WO2023171958A1 - 코티닌을 표적하는 항체 또는 그의 항원 결합 단편, 이를 포함하는 키메라 항원 수용체 및 이들의 용도 - Google Patents

코티닌을 표적하는 항체 또는 그의 항원 결합 단편, 이를 포함하는 키메라 항원 수용체 및 이들의 용도 Download PDF

Info

Publication number
WO2023171958A1
WO2023171958A1 PCT/KR2023/002676 KR2023002676W WO2023171958A1 WO 2023171958 A1 WO2023171958 A1 WO 2023171958A1 KR 2023002676 W KR2023002676 W KR 2023002676W WO 2023171958 A1 WO2023171958 A1 WO 2023171958A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
cotinine
binding fragment
antigen
seq
Prior art date
Application number
PCT/KR2023/002676
Other languages
English (en)
French (fr)
Inventor
이종서
이영하
이종호
김기현
Original Assignee
앱클론(주)
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 앱클론(주) filed Critical 앱클론(주)
Publication of WO2023171958A1 publication Critical patent/WO2023171958A1/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/14—Blood; Artificial blood
    • A61K35/17—Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/44—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material not provided for elsewhere, e.g. haptens, metals, DNA, RNA, amino acids
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06—Animal cells or tissues; Human cells or tissues

Definitions

  • This invention was made under project identification number 1415175509 and detailed task number 20002893 under the support of the Ministry of Trade, Industry and Energy of the Republic of Korea.
  • the specialized research management agency for the project was the Korea Institute of Industrial Technology Evaluation and Planning, and the research project name was "Bio-industry Core Technology Development Project”.
  • the name of the research project is "Development of HER2-targeted ovarian cancer treatment using innovative switchable CART technology," the host organization is AbClon Co., Ltd., and the research period is 2018.10.01 - 2022.06.30.
  • the present invention relates to antibodies targeting cotinine or antigen-binding fragments thereof, chimeric antibody receptors containing the same, and uses thereof.
  • CAR-T treatment is a genetically recombinant T-cell that activates the cytotoxicity of T-cells by introducing a receptor gene that specifically recognizes cells (cancer cells, etc.) expressing target molecules, resulting in apoptosis of target cells. It is a cell therapy that induces .
  • CAR-T treatment was recognized as a dream anticancer drug by activating the disabled immune system, showing a cure rate of about 80% in early clinical trials targeting leukemia patients who had been refractory to all existing treatments, and was approved by Novartis in August 2017. In October, Gilead subsidiary Kite Pharma's Yescarta and Kymriah, a Gilead subsidiary, were commercialized after obtaining FDA approval.
  • CRS cytokine release syndrome
  • a mediator that acts as a switch is used, which can be recognized by the chimeric antigen receptor of CAR-T and at the same time can recognize the target molecule.
  • cotinine was bound as an adapter to an antibody used in existing cancer immunotherapy, and conventional antibodies that specifically bind to cotinine were used as a switch molecule.
  • a switchable CAR-T system was built. As a result, it was possible to control the activation of CAR-T cells, which had previously been a problem, through the ON/OFF mechanism of the switch molecule.
  • cotinine with antibodies used in existing cancer immunotherapy, it was possible to create a multi-targeting CAR-T system based on various switch molecules in the form of cotinine.
  • Cotinine is a metabolite of nicotine and is not biosynthesized in the body and does not induce physiological activity, so it can be said to be highly useful as a component of a switch molecule.
  • cotinine is a metabolite of nicotine and is not biosynthesized in the body and does not induce physiological activity, so it can be said to be highly useful as a component of a switch molecule.
  • the present inventors sought to develop a new antibody capable of inducing superior cytotoxic activity compared to existing cotinine-targeted antibodies.
  • intensive research efforts were made to develop a chimeric antigen receptor using the novel antibody of the present invention.
  • a novel antibody or antigen-binding fragment thereof with very low homology compared to the CDR sequences of conventional cotinine target antibodies was developed.
  • the present invention was completed by producing a chimeric antigen receptor using a humanized antibody and an effector cell expressing the chimeric antigen receptor, and demonstrating that effective immune cell activity is induced at a higher concentration compared to a conventional cotinine target antibody. .
  • an object of the present invention is to provide a cotinine-targeted antibody or antigen-binding fragment thereof that binds more specifically to the S-isomer of cotinine.
  • Another object of the present invention is to provide a chimeric antigen receptor containing the antibody or antigen-binding fragment thereof and an effector cell thereof.
  • Another object of the present invention is to provide a pharmaceutical composition for immunotherapy containing an effector cell and a switch molecule for controlling the activation of the effector cell, and a pharmaceutical kit thereof.
  • the present invention provides inventions 1 to 27 below.
  • An antibody or antigen-binding fragment thereof that binds more specifically to the S-isomer of cotinine than to the R-isomer.
  • the antibody or antigen-binding fragment thereof includes HCDR1 containing the amino acid sequence of SEQ ID NO: 1, HCDR2 containing the amino acid sequence of SEQ ID NO: 2, and HCDR3 containing the amino acid sequence of SEQ ID NO: 3. heavy chain variable region; and
  • S-isomer of cotinine comprising a light chain variable region comprising LCDR1 comprising the amino acid sequence of SEQ ID NO: 4, LCDR2 comprising the amino acid sequence of SEQ ID NO: 5, and LCDR3 comprising the amino acid sequence of SEQ ID NO: 6
  • LCDR1 comprising the amino acid sequence of SEQ ID NO: 4
  • LCDR2 comprising the amino acid sequence of SEQ ID NO: 5
  • LCDR3 comprising the amino acid sequence of SEQ ID NO: 6
  • the antibody or antigen-binding fragment is a monoclonal antibody, polyclonal antibody, human antibody, humanized antibody, chimeric antibody, scFv, Fab, F(ab) comprising a heavy chain variable region and a light chain variable region. , and F(ab) 2 , an antibody or antigen-binding fragment thereof.
  • a nucleic acid molecule comprising a nucleotide sequence encoding the antibody or antigen-binding fragment thereof according to any one of 1 to 4.
  • nucleic acid molecule is:
  • (i) comprises the nucleotide sequence of SEQ ID NO: 12 encoding the heavy chain variable region and the nucleotide sequence of SEQ ID NO: 13 encoding the light chain variable region;
  • nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 14 encoding the heavy chain variable region and the nucleotide sequence of SEQ ID NO: 15 encoding the light chain variable region.
  • a chimeric antigen receptor comprising an antibody or antigen-binding fragment thereof that binds more specifically to the S-isomer of cotinine of any one of 1 to 4.
  • a chimeric antigen receptor effector cell expressing a chimeric antigen receptor comprising an antibody or antigen-binding fragment thereof that binds more specifically to the S-isomer of cotinine of any one of 1 to 4.
  • a switch molecule comprising:
  • a targeting moiety that binds to a cell surface molecule on a target cell (b) A targeting moiety that binds to a cell surface molecule on a target cell.
  • cell surface molecules on the target cells are HER2, CD19, EGFR, VEGFR2, CD80, CD86, mesothelin, PSMA (prostate specific membrane antigen), CD20, MUC1, and a group consisting of a combination thereof.
  • An effector cell selected from .
  • Cell effector cell
  • a pharmaceutical composition for immunotherapy containing the chimeric antigen receptor effector cell of 10 as an active ingredient.
  • a pharmaceutical kit for immunotherapy containing chimeric antigen receptor effector cells of 10 to 14 as an active ingredient.
  • a method comprising administering the chimeric antigen receptor effector cells of 10 to 14 and a switch molecule that binds to the chimeric antigen receptor to a subject in need of treatment.
