.73 ⁇ g/mL, while the rats included in the analysis had an average serum antibody level of 302 ⁇ g/mL.
- antibodies 8Dl-IgG4 and 12F5 IgG4 were formulated in phosphate buffer saline (PBS) at a concentration of approximately 10 mg/ml and incubated at 40°C or 5°C. Samples were taken after 2 weeks and 4 weeks for analysis by Size Exclusion Chromatography and functional assay (direct binding to nicotine conjugate). The results of the stability studies are shown in Table 5 below.
- PBS phosphate buffer saline
- NSA nicotine self-administration
- FR fixed- ratio
- Fig 5 shows the mean ( ⁇ SEM) number of infusions during the last three sessions before (Baseline) and during mAb treatment at each unit nicotine dose.
- Rats given 8Dl-IgG4 exhibited a significant decrease in NSA at both unit doses compared to their respective baseline and to control rats.
- varenicline As a point of reference, the potency of varenicline was considerably higher in clinical trials for smoking cessation than it was in preclinical nicotine self- administration studies in rats. Rollema, H. et al., Neuropharmacology, 52: 985-994 (2007).
- Rodent PK assays of mAb's are not always predictive of PK in humans but are often used as a measure of "in vivo fitness" in the lead selection process. While not seen for 8Dl-IgG4, an abnormally fast antibody clearance can be a sign of unwanted nonspecific interactions, so these assays are used to identify antibodies with high nonspecific disposition PK.
- rats were dosed with 0.03 mg/kg i.v. nicotine and sacrificed 3 minutes later and samples were analyzed to assess the amount of unbound nicotine by before and after ultrafiltration. All samples had ⁇ 2% unbound nicotine (data not shown).
- 8Dl-IgG4 was well-tolerated with no obvious pathology in the treatment groups. All animals received the full dose and no mortality was induced in any animals. Daily clinical observations found no observable behavioral changes or modifications in feeding or grooming in any groups. Body weight was monitored twice weekly for the duration of the study and no significant differences between treatment groups was found. At the end of the study animals were necropsied and major organs (liver, lung, spleen, heart, kidneys, testis or ovaries) were isolated and weighed. No gross pathological findings were noted and no statistically significant changes in organ weights were found. Blood was collected, and complete blood count performed to determine any changes in hematological parameters. While occasional animals had values outside the normal range (e.g.
- lymphocytes or hemoglobin no significant changes or trends were found in any group. There was a trend to have slight polychromasia in some of the animals that received nicotine. Serum clinical chemistry of 23 different analytes and plasma coagulation did not find any notable changes between treatment groups.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- Addiction (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Immunology (AREA)
- Biophysics (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Neurology (AREA)
- Psychiatry (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Neurosurgery (AREA)
- Biochemistry (AREA)
- Biomedical Technology (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Epidemiology (AREA)
- Dermatology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicinal Preparation (AREA)
Priority Applications (12)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA3072767A CA3072767A1 (en) | 2017-08-15 | 2018-08-14 | Novel nicotine-binding antibodies |
| MX2020001725A MX2020001725A (es) | 2017-08-15 | 2018-08-14 | Anticuerpos de fijacion a nicotina novedosos. |
| BR112020002994-7A BR112020002994A2 (pt) | 2017-08-15 | 2018-08-14 | novos anticorpos de ligação a nicotina |
| CN201880067101.7A CN111432883B (zh) | 2017-08-15 | 2018-08-14 | 新型烟碱结合抗体 |
| ES18760233T ES3041362T3 (en) | 2017-08-15 | 2018-08-14 | Novel nicotine-binding antibodies |
| US16/639,050 US11440970B2 (en) | 2017-08-15 | 2018-08-14 | Nicotine-binding antibodies |
| EP18760233.9A EP3668598B1 (en) | 2017-08-15 | 2018-08-14 | Novel nicotine-binding antibodies |
| KR1020207007504A KR102712005B1 (ko) | 2017-08-15 | 2018-08-14 | 신규 니코틴-결합 항체 |
| EP25191604.5A EP4624496A3 (en) | 2017-08-15 | 2018-08-14 | Novel nicotine-binding antibodies |
| AU2018317372A AU2018317372B2 (en) | 2017-08-15 | 2018-08-14 | Novel nicotine-binding antibodies |
| JP2020509479A JP7364555B2 (ja) | 2017-08-15 | 2018-08-14 | 新規ニコチン結合抗体 |
| US17/819,577 US20230089068A1 (en) | 2017-08-15 | 2022-08-12 | Novel nicotine-binding antibodies |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201762545696P | 2017-08-15 | 2017-08-15 | |
| US62/545,696 | 2017-08-15 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/639,050 A-371-Of-International US11440970B2 (en) | 2017-08-15 | 2018-08-14 | Nicotine-binding antibodies |
| US17/819,577 Continuation US20230089068A1 (en) | 2017-08-15 | 2022-08-12 | Novel nicotine-binding antibodies |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2019036419A1 true WO2019036419A1 (en) | 2019-02-21 |
Family
ID=63405495
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2018/046621 Ceased WO2019036419A1 (en) | 2017-08-15 | 2018-08-14 | NEW NICOTINE BINDING ANTIBODIES |
Country Status (11)
| Country | Link |
|---|---|
| US (2) | US11440970B2 (https=) |
| EP (2) | EP4624496A3 (https=) |
| JP (1) | JP7364555B2 (https=) |
| KR (1) | KR102712005B1 (https=) |
| CN (1) | CN111432883B (https=) |
| AU (1) | AU2018317372B2 (https=) |
| BR (1) | BR112020002994A2 (https=) |
| CA (1) | CA3072767A1 (https=) |
| ES (1) | ES3041362T3 (https=) |
| MX (1) | MX2020001725A (https=) |
| WO (1) | WO2019036419A1 (https=) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2019236665A1 (en) * | 2018-06-06 | 2019-12-12 | Antidote Therapeutics, Inc. | Methods for improving circulation and treating cardiovascular disease |
| WO2023171958A1 (ko) * | 2022-03-11 | 2023-09-14 | 앱클론(주) | 코티닌을 표적하는 항체 또는 그의 항원 결합 단편, 이를 포함하는 키메라 항원 수용체 및 이들의 용도 |
Citations (13)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0194158A2 (en) * | 1985-03-08 | 1986-09-10 | Baylor College of Medicine | Anti-nicotine and anti-cotinine antibodies (monoclonal and other), and their uses in nicotine and cotinine assays |
| WO2000032239A1 (en) | 1998-12-01 | 2000-06-08 | Nabi | Hapten-carrier conjugates for treating and preventing nicotine addiction |
| WO2002058635A2 (en) | 2001-01-26 | 2002-08-01 | The Scripps Research Institute | Nicotine immunogens and antibodies and uses thereof |
| US20030118592A1 (en) | 2001-01-17 | 2003-06-26 | Genecraft, Inc. | Binding domain-immunoglobulin fusion proteins |
| US20030133939A1 (en) | 2001-01-17 | 2003-07-17 | Genecraft, Inc. | Binding domain-immunoglobulin fusion proteins |
| WO2003082329A2 (en) | 2002-03-01 | 2003-10-09 | The Board Of Regents Of The University Of Nebraska | Compositions and compounds for use as molecular adjuvant for a nicotine vaccine |