  • a method comprising inhibiting the activity of a chimeric antigen receptor effector cell.
  • the method of 20 suppresses side effects caused by administration of the chimeric antigen receptor effector cell.
  • a chimeric antigen receptor-effector cell therapy system comprising 10 to 14 chimeric antigen receptor effector cells and a switch molecule that binds to the chimeric antigen receptor.
  • the present inventors developed an antibody or antigen-binding fragment thereof that can induce superior cytotoxic activity compared to conventional cotinine-targeted antibodies.
  • the chimeric antigen receptor effector cell containing a novel antibody targeting cotinine or an antigen-binding fragment thereof of the present invention induces effective immune cell activity at high concentrations depending on the type of isomer of cotinine, compared to conventional cotinine targeting antibodies. confirmed.
  • the present invention provides an antibody or antigen-binding fragment thereof that binds more specifically to the S-isomer of cotinine than to the R-isomer.
  • cotinine refers to a substance having the structure of Formula 1 below, which is the main metabolite of nicotine.
  • the cotinine is not biosynthesized in the body (de novo biosynthesis), does not cause physiological activity, does not change the characteristics of the conjugate, and is characterized by being able to bind to an antibody that specifically recognizes cotinine.
  • it has the characteristic of being easy to manufacture in the form of a carboxyl group bonded to it, making it possible to combine it with a bonding material.
  • the cotinine has stereoisomers divided into S-isomer and R-isomer.
  • the term “isomer” refers to molecules that have the same molecular formula but differ in the connection method or spatial arrangement of their members. Isomers can be broadly divided into structural isomers (constitutional isomers) and stereoisomers (stereoisomers). Structural isomers refer to compounds that have the same molecular formula, but have different connection states (type and number of bonds, type and position of functional groups, etc.) of atoms within the molecule. Stereoisomers refer to compounds in which the atoms have the same connection state, but the spatial arrangement between the atoms is different, so they do not overlap. The stereoisomers are further divided into enantiomers, optical isomers, and diastreoisomers.
  • the enantiomers refer to isomers that do not overlap with the original compound in a mirror image relationship with each other.
  • Stereoisomers other than enantiomers that is, isomers that do not have a mirror image relationship but do not overlap, are all classified as diastereomers, and these include: Geometric isomers and conformational isomers are included.
  • isomers can be classified into different compounds with different physical/chemical properties even if they have the same molecular formula. For example, even though the physical properties are the same in vivo, only one optical isomer may have physiological activity depending on the specific environment for the optical isomer due to optical activity. Therefore, the importance of each isomer having different physical/chemical properties in terms of biological or pharmaceutical role is emphasized.
  • the cotinine has stereoisomers, and its isomers are represented by substances having the structure of Formula 2 below. Since they have the same name except for being distinguished by the prefix "cis-trans” or "R-S”, they are hereinafter referred to as the S-isomer and R-isomer of cotinine.
  • cotinine a mixture of two isomers
  • the antibody and antigen-binding fragment thereof of the present invention showed the S-isomer compared to the R-isomer of cotinine. It was confirmed that it binds more specifically to .
  • the antibody or antigen-binding fragment thereof that binds more specifically to the S-isomer of cotinine of the present invention includes HCDR1 containing the amino acid sequence of SEQ ID NO: 1, and the amino acid sequence of SEQ ID NO: 2.
  • the antibody or antigen-binding fragment thereof that binds more specifically to the S-isomer of cotinine of the present invention includes (i) a heavy chain variable region and sequence comprising the amino acid sequence of SEQ ID NO: 7; It contains a light chain variable region containing the amino acid sequence number 8; or (ii) an antibody or antigen-binding fragment thereof, comprising a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 9 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 10.
  • antibody refers to an antibody that specifically binds to a specific antigen, and includes not only the complete form of the antibody but also the antigen binding fragment of the antibody molecule.
  • a complete antibody has a structure of two full-length light chains and two full-length heavy chains, and each light chain is connected to the heavy chain by a disulfide bond.
  • the constant region of an antibody is divided into a heavy chain constant region and a light chain constant region, and the heavy chain constant region is divided into gamma ( ⁇ ), mu ( ⁇ ), alpha ( ⁇ ), delta ( ⁇ ), and epsilon ( ⁇ ) types.
  • the constant region of the light chain has kappa ( ⁇ ) and lambda ( ⁇ ) types (Cellular and Molecular Immunology, Wonsiewicz, M. J., Ed., Chapter 45, pp. 41-50, W. B. Saunders Co. Philadelphia, PA (1991); Nisonoff, A., Introduction to Molecular Immunology, 2nd Ed., Chapter 4, pp. 45-65, sinauer Associates, Inc., Sunderland, MA (1984)).
  • the term “antibody” refers to an antibody that specifically binds to cotinine, which includes not only the complete antibody form but also the antigen binding fragment of the antibody molecule. Specifically, as used herein, the term “antibody” refers to an antibody that binds more specifically to the S-isomer of cotinine than to the R-isomer, which includes not only the complete antibody form but also an antigen-binding fragment of the antibody molecule (antigen binding fragment). fragment).
  • the term “antigen binding fragment” refers to a fragment that possesses an antigen-binding function, including Fab, F(ab ⁇ ), F(ab ⁇ ) 2 , and chemically linked F(ab ⁇ ). ) 2 and Fv, etc.
  • Fab fragment antigen binding
  • Fab' differs from Fab in that it has a hinge region containing one or more cysteine residues at the C-terminus of the heavy chain CH1 domain.
  • F(ab ⁇ ) 2 antibody is produced when the cysteine residue in the hinge region of Fab ⁇ forms a disulfide bond.
  • Fv is a minimal antibody fragment containing only the heavy chain variable region and the light chain variable region, and the recombinant technology to generate the Fv fragment is described in PCT International Publication Patent Applications WO 88/10649, WO 88/106630, WO 88/07085, WO 88/07086. and WO 88/09344.
  • a two-chain Fv connects the heavy chain variable region and the light chain variable region by a non-covalent bond
  • a single-chain Fv single-chain variable fragment, scFv
  • the domains can be covalently linked or linked directly at the C-terminus to form a dimer-like structure, such as double-chain Fv.
  • These antibody fragments can be obtained using proteolytic enzymes (for example, Fab can be obtained by restriction digestion of the entire antibody with papain, and F(ab ⁇ ) 2 fragments can be obtained by digestion with pepsin). ). Alternatively, it can be produced through genetic recombination technology.
  • the antibody or antigen-binding fragment thereof of the present invention is specifically in the form of an scFv or a complete antibody.
  • the heavy chain constant region may be selected from any one of the following isotypes: gamma ( ⁇ ), mu ( ⁇ ), alpha ( ⁇ ), delta ( ⁇ ), or epsilon ( ⁇ ).
  • the heavy chain constant region is gamma 1 (IgG1), gamma 2 (IgG2), gamma 3 (IgG3) or gamma 4 (IgG4), most specifically the gamma 4 (IgG4) isotype.
  • the light chain constant region can be of the kappa ( ⁇ ) or lambda ( ⁇ ) type, and is preferably the kappa ( ⁇ ) type. Accordingly, the specific antibody of the present invention is in an scFv form or an IgG4 form having a kappa ( ⁇ ) light chain and a gamma 4 (IgG4) heavy chain, but is not necessarily limited thereto.
  • the term “heavy chain” refers to a hinge chain with the variable region domain VH and the three constant region domains CH1, CH2, and CH3 of an antibody comprising an amino acid sequence with sufficient variable region sequence to confer specificity to an antigen. It refers to both the full-length heavy chain including the (hinge) and fragments thereof.
  • the term “light chain” refers to a full-length light chain comprising the variable region domain VL and the constant region domain CL of an antibody comprising an amino acid sequence with sufficient variable region sequence to confer specificity to an antigen, and It means all fragments.
  • CDR complementarity determining region
  • FR refers to variable domain residues other than hypervariable region residues.
  • FRs in variable domains generally consist of four FR domains FR1, FR2, FR3 and FR4.
  • variable region refers to the domain of an antibody heavy or light chain that is involved in binding the antibody to an antigen.
  • the variable domains (VH and VL, respectively) of the heavy and light chains of native antibodies generally have similar structures, with each domain containing four conserved framework regions and three hypervariable regions (HVR) (kindt et al., Kuby Immunology, 6th edition, W.H. Freeman and Co., page 91 (2007)).
  • HVR hypervariable regions
  • a single VH or VL domain may be sufficient to confer antigen-binding specificity.
  • antibodies that bind to a specific antigen can be separated using the VH or VL domain from antibodies that bind to the antigen and screen a library of complementary VH or VL domains, respectively.
  • the term “specifically binds” or the like means that an antibody, an antigen-binding fragment thereof, or another construct such as an scFv specifically interacts with an antigen or a corresponding substance to produce an immunological response. it means.
  • Specific binding is at least about 1 x 10 -6 M or less (e.g., 9 x 10 -7 M, 8 x 10 -7 M, 7 x 10 -7 M, 6 x 10 -7 M , 5 x 10 -7 M , 4 x 10 -7 M, 3 x 10 -7 M, 2 x 10 -7 M, or 1 x 10 -7 M), preferably 1 x 10 -7 M or less (e.g., 9 x 10 -8 M , 8 x 10 -8 M, 7 x 10 -8 M, 6 x 10 -8 M, 5 x 10 -8 M, 4 x 10 -8 M, 3 x 10 -8 M , 2 x 10 -8 M, or 1 x 10 -8 M), more preferably 1 x 10 -8 M or less (e.g., 9 x 10 -9 M, 8 x 10 -9 M, 7 x 10 -9 M , 6 x 10 -9 M , 5 x 10-9 M, 4 x 10-9 M,
  • the antibody or antigen-binding fragment thereof of the present invention may be a full-length or intact polyclonal- or monoclonal-antibody, as well as antigen-binding fragments thereof (e.g., Fab, Fab', F (ab') 2 , Fab 3 , Fv and variants thereof), fusion proteins containing one or more antibody portions, human antibodies, humanized antibodies, chimeric antibodies, minibodies, diabodies, triabodies, tetrabodies, linear Antibodies, single chain antibodies (scFv), scFv-Fc, bispecific antibodies, multispecific antibodies, glycosylation variants of antibodies as other modified configurations of immunoglobulin molecules containing antigen recognition sites of the required specificity, Includes amino acid sequence variants and covalently modified antibodies.
  • antigen-binding fragments thereof e.g., Fab, Fab', F (ab') 2 , Fab 3 , Fv and variants thereof
  • fusion proteins containing one or more antibody portions
  • modified antibodies and antigen-binding fragments thereof include nanobodies, AlbudAbs, dual affinity re-targeting (DARTs), bispecific T-cell engagers (BiTEs), tandem diabodies (TandAbs), dual acting Fabs (DAFs), two- These include in-one antibodies, small modular immunopharmaceuticals (SMIPs), fynomers fused to antibodies (FynomAbs), dual variable domain immunoglobulins (DVD-Igs), peptide modified antibodies (CovX-bodies), duobodies, and triomAbs.
  • SMIPs small modular immunopharmaceuticals
  • FynomAbs fused to antibodies
  • DVD-Igs dual variable domain immunoglobulins
  • CovX-bodies duobodies
  • triomAbs peptide modified antibodies
  • the antibody or antigen-binding fragment thereof of the present invention is a monoclonal antibody, polyclonal antibody, human antibody, humanized antibody, or chimeric antibody comprising the above-described heavy chain variable region and light chain variable region. , scFv, Fab, F(ab), and F(ab) 2 , but is not limited thereto.
  • the antibody or antigen-binding fragment thereof may be a humanized antibody.
  • humanized antibody refers to a chimeric immunoglobulin, immunoglobulin chain or fragment thereof (e.g. Fv) containing minimal sequence derived from a non-human immunoglobulin of a non-human (e.g. murine) antibody. , Fab, Fab', F(ab') 2 or other antigen-binding subsequence of an antibody).
  • humanized antibodies are such that the residues in the complementarity-determining region (CDR) of the recipient are derived from a non-human species (donor antibody), such as mouse, rat or rabbit, with the desired specificity, affinity and capacity. It is a human immunoglobulin (recipient antibody) replaced by residues from CDRs.
  • the Fv framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues.
  • humanized antibodies may contain residues that are not found in the CDR or framework sequences of the recipient antibody or donor antibody. These modifications are made to further improve and optimize antibody performance.
  • the humanized antibody will comprise substantially all of at least one, and typically two, variable domains in which all or substantially all of the CDR regions correspond to CDR regions of a non-human immunoglobulin, All or substantially all of the FR region has the sequence of the FR region of a human immunoglobulin.
  • the humanized antibody comprises at least a portion of an immunoglobulin constant region (Fc region) or substantially the constant region (Fc region) sequence of a human immunoglobulin.
  • the present invention provides a nucleic acid molecule comprising a nucleotide sequence encoding an antibody or antigen-binding fragment thereof that binds more specifically to the S-isomer of cotinine described above.
  • nucleotide sequence encoding an amino acid sequence constituting the antibody or antigen-binding fragment thereof of the present invention, and it is clear to those skilled in the art that it is not limited to any specific nucleotide sequence. This is because even if a mutation in the nucleotide sequence occurs, there are cases in which no change occurs in the protein sequence when the mutated nucleotide sequence is expressed as a protein. This is called codon degeneracy.
  • the nucleotide sequence may be a functionally equivalent codon or a codon encoding the same amino acid (e.g., due to codon degeneracy, there are six codons encoding arginine or serine), or a biologically equivalent amino acid. Contains a nucleotide sequence containing a codon.
  • the nucleic acid molecule of the present invention includes (i) the nucleotide sequence of SEQ ID NO: 12 encoding the heavy chain variable region and the nucleotide sequence of SEQ ID NO: 13 encoding the light chain variable region; or (ii) a nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 14 encoding the heavy chain variable region and the nucleotide sequence of SEQ ID NO: 15 encoding the light chain variable region.
  • nucleic acids is meant to comprehensively include DNA (gDNA and cDNA) and RNA molecules.
  • Nucleotide the basic structural unit of the nucleic acid molecule, includes not only natural nucleotides but also analogues in which sugar or base sites have been modified (Scheit, Nucleotide Analogs, John Wiley, New York (1980); Uhlman and Peyman, Chemical Reviews, 90:543-584 (1990)).
  • the nucleic acid molecule of the present invention encoding the amino acid sequence constituting the antibody and its antigen fragment is interpreted to also include a sequence showing substantial identity thereto.
  • the above substantial identity is achieved by aligning the sequence of the present invention and any other sequence to correspond as much as possible, and analyzing the aligned sequence using an algorithm commonly used in the art. refers to a sequence that exhibits at least 60% homology, more specifically at least 70% homology, even more specifically at least 80% homology, even more specifically at least 90% homology, and most specifically at least 95% homology. . Alignment methods for such sequence comparison are known in the art. Various methods and algorithms for alignment are discussed in Smith and Waterman, Adv. Appl.
  • the present invention provides a recombinant vector containing the above nucleic acid molecule.
  • vector refers to a means for expressing a gene of interest in a host cell, including a plasmid vector; cosmid vector; and viral vectors such as bacteriophage vectors, adenovirus vectors, retroviral vectors, and adeno-associated virus vectors.