| US20060111271A1 (en) | 2004-11-24 | 2006-05-25 | Cerny Erich H | Active and passive immunization against pharmacologically active hapten molecules using a synthetic carrier compound composed of similar elements |
| US7446205B2 (en) | 2005-11-28 | 2008-11-04 | Nabi Biopharmaceuticals | Method for making nicotine hapten |
| WO2009068335A1 (en) * | 2007-11-29 | 2009-06-04 | Cytos Biotechnology Ag | Human monoclonal nicotine specific antibodies |
| US7547712B2 (en) | 2006-02-27 | 2009-06-16 | Nabi Biopharmaceuticals | Methods for decreasing the toxic effects of nicotine on fetuses in pregnant women |
| US8232072B2 (en) | 2008-06-13 | 2012-07-31 | Nabi Biopharmaceuticals | Smoking cessation kit and method |
| US8344111B2 (en) | 2007-11-29 | 2013-01-01 | Cytos Biotechnology Ag | Human monoclonal nicotine specific antibodies |
| US20140056879A1 (en) | 2004-11-12 | 2014-02-27 | Xencor, Inc. | Fc variants that extend antibody half-life |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8316104B2 (en) * | 2005-11-15 | 2012-11-20 | California Institute Of Technology | Method and apparatus for collaborative system |
-
2018
- 2018-08-14 US US16/639,050 patent/US11440970B2/en active Active
- 2018-08-14 JP JP2020509479A patent/JP7364555B2/ja active Active
- 2018-08-14 EP EP25191604.5A patent/EP4624496A3/en active Pending
- 2018-08-14 KR KR1020207007504A patent/KR102712005B1/ko active Active
- 2018-08-14 MX MX2020001725A patent/MX2020001725A/es unknown
- 2018-08-14 AU AU2018317372A patent/AU2018317372B2/en active Active
- 2018-08-14 EP EP18760233.9A patent/EP3668598B1/en active Active
- 2018-08-14 CN CN201880067101.7A patent/CN111432883B/zh active Active
- 2018-08-14 ES ES18760233T patent/ES3041362T3/es active Active
- 2018-08-14 CA CA3072767A patent/CA3072767A1/en active Pending
- 2018-08-14 BR BR112020002994-7A patent/BR112020002994A2/pt not_active Application Discontinuation
- 2018-08-14 WO PCT/US2018/046621 patent/WO2019036419A1/en not_active Ceased
-
2022
- 2022-08-12 US US17/819,577 patent/US20230089068A1/en active Pending
Patent Citations (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0194158A2 (en) * | 1985-03-08 | 1986-09-10 | Baylor College of Medicine | Anti-nicotine and anti-cotinine antibodies (monoclonal and other), and their uses in nicotine and cotinine assays |
| WO2000032239A1 (en) | 1998-12-01 | 2000-06-08 | Nabi | Hapten-carrier conjugates for treating and preventing nicotine addiction |
| US6232082B1 (en) | 1998-12-01 | 2001-05-15 | Nabi | Hapten-carrier conjugates for treating and preventing nicotine addiction |
| US20030118592A1 (en) | 2001-01-17 | 2003-06-26 | Genecraft, Inc. | Binding domain-immunoglobulin fusion proteins |
| US20030133939A1 (en) | 2001-01-17 | 2003-07-17 | Genecraft, Inc. | Binding domain-immunoglobulin fusion proteins |
| WO2002058635A2 (en) | 2001-01-26 | 2002-08-01 | The Scripps Research Institute | Nicotine immunogens and antibodies and uses thereof |
| WO2003082329A2 (en) | 2002-03-01 | 2003-10-09 | The Board Of Regents Of The University Of Nebraska | Compositions and compounds for use as molecular adjuvant for a nicotine vaccine |
| US20140056879A1 (en) | 2004-11-12 | 2014-02-27 | Xencor, Inc. | Fc variants that extend antibody half-life |
| US20060111271A1 (en) | 2004-11-24 | 2006-05-25 | Cerny Erich H | Active and passive immunization against pharmacologically active hapten molecules using a synthetic carrier compound composed of similar elements |
| US7446205B2 (en) | 2005-11-28 | 2008-11-04 | Nabi Biopharmaceuticals | Method for making nicotine hapten |
| US7547712B2 (en) | 2006-02-27 | 2009-06-16 | Nabi Biopharmaceuticals | Methods for decreasing the toxic effects of nicotine on fetuses in pregnant women |
| WO2009068335A1 (en) * | 2007-11-29 | 2009-06-04 | Cytos Biotechnology Ag | Human monoclonal nicotine specific antibodies |
| US8344111B2 (en) | 2007-11-29 | 2013-01-01 | Cytos Biotechnology Ag | Human monoclonal nicotine specific antibodies |
| US8232072B2 (en) | 2008-06-13 | 2012-07-31 | Nabi Biopharmaceuticals | Smoking cessation kit and method |
Non-Patent Citations (19)
| Title |
|---|
| BEERLI ET AL., PNAS, vol. 105, no. 38, 2008, pages 14336 - 41 |
| BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 26 |
| C.A. JANEWAY ET AL.: "IMMUNOBIOLOGY, 5th Ed.", 2001, GARLAND PUBLISHING |
| CARRERA ET AL.: "Investigations using immunization to attenuate the psychoactive effects of nicotine", BIOORG MED CHEM, vol. 12, no. 3, 2004, pages 563 - 70, XP055059496, DOI: doi:10.1016/j.bmc.2003.11.029 |
| CHAO ET AL., NAT. PROTOC., vol. 1, no. 2, 2006, pages 755 - 68 |
| DALL'ACQUA ET AL., J BIOL CHEM., vol. 281, 2006, pages 23514 - 24 |
| HARLOW AND LANE: "ANTIBODIES: A LABORATORY MANUAL", 1988, CSH PRESS |
| HICKS ET AL., SCI. TRANSL. MED, vol. 4, no. 140, 2012, pages 140ra87 |
| HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 83 |
| KAMBOJ ET AL., PEDIATRICS, vol. 137, no. 6, 2016, pages e20160041 |
| KEYLER D E ET AL: "Monoclonal nicotine-specific antibodies reduce nicotine distribution to brain in rats: dose- and affinity-response relationships", DRUG METABOLISM AND DISPOSITION, PHARMACOLOGY AND EXPERIMENTAL THERAPEUTICS, US, vol. 33, no. 7, 1 July 2005 (2005-07-01), pages 1056 - 1061, XP002466379, ISSN: 0090-9556, DOI: 10.1124/DMD.105.004234 * |
| KOHLER; MILSTEIN, EUR. J. IMMUNOL., vol. 5, 1976, pages 511 - 519 |
| LABRIJN ET AL.: "Therapeutic IgG4 antibodies engage in Fab-arm exchange with endogenous human IgG4 in vivo", NATURE B, vol. 27, no. 8, 2009, pages 767 - 71, XP055131750, DOI: doi:10.1038/nbt.1553 |
| LONBERG, NAT. BIOTECHNOL., vol. 23, no. 9, 2005, pages 1117 - 25 |
| LONBERG; HANDB, EXP. PHARMACOL., vol. 181, 2008, pages 69 - 97 |
| LUKASHEV; ZAMYATNIN, BIOCHEM., vol. 81, no. 7, 2016, pages 700 - 8 |
| PENTEL P R ET AL: "Differential effects of passive immunization with nicotine-specific antibodies on the acute and chronic distribution of nicotine to brain in rats", JOURNAL OF PHARMACOLOGY AND EXPERIMENTAL THERAPEUTICS,, vol. 317, no. 2, 1 May 2006 (2006-05-01), pages 660 - 666, XP002466378, ISSN: 0022-3565, DOI: 10.1124/JPET.105.097873 * |
| ROLLEMA, H. ET AL., NEUROPHARMACOLOGY, vol. 52, 2007, pages 985 - 994 |
| TARS ET AL., J. MOL. BIO., vol. 415, 2012, pages 118 - 127 |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2019236665A1 (en) * | 2018-06-06 | 2019-12-12 | Antidote Therapeutics, Inc. | Methods for improving circulation and treating cardiovascular disease |
| WO2023171958A1 (ko) * | 2022-03-11 | 2023-09-14 | 앱클론(주) | 코티닌을 표적하는 항체 또는 그의 항원 결합 단편, 이를 포함하는 키메라 항원 수용체 및 이들의 용도 |
Also Published As
| Publication number | Publication date |
|---|---|
| KR20200089255A (ko) | 2020-07-24 |
| CN111432883B (zh) | 2024-10-01 |
| EP3668598A1 (en) | 2020-06-24 |
| EP3668598B1 (en) | 2025-07-30 |
| US20230089068A1 (en) | 2023-03-23 |
| AU2018317372A1 (en) | 2020-03-05 |
| US11440970B2 (en) | 2022-09-13 |
| ES3041362T3 (en) | 2025-11-11 |
| EP4624496A3 (en) | 2025-12-17 |
| US20200377616A1 (en) | 2020-12-03 |
| AU2018317372B2 (en) | 2025-06-26 |
| BR112020002994A2 (pt) | 2020-08-11 |