  • the nucleic acid molecule encoding the anti-CD19 antibody or antigen-binding fragment thereof is operatively linked to a promoter.
  • operably linked refers to a functional linkage between a nucleic acid expression control sequence (e.g., a promoter, a signal sequence, or an array of transcriptional regulator binding sites) and another nucleic acid sequence, thereby Regulatory sequences regulate the transcription and/or translation of these other nucleic acid sequences.
  • a nucleic acid expression control sequence e.g., a promoter, a signal sequence, or an array of transcriptional regulator binding sites
  • the recombinant vector system of the present invention can be constructed through various methods known in the art, and specific methods are disclosed in Sambrook et al., Molecular Cloning, A Laboratory Manual , Cold Spring Harbor Laboratory Press (2001) , this document is incorporated herein by reference.
  • the vector of the present invention can typically be constructed as a vector for cloning or as a vector for expression. Additionally, the vector of the present invention can be constructed using prokaryotic cells or eukaryotic cells as hosts.
  • promoters derived from the genome of mammalian cells e.g., metallothionein promoter, ⁇ -actin promoter, human heroglobin promoter, and human muscle creatine promoter
  • promoters derived from mammalian viruses e.g., adenovirus late promoter, vaccinia virus 7.5K promoter, SV40 promoter, cytomegalovirus promoter, tk promoter of HSV, mouse mammary tumor virus (MMTV) promoter
  • the LTR promoter of HIV, the promoter of Moloney virus, the promoter of Epstein Barr virus (EBV), and the promoter of Roux Sarcoma virus (RSV) can be used, and generally have a polyadenylation sequence as the transcription termination sequence.
  • the vector of the present invention may be fused with other sequences to facilitate purification of the antibody or antigen-binding fragment expressed therefrom.
  • Sequences to be fused include, for example, glutathione S-transferase (Pharmacia, USA), maltose binding protein (NEB, USA), FLAG (IBI, USA), and 6x His (hexahistidine; Quiagen, USA).
  • the expression vector of the present invention contains an antibiotic resistance gene commonly used in the art as a selection marker, for example, ampicillin, gentamicin, carbenicillin, chloramphenicol, streptomycin, kanamycin, geneticin, neo.
  • antibiotic resistance gene commonly used in the art as a selection marker, for example, ampicillin, gentamicin, carbenicillin, chloramphenicol, streptomycin, kanamycin, geneticin, neo.
  • resistance genes for mycin and tetracycline are resistance genes for mycin and tetracycline.
  • the present invention includes host cells transformed with the above recombinant vector.
  • Host cells capable of stably and continuously cloning and expressing the vector of the present invention are known in the art and any host cell can be used.
  • a suitable eukaryotic host cell for the vector is monkey kidney cell 7 (COS7). kidney cells), NSO cells, SP2/0, Chinese Hamster Ovary (CHO) cells, W138, baby hamster kidney (BHK) cells, MDCK, myeloma cell line, HuT 78 cells and HEK-293 cells. Including, but not limited to.
  • transformed As used herein, the terms “transformed,” “transduced,” or “transfected” refer to the process by which an exogenous nucleic acid is transferred or introduced into a host cell.
  • a “transformed”, “transduced” or “transfected” cell is a cell that has been transformed, transduced or transfected with an exogenous nucleic acid, including that cell and progeny cells resulting from subculture thereof.
  • the present invention provides a chimeric antigen receptor comprising the above-described antibody or antigen-binding fragment thereof that specifically binds to cotinine.
  • the antibody or antigen-binding fragment thereof of the chimeric antigen receptor is an anti-cotinine antibody or antigen-binding fragment thereof.
  • a chimeric antigen receptor is provided to which an anti-cotinine antibody is linked, comprising an anti-cotinine antibody or an antigen-binding fragment thereof, a hinge domain, a transmembrane domain, and a signaling domain.
  • Chimeric Antigen Receptor refers to an effector cell signaling domain or an effector cell activation domain (e.g., a T-cell signaling domain or T-cell signaling domain). refers to an artificially produced hybrid protein or polypeptide containing a target binding domain linked to a cell activation domain). Chimeric antigen receptors (CARs) have the ability to redirect T-cell specificity and reactivity to selected targets in a non-MHC-restricted manner, generally exploiting the antigen-binding properties of monoclonal antibodies.
  • Non-MHC-restricted antigen recognition provides T-cells expressing chimeric antigen receptors the ability to recognize antigens independent of antigen processing and circumvents a key mechanism of tumor escape. Additionally, the chimeric antigen receptor, when expressed on T-cells, advantageously does not dimerize with the endogenous T-cell receptor (TCR) alpha and beta chains.
  • TCR T-cell receptor
  • the chimeric antigen receptor of the present invention refers to a "switchable chimeric antigen receptor (sCAR).
  • the extracellular domain of a conventional classical chimeric antigen receptor is a target cell. It includes an antibody or antigen-binding fragment of an antibody that directly targets a specific antigen on the surface.
  • the extracellular domain of the chimeric antigen receptor of the present invention does not directly target the cell surface antigen of the target cell, but rather the above-mentioned Cotinine (specifically, cotinine conjugated to a switch molecule) is targeted by comprising an antibody or antigen-binding fragment thereof that specifically binds to cotinine.
  • the “hinge domain” refers to a domain that connects an anti-cotinine antibody or fragment thereof and a transmembrane domain. It may include a cysteine residue, which may be involved in the binding of the hinge domain to the antibody.
  • the hinge domain may be a hinge domain derived from CD8 or CD28, a hinge domain derived from IgG1, IgG2, IgG4, or IgGD, a KIR (killer immunoglobulin-like receptor) extracellular region, or a combination thereof. It is not limited.
  • the “transmembrane domain” refers to a region that can connect the hinge domain of the chimeric antigen receptor and the signaling domain.
  • the transmembrane domain can penetrate the cell membrane of the cell such that the anti-cotinine antibody or antigen-binding fragment thereof of the chimeric antigen receptor is located on the cell surface and the signaling domain is located within the cell.
  • the transmembrane domain is T-cell receptor, CD27, CD28, CD3 epsilon ( ⁇ ), CD45, CD4, CD5, CD8 (CD8 ⁇ ), CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137 and the alpha, beta or zeta chain of CD154, but is not limited thereto.
  • the “signaling domain (intracellular signaling domain)” is a part located inside the cell membrane of an immune cell, that is, in the cytoplasm, and when an antibody or antigen-binding fragment thereof contained in the extracellular domain binds to a target antigen, it produces a signal within the cell. This refers to the area that delivers the , activating the immune response of immune cells.
  • the intracellular signaling domain of the present invention consists of CD3 zeta ( ⁇ ), CD3 gamma ( ⁇ ), CD3 delta ( ⁇ ), CD3 epsilon ( ⁇ ), FcR gamma, FcR beta, CD5, CD22, CD79a, CD79b and CD66d. It may be one or more intracellular signaling domains selected from the group, but is not limited thereto, and is preferably CD3 zeta ( ⁇ ).
  • the intracellular signaling domain according to the present invention may additionally include a co-stimulatory domain, which includes CD2, CD7, CD27, CD28, CD30, CD40, 4-1BB (CD137), OX40 ( It may be one or more co-stimulatory domains selected from the group consisting of ligands that specifically bind to CD134), ICOS, LFA-1, GITR, MyD88, DAP1, PD-1, LIGHT, NKG2C, B7-H3, and CD83. It is not limited.
  • a co-stimulatory domain which includes CD2, CD7, CD27, CD28, CD30, CD40, 4-1BB (CD137), OX40 ( It may be one or more co-stimulatory domains selected from the group consisting of ligands that specifically bind to CD134), ICOS, LFA-1, GITR, MyD88, DAP1, PD-1, LIGHT, NKG2C, B7-H3, and CD83. It is not limited.
  • the chimeric antigen receptor of the invention may comprise modified forms of the antibodies and domains as described above.
  • the modification may be performed by substituting, deleting, or adding one or more amino acids in the amino acid sequence of the wild-type antibody and domain without modifying the function of the antibody and domains.
  • the substitution may be alanine or may be performed by conservative amino acid substitution that does not affect the charge, polarity or hydrophobicity of the overall protein.
  • the present invention provides a chimeric antigen receptor effector cell that expresses a chimeric antigen receptor comprising the above-described antibody or antigen-binding fragment thereof that specifically binds to cotinine. .
  • effector cell refers to a cell transformed with a vector containing a gene encoding a chimeric antigen receptor polypeptide and expressing the introduced chimeric antigen receptor in the cell membrane.
  • effector cell refers to an immune cell of hematopoietic origin that is responsible for initiating and/or executing innate and/or adaptive immune responses.
  • the immune cells according to the present invention include immune cells such as dendritic cells, killer dendritic cells, mast cells, T cells, NKT cells, regulatory T cells, natural killer cells (NK cells), or B cells. It may be a cell, and may be obtained from bone marrow, peripheral blood, peripheral blood mononuclear cells, or umbilical cord blood.
  • the cells may be cells derived from an animal allogeneic to the subject to be administered or cells derived from autologous cells.
  • the effector cell may be a T cell, an immune cell that expresses the chimeric antigen receptor on its surface.
  • the effector cell is a form in which the antibody or antigen-binding fragment thereof of the present invention is linked, and expresses the above-described chimeric antigen receptor to target the cotinine-labeled conjugate.
  • the binding between the effector cell and the cotinine-labeled conjugate may be an antigen-antibody binding between an anti-cotinine antibody or antigen-binding fragment thereof of a chimeric antigen receptor and cotinine.
  • effector cells can bind to a cotinine-labeled conjugate, thereby inducing its activity.
  • the cotinine-labeled conjugate acts as a switch molecule that regulates the activation of the effector cell.
  • Activation of the effector cell includes exerting a cytotoxic function on target cells, secreting cytokines, and combinations thereof.
  • the activation of the chimeric antigen receptor effector cell is controlled by a switch molecule comprising:
  • a targeting moiety that binds to a cell surface molecule on a target cell (b) A targeting moiety that binds to a cell surface molecule on a target cell.
  • the targeting moiety of the switch molecule is an antibody, an antigen-binding fragment of an antibody, or a target binding polypeptide.
  • the switch molecule is a cotinine-conjugated affibody in which the S-isomer of cotinine is conjugated.
  • switch molecule refers to an effector cell using a chimeric antigen receptor that separates the target recognition domain of the chimeric antigen receptor from the cell signaling domain of the chimeric antigen receptor and mediates this. refers to an adapter molecule that The switch molecule replaces the target of the chimeric antigen receptor for a heterogenous target or resistant tumor, or regulates the administration of the switch molecule when side effects occur due to excessive activation of cells expressing the chimeric antigen receptor. It enables a decrease in activity (Cao et al., Angew Chem Int Ed Engl. 2016 June 20; 55(26): 7520-7524.).
  • target binding polypeptide refers to a non-immunoglobulin polypeptide molecule that has binding affinity for a target antigen, like an antibody, but is structurally unrelated to the antibody.
  • the target-binding polypeptide is also called an antibody-like molecule or antibody mine, and unlike antibodies, which have a molecular weight of about 150 Kda, it generally has a molecular weight of 3 KDa to 20 KDa.
  • the target-binding polypeptide is an affibody derived from the Z-domain of protein A, an affilin derived from gamma-B crystallin or ubiquitin, and an affimer derived from cystatin ( Affimer, Alphabody, Anticalin derived from lipocalin, Avimer derived from the domain of a cell membrane receptor, DARPin derived from ankyrin repeat motif, Fynomer derived from the SH3 domain of Fyn, Kunitz domain peptide derived from the Kunitz domain of a protease inhibitor, and the 10th type III domain of fibronectin.
  • cystatin Affimer, Alphabody, Anticalin derived from lipocalin, Avimer derived from the domain of a cell membrane receptor, DARPin derived from ankyrin repeat motif, Fynomer derived from the SH3 domain of Fyn, Kunitz domain peptide derived from the Kunitz domain of a protease inhibitor, and the 10
  • the target-binding polypeptide can be engineered to have binding affinity for any target antigen through various screening methods known in the art, such as phage display and ribosome display.
  • the term “Affibody” refers to the Z-domain, which is a portion of Protein A of Staphylococcus aureus that has affinity for IgG.
  • Affibody is a small protein consisting of 58 amino acid residues. In the protein sequence of this Affibody molecule, the 13 amino acids that form the binding surface for IgG are capable of binding to various target antigens depending on the amino acid sequence and are arranged randomly. It is possible to build a library. Similar to antibodies, affibody molecules that can bind to various target antigens can be selected from libraries through screening methods such as phage library and yeast two hybrid (Y2H). .
  • affibodies that specifically bind to HER2 and amyloid- ⁇ have recently been developed (Orlova et al. 2006, Cancer Res., Gronwall et al. ., 2007, J. Biotechnol.).
  • affibody has a very small molecular weight of 6 Kda, and has the characteristic of spreading systemically when administered to the human body and being rapidly eliminated through renal filtration compared to IgG-type antibodies with a molecular weight of 150 Kda. Therefore, Affibody is mainly applied to the research and development of diagnostic samples (Goldstein R et al., 2013, Expert Rev Anticancer Ther.).
  • the affibody and cotinine constituting the switch molecule may be combined by chemical conjugation.
  • the chemical conjugation may be accomplished using a chemical cross-linking agent.
  • the chemical crosslinking agents include EDC (1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride), DCC (dicyclohexyl carbodiimide), NHS (Nhydroxysuccinimide), Sulfo-NHS (N-hydroxysulfosuccinimide), imidoester-based crosslinking agent, and Sulfo-SMCC ( sulfosuccinimidyl 4-(N-maleimidomethyl)cyclohexane-1-carboxylate), etc., but is not limited thereto, and chemical crosslinking agents commonly used in the field to which the present invention pertains can be used without limitation.
  • the affibody and cotinine constituting the switch molecule can be indirectly connected through a linker.
  • fusion protein usually includes the use of linkers between the functional moieties to be fused, and other types of linkers with different characteristics, for example, flexible amino acid linkers, inflexible amino acid linkers, etc. You probably know that there are linkers and cleavable amino acid linkers. Linkers have been used to increase the expression level of fusion proteins, improve biological activity, enable targeting, change pharmacokinetics, or increase stability and improve folding of fusion proteins.
  • the present invention provides a pharmaceutical composition for immunotherapy containing the above-described chimeric antigen receptor effector cell as an active ingredient.
  • the pharmaceutical composition for immunotherapy may additionally include the above-described switch molecule to regulate the activity of chimeric antigen receptor effector cells.
  • immunotherapy refers to a method of treating cancer that helps the immune system eliminate cancer. Immunotherapy is divided into active immunotherapy and passive immunotherapy. Active immunotherapy is i) cancer vaccine therapy, which activates the immune system by injecting cancer cells or substances produced by cancer cells into the body, ii) immunomodulators such as cytokines (interferons, interleukins, etc.), growth factors, etc. It includes immunomodulatory treatment that activates specific white blood cells by administering immune-modulating agents. Passive immunotherapy includes therapeutic antibodies that bind to specific cancer cells and immune cell therapy.
  • Immune cell therapy specifically includes dendritic cell vaccine therapy, CAR-T (chimeric antigen receptor T cell) therapy, NK cell therapy (natural killer cell therapy), CTL therapy (cytotoxic T lymphocyte therapy), and adoptive cell therapy. It includes, but is not limited to, metastasis (adoptive cell transfer).
  • immunotherapy mainly refers to the above-described immune cell treatment.
  • cancer refers to a disease characterized by rapid and uncontrolled growth and proliferation of abnormal cells. Cancer cells can spread locally or through the bloodstream and lymphatic system to other parts of the body.
  • the cancers include solid tumors and non-solid tumors (e.g. hematologic malignancies such as leukemia and lymphoma).
  • tumor means an abnormal growth of tissue that may be benign, pre-cancerous, malignant, or metastatic.
  • solid tumors are abnormal tissue masses that usually do not contain cysts or areas of fluid, and can be benign or malignant.
  • Different types of solid tumors are named according to the type of cells that form the tumor (eg, sarcoma, carcinoma, and lymphoma).
  • the disease or disease targeted by the immunotherapy of the present invention may be cancer
  • the cancer may be a solid cancer or a blood cancer.
  • the solid cancer includes lung cancer, colon cancer, prostate cancer, thyroid cancer, breast cancer, brain cancer, head and neck cancer, esophagus cancer, skin cancer, melanoma, retinoblastoma, thymus cancer, stomach cancer, colon cancer, liver cancer, ovarian cancer, uterine cancer, bladder cancer, rectal cancer, It may be gallbladder cancer, biliary tract cancer, or pancreatic cancer.
  • the blood cancer may be cancer of the blood or bone marrow, for example, lymphoma, leukemia, or multiple myeloma.
  • cancer can only be treated by administering a pharmaceutical composition containing effector cells expressing the chimeric antigen receptor. Rather, efficient treatment is possible by controlling the activity of the effector cells by additionally administering a switch molecule.
  • the switch molecule of the present invention includes an affibody that specifically binds to the HER2 antigen, and diseases that can be treated using the above-described pharmaceutical composition express HER2. It can be a human and mammalian disease associated with cells that
  • the switch molecule comprising an anti-HER2 affibody bound to cotinine of the present invention and the effector cell expressing a chimeric antigen receptor targeting cotinine of the switch molecule are cancer cells overexpressing HER2 on the surface. It effectively kills OVCAR3, a cancer cell line expressing its host SKOV3 and HER2. Therefore, the effector cell expressing a chimeric antigen receptor comprising an antibody that binds more specifically to the S-isomer of cotinine or an antigen-binding fragment thereof of the present invention is used as a pharmaceutical for the treatment of carcinoma expressing HER2. It can be usefully used as an active ingredient in a composition.
  • diseases subject to the above treatment may include breast cancer, stomach cancer, ovarian cancer, rectal cancer, and endometrial cancer, but are not limited thereto.
  • the pharmaceutical composition of the present invention may additionally include a switch molecule containing a targeting moiety that binds to the cell surface molecule of the target cell, thereby preventing a wider variety of diseases by manipulating the target antigen of the targeting moiety. Alternatively, it can be used effectively for treatment.
  • Pharmaceutically acceptable carriers included in the pharmaceutical composition of the present invention are those commonly used in preparation, and include lactose, dextrose, sucrose, sorbitol, mannitol, starch, gum acacia, calcium phosphate, alginate, gelatin, and silicic acid. Contains calcium, microcrystalline cellulose, polyvinylpyrrolidone, cellulose, water, syrup, methyl cellulose, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate, and mineral oil. It is not limited.
  • the pharmaceutical composition of the present invention may further include lubricants, wetting agents, sweeteners, flavoring agents, emulsifiers, suspending agents, preservatives, etc.
  • lubricants wetting agents, sweeteners, flavoring agents, emulsifiers, suspending agents, preservatives, etc.
  • suitable pharmaceutically acceptable carriers and formulations are described in detail in Remington's Pharmaceutical Sciences ( 19th ed., 1995).
  • the pharmaceutical composition of the present invention can be administered orally or parenterally, for example, intravenous injection, subcutaneous injection, intradermal injection, intramuscular injection, intraperitoneal injection, intrasternal injection, intratumoral injection, topical administration, intranasal administration, intracerebral injection. It can be administered by intracranial administration, intrapulmonary administration, and intrarectal administration, but is not limited thereto.
  • the appropriate dosage of the pharmaceutical composition of the present invention depends on the type of disease, the severity of the disease, the type and content of the active ingredient and other ingredients contained in the pharmaceutical composition, the type of dosage form, the method of administration, and the patient's age, weight, gender, and diet. , can be adjusted according to various factors, including administration time, administration route, treatment period, and simultaneously used drugs, and a generally skilled doctor can easily determine and prescribe an effective dosage for the desired treatment.
  • the daily dosage of the pharmaceutical composition of the present invention is 0.1-9 x10 5 to 0.1-9 x10 9 CAR-positive viable cells/kg.
  • the term “pharmaceutically effective amount” refers to an amount sufficient to treat the above-mentioned disease.
  • the pharmaceutical composition of the present invention is prepared in unit dosage form by formulating it using a pharmaceutically acceptable carrier and/or excipient according to a method that can be easily performed by a person skilled in the art. Alternatively, it can be manufactured by placing it in a multi-capacity container. At this time, the formulation may be in the form of a solution, suspension, or emulsion in an oil or aqueous medium, or may be in the form of an extract, powder, suppository, powder, granule, tablet, or capsule, and may additionally contain a dispersant or stabilizer.
  • the pharmaceutical composition of the present invention also contains other pharmaceutically active agents or drugs, such as asparaginase, busulfan, carboplatin, cisplatin, daunorubicin, doxorubicin, fluorouracil, gemcitabine, in addition to the switch molecules described above. , hydroxyurea, methotrexate, paclitaxel, rituximab, vinblastine, vincristine, etc. may additionally be included, but are not limited thereto.
  • other pharmaceutically active agents or drugs such as asparaginase, busulfan, carboplatin, cisplatin, daunorubicin, doxorubicin, fluorouracil, gemcitabine, in addition to the switch molecules described above.
  • hydroxyurea, methotrexate, paclitaxel, rituximab, vinblastine, vincristine, etc. may additionally be included, but are not limited thereto.
  • the present invention provides a pharmaceutical kit for immunotherapy containing the above-described chimeric antigen receptor effector cell (effector cell) as an active ingredient.
  • the pharmaceutical kit may additionally include the above-described switch molecule to control the activation of chimeric antigen receptor effector cells.
  • the pharmaceutical kit for immunotherapy of the present invention includes the chimeric antigen receptor effector cell and switch molecule, which are another aspect of the present invention described above, so to avoid excessive complexity of the description herein, redundant The content is cited and its description is omitted.
  • the present invention provides an antibody targeting cotinine or an antigen-binding fragment thereof that binds more specifically to the S-isomer of cotinine than to the R-isomer.
  • the present invention provides a chimeric antigen receptor comprising an antibody targeting cotinine or an antigen-binding fragment thereof that binds more specifically to the S-isomer of cotinine, and an effector cell expressing the chimeric antigen receptor. (effector cells) are provided.
  • the present invention provides a switch molecule for activating an effector cell expressing the chimeric antigen receptor.
  • the present invention provides a pharmaceutical composition for immunotherapy and a pharmaceutical kit for immunotherapy comprising the chimeric antigen receptor and switch molecule.
  • Figure 1 is a diagram quantitatively confirming the binding of an antibody specific to cotinine using ELISA analysis.
  • Figure 2 is a diagram showing the cell-binding ability of a switch (trastuzumab bound to cotinine) that binds to HER2 in NCI-N87 cells, which are HER2-expressing cells, and graphing the MFI (mean fluorescence intensity) values.
  • Figure 3 is a diagram quantitatively comparing and confirming the binding of hz33B2 antibody using ELISA analysis.
  • Figure 4 is a diagram confirming the binding of hz33B2 antibody using flow cytometry analysis.
  • Figure 5 is a schematic diagram of the CAR structure containing the hz33B2 antibody and the SUN10 antibody used as a control.
  • Figure 6 is a diagram measuring the cytotoxic effect of CAR-T containing a cotinine-conjugated affibody and an anti-cotinine antibody on SKOV-3, a HER2 overexpressing cell line, and OVCAR-3, a HER2 expressing cell line.
  • Figure 7 is a diagram confirming the binding of the hz33B2 antibody to the switch to which each cotinine isomer is bound using ELISA analysis.
  • Figure 8 is a diagram confirming the binding of each cotinine isomer switch to CAR-T containing the hz33B2 antibody using flow cytometry analysis.
  • Figure 9 is a diagram measuring the cytotoxic effect of CAR-T containing a switch linked to each cotinine isomer and an anti-cotinine antibody on the SKOV-3 cell line, a HER2 overexpressing cell line.
  • % used to indicate the concentration of a specific substance means (weight/weight) % for solid/solid, (weight/volume) % for solid/liquid, and Liquid/liquid is (volume/volume) %.
  • KLH (Thermo, 77600) was coupled with cotinine using SMCC (Thermo, 22122) as a linker.
  • KLH and SMCC were each mixed at a weight ratio of 2:1 and reacted at RT for 1 hour to combine, and the remaining SMCC was removed through an ultra-centrifugal filter.
  • Cotinine was mixed with KLH combined with SMCC in a 1:1 ratio and allowed to bind at 4°C overnight.
  • 100 ⁇ g of KLH-Cotinine was mixed with Freund's adjuvant (Sigma, F5506) and injected into the abdominal cavity of BALB/c mice (Daehan Bio Co., Ltd.).
  • lymphocytes were isolated.
  • the isolated lymphocytes were mixed with myeloma cell line SP2/0-Ag14 (ATCC, CRL-1581) in a 5:1 ratio and fused using PEG-1500 (Roche, 10783641001). .
  • the fused cells were cultured in medium containing HAT supplement (Sigma, H0262), and fused cells (hybridoma) were selectively selected and cultured.
  • BSA-Cotinine which can detect antibodies that specifically bind to cotinine, was prepared using the same method as the method for producing KLH-Cotinine.
  • BSA-Cotinine at a concentration of 1 ⁇ g/mL was fixed to a Costar 96-well plate (Corning, 3590) at room temperature for 1 hour. After washing three times with TBS-T (0.05% Triton After washing the blocked plate three times with TBS-T, the selected hybridoma culture was added and an antigen-antibody reaction was performed at 37°C for 1 hour.
  • SUN10 antibody (US 2008-0226650 A1) was used as a positive control. Then, after washing three times with TBS-T, anti-mIgG-HRP (Pierce, 31439) was added as a secondary antibody diluted 1:5,000 in TBS-T/SM and reacted at 37°C for 1 hour. Next, it was washed three times with TBS-T, TMB (Surmodics, TMBC-1000-01) was added to develop color at room temperature for 5 minutes, and 1 N sulfuric acid (sulfuric acid, Duksan, 254) was further added to develop color. stopped. Absorbance was measured at 450 nm using Victor
  • 20E12, 30G5, and 33B2 were selected as antibodies that specifically bind to BSA-Cotinine.
  • NCI-N87 ATCC, CRL5822
  • a cancer cell expressing HER2 ATCC, CRL5822
  • anti-HER2 switch Trastuzumab conjugated with cotinine
  • an anti-HER2 switch was created by binding Trans-4-cotininecarboxylic acid (Sigma, 33224-01-0) to trastuzumab in the form of human IgG through EDC reaction.
  • the anti-HER2 switch was quantified using Protein assay dye (Bio-Rad, Cat. No. 500-0006), and concentration and purity were confirmed through SDS-PAGE and coomassie blue staining.
  • NCI-N87 cells were prepared at 5 x 10 5 cells/tube, and the cells were collected by centrifugation at 1,200 rpm for 3 minutes. After washing with PBS containing 5% FBS, the cells were treated with anti-HER2 switch and incubated at 4°C for 1 hour. Cells were washed three times by centrifugation at 1,200 rpm for 3 minutes using 200 ⁇ l of PBS containing 5% FBS. The hybridoma culture was then treated and incubated at 4°C for 1 hour. Cells were washed three times using the same method as above.
  • cells were treated with anti-mouse IgG-FITC (Jackson, 715-095-150) at 1 ⁇ g/mL and incubated at 4°C for 45 minutes while blocking light. Cells were washed three times using the same method as above. Cell binding of the selected antibodies was determined using a FACS device.
  • anti-mouse IgG-FITC Jackson, 715-095-150
  • Antibody that specifically binds to cotinine 33B2 order number designation order type One 33B2_HCDR1 SYWIQ PRT 2 33B2_HCDR2 EIFPGGTTYYNEKFKG PRT 3 33B2_HCDR3 GGYYYDSRAWFAY PRT 4 33B2_LCDR1 RSSTGTVTTSNYAN PRT 5 33B2_LCDR2 GTNNRAP PRT 6 33B2_LCDR3 ALWFSNHWV PRT 7 33B2_VH EVQLQQSGAELVKPGASVKLSCKTSGYTFT SYWIQ WIKQRPGQGLGWVG EIFPGTGTTYYNEKFKG KATLTIDTSSSTAYMQLSSLTSEDSAVYFCAR GGYYYDSRAWFAY WGQGTLVTVSA PRT 8 33B2_VL DAVVTQESALTTSPGETVTLTC RSSTGTVTTSNYAN WVQEKPDHLFTGLIG GTNNRAP GVPARF
  • a humanized antibody of the mouse 33B2 antibody developed in Example 1 was developed using the CDR grafting method.
  • the human antibodies to which the CDR of the developed antibody will be transplanted were selected from the V and J genes of human germline antibody genes with high similarity based on base sequence using IMGT/V-QUEST (Brochet, X. et al. , Nucl Acids Res. 36:503-508 (2008)).
  • IGHV1-46*01 and IGHJ4*03 genes were selected as the V and J genes of the heavy chain, respectively, and their similarities were 74.65% and 81.25%, respectively.
  • IGLV7-46*01 and IGLJ3*02 genes were selected as the V and J genes of the light chain, respectively, and their similarities were 63.54% and 88.24%, respectively.
  • a ClaI restriction site was added to the forward direction
  • a NheI restriction site was added to the heavy chain and a BsiWI restriction site to the light chain in the reverse direction.
  • the signal sequence shown in Table 2 below was added to the forward direction of the variable region to enable the humanized antibody to be secreted into the cell culture medium.
  • Each of the synthesized variable regions was linked to the human constant regions C ⁇ and C H , and the heavy chain portion was TA cloned into the pcDNA3.3-TOPO (Invitrogen, K8300-01) vector, and the light chain portion was cloned into pOptiVEC-TOPO (Invitrogen, TA cloning was performed using the 12744-017) vector.
  • Table 3 shows sequence information of the humanized antibody (hz33B2) that specifically binds to cotinine.
  • FreeStyle TM 293F (Invitrogen, R790-07) animal cells were transiently transfected with the cloned vector using polyethyleneimine (polyscience Inc., 23966), and Protein-A Ceramic HyperD F resin ( Humanized antibodies were purified using PALL, 20078-028).
  • Purified humanized antibodies were quantified using BCA analysis (Pierce, 23227), SDS-PAGE was performed, and concentration and purity were confirmed through coomassie blue staining.
  • Example 2 To confirm the cotinine binding ability of the humanized antibody (hz33B2) developed in Example 2, ELISA and flow cytometry were performed using a cotinine-conjugated anti-HER2 affibody.
  • the plate coated with hHER2-ECD-His protein at a concentration of 2 ⁇ g/mL was washed three times with TBS-T (0.05% Triton X-100) and then washed with 200 ⁇ l of TBS-T/SM (3% skim milk). Blocking was performed for 120 minutes at room temperature. After washing the blocked plate three times with TBS-T, cotinine-conjugated anti-HER2 affibody (ZQAA1-Cot) was fixed at a concentration of 2 ⁇ g/mL for 1 hour at room temperature. After washing the plate three times with TBS-T, the humanized antibody was diluted 1/10 from 20 ⁇ g/mL, treated to 9 points, and incubated at room temperature for 1 hour.
  • SUN10 antibody US 2008-0226650 A1
  • anti-hIgG-Fc-HRP Invitrogen, H10007
  • TMB TMB
  • OD450 value was measured using an ELISA reader.
  • cell binding affinity assay was performed using SKOV-3 expressing HER2 and anti-HER2 affibody conjugated with cotinine to evaluate the cell binding ability.
  • SKOV-3 (Korea Cell Line Bank, 30077) expressing HER2 was prepared at 2 x 10 5 cells/tube, and then centrifuged at 1,200 rpm for 3 minutes to collect the cells. Then, after washing three times with PBS containing 5% FBS, cotinine-conjugated anti-HER2 affibody (ZQAA1-Cot) was incubated at a concentration of 2 ⁇ g/mL for 1 hour at 4°C. After washing the cells three times with PBS containing 5% FBS, humanized antibodies were treated at 6 points by diluting 1/10 from 20 ⁇ g/mL and incubated at 4°C for 1 hour. Here, SUN10 antibody (US 2008-0226650 A1) was used as a positive control.
  • the cells were washed three times by centrifugation at 1,200 rpm for 3 minutes using 200 ⁇ l of PBS containing 5% FBS.
  • 1 ⁇ g/mL of anti-human-IgG-BV421 (BD, 562581) was treated as a secondary antibody and incubated at 4°C for 30 minutes while blocking light. After washing in the same manner as above, the intensity of fluorescence was measured using a FACS device.
  • a chimeric antigen receptor was developed using an anti-cotinine antibody fragment.
  • the chimeric antigen receptor consisted of the CD8 leader, anti-cotinine in scFV form, CD8 hinge and transmembrane domains, CD137 cytoplasmic domain, and CD3zeta cytoplasmic domain.
  • the pLenti6-V5/DEST lentiviral vector (Invitrogen, V53306) modified with the EF-1 alpha promoter shown in Table 4 below was digested and ligated with SpeI/XhoI.
  • EF-1 alpha promoter sequence order number designation order type 16 EF-1 alpha promoter GATGGAGTTTCCCCACACTGAGTGGGTGGAGACTGAAGTTAGGCCAGCTTGGCACTTGATGTAATTCTCCTTGGAATTTGCCCTTTTTTTGAGTTTGGATCTTGGTTCATTCTCAAGCCTCAGACAGTGGTTCAAAGTTTTTTTCTTCCATTTCAGGTGTCGTGA DNA
  • the constructed construct was confirmed through base sequence analysis, and Table 5 below shows the sequence information.
  • CAR construct sequence order number designation order type 17 CAR construct ATCGAGGTGATGTACCCTCCTCCCTATCTCGATAACGAGAAATCTAACGGCACCATCATCCATGTGAAAGGGAAACACCTCTGCCCTTCACCACTCTTCCCAGGTCCGAGCAAGCCAATTTATATCTGGGCACCGTTGGCGGGGACTTGCGGAGTGCTTTTACTTTCACTGGTTATTACGCTGTACTGTAAACGCGGTCGGAAGAAGCTCCTTTACATTTTCAAGCAGCCTTTTATGCGCCCAGTGCAGACCACACA GGAGGAAGATGGCTGTAGTTGCAGATTTCCCGAGGAAGAAGAGGGGAGGGTGTGAACTGAGAGTCAAATTCAGCCGTTCCGCTGATGCCCCAGCCTATCAACAGGGGGGCAGAATCAACTGTATAATGAATTGAATCTGGGCAGGAGAAGAATACGACGTCCTGGATAAGAGGCGAGGCAGAGACCCCGAGATGGGCGGTAAACCCCGGCGGAAGAACCCCCAGGAAGGCCTGTACAAC
  • the prepared lentiviral construct was used as Lenti- (Takara Bio Incl., 632180) was transduced into cell lines. Transduction was performed using Lipofectamine 2000 (Invitrogen, 11668019) according to the manufacturer's protocol. After 72 hours, the culture medium containing the lentivirus was concentrated 10 times using a centrifugal filter device (Millipore, UFC910024) and stored frozen at -80°C.
  • cytotoxic T cells displaying a chimeric antigen receptor containing an anti-cotinine antibody fragment on their surface were prepared.
  • human naive T cells were isolated and stimulated with Dynabeads TM Human T-Activator CD3/CD28 (Thermofisher scientific, 11131D) for 24 hours, and polybrene (Sigma-Aldrich, H9268) and the lentivirus were added to the cells. The cells were cultured for 24 hours and transfected. Afterwards, the medium was replaced with IL-2 (Gibco, CTP0021) and cultured under conditions of 5% CO 2 and 37°C. T cells displaying chimeric antigen receptors containing the prepared anti-cotinine antibody fragment on their surface were used in subsequent experiments within 24 hours after preparation.
  • IL-2 Gibco, CTP0021
  • Example 4.2 Using the anti-HER2 affibody combining CAR-T and cotinine prepared in Example 4.2, it was confirmed whether this complex induces activation of chimeric antigen receptor cells by recognizing HER2 on the cell surface. .
  • a lentivirus (Biosettia, GlowCell-16p-1) expressing GFP-Luciferase was introduced into SKOV-3, a HER2-overexpressing cell line, and OVCAR-3, a HER2-expressing cell line, to produce the transgenic cell lines SKOV3-Luc and OVCAR3-Luc.
  • Cell lines were constructed and used in experiments.
  • the SKOV3-Luc cell line and OVCAR3-Luc cell line were distributed in a 96-well plate at 1 x 10 4 cells per well. Cytotoxic T cells prepared were added to the plate on which the Luc cell line was distributed so that the ratio of SKOV3-Luc or OVCAR3-Luc:cytotoxic T cells per well was 2:1 (cell number ratio).
  • Cotinine-conjugated anti-HER2 affibody was added at appropriate concentrations (0.1, 1, 10, 100 nM) to the test group treated with Luc cell line and cytotoxic T cells, and incubated for 24 hours under conditions of 5% CO 2 and 37°C. It was cultured for some time.
  • SUN10-CAR-T cells US 2008-0226650 A1
  • the toxic effect of cytotoxic T cells was confirmed through luciferase measurement (Bio-Glo Luciferase assay system, Promega, G7941).
  • SKOV3-Luc or OVCAR3-Luc cell lines were lysed in 3X Lysis buffer (75mM Tris (pH8.0), 30% glycerol, 3% Triton ) and confirmed by reacting the eluted luciferase with the substrate. Lysis rate was determined based on the signal (100%) from wells cultured only with the Luc cell line.
  • Cotinine a mixture of two isomers, was separated into two single isomers using a chiral column. Each isolated isomer was determined to be an R-isomer and an S-isomer