| MX2020001725A (es) | 2020-08-20 |
| KR102712005B1 (ko) | 2024-09-30 |
| JP2020531480A (ja) | 2020-11-05 |
| CA3072767A1 (en) | 2019-02-21 |
| JP7364555B2 (ja) | 2023-10-18 |
| CN111432883A (zh) | 2020-07-17 |
| EP4624496A2 (en) | 2025-10-01 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| ES2974803T3 (es) | Anticuerpos antagonistas dirigidos contra el péptido relacionado con el gen de la calcitonina y métodos para utilizarlos | |
| Kosten et al. | Immunotherapy for the treatment of drug abuse | |
| Treweek et al. | An antidote for acute cocaine toxicity | |
| Bachmann et al. | Therapeutic vaccines for chronic diseases: successes and technical challenges | |
| LeSage et al. | Current status of immunologic approaches to treating tobacco dependence: vaccines and nicotine-specific antibodies | |
| CN118001391A (zh) | 以il-4r抑制剂治疗过敏症及强化过敏原特异性免疫治疗的方法 | |
| US20230089068A1 (en) | Novel nicotine-binding antibodies | |
| TW202310872A (zh) | 藉由投予pcsk9抑制劑治療糖尿病患者高血脂症之方法 | |
| Escobar-Chávez et al. | Targeting nicotine addiction: the possibility of a therapeutic vaccine | |
| Raleigh et al. | Attenuating nicotine’s effects with high affinity human anti-nicotine monoclonal antibodies | |
| KR20230030573A (ko) | 항-bet v1 항체를 사용하여 알러지를 치료하는 방법 | |
| Michael Owens et al. | Monoclonal antibodies as pharmacokinetic antagonists for the treatment of (+)-methamphetamine addiction | |
| Pentel et al. | Differential effects of passive immunization with nicotine-specific antibodies on the acute and chronic distribution of nicotine to brain in rats | |
| CN113474363A (zh) | 用于降低体重和/或减少食物摄取量的gdf15类似物和方法 | |
| Zheng et al. | Family of structurally related bioconjugates yields antibodies with differential selectivity against ketamine and 6-hydroxynorketamine | |
| US20220267474A1 (en) | Methods for improving circulation and treating cardiovascular disease | |
| CN116096746A (zh) | 多瘤病毒中和抗体的给药 | |
| Harwood et al. | Vaccines and depot medications for drug addiction: rationale, mechanisms of action, and treatment implications | |
| Barbosa-Mendez et al. | NIC6-TT Vaccine Attenuates Nicotine-Seeking and Expression of Nicotine-Induced Locomotor Sensitization in Rats | |
| Pashmi | Immunotherapy approach to combat nicotine addiction | |
| EA049619B1 (ru) | Способы лечения аллергии с применением антител к bet v 1 | |
| De Villiers | Active immunization against nicotine dependence | |
| Oliver | Vaccination against cotinine as a potential approach to smoking cessation | |
| Roiko | Passive immunization to treat nicotine dependence in rats | |
| Pentel | Hennepin County Medical Center and University of Minnesota |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18760233 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3072767 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2020509479 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112020002994 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2018317372 Country of ref document: AU Date of ref document: 20180814 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2018760233 Country of ref document: EP Effective date: 20200316 |
|
| ENP | Entry into the national phase |
Ref document number: 112020002994 Country of ref document: BR Kind code of ref document: A2 Effective date: 20200212 |
|
| WWG | Wipo information: grant in national office |
Ref document number: MX/A/2020/001725 Country of ref document: MX |
|
| WWG | Wipo information: grant in national office |
Ref document number: 2018760233 Country of ref document: EP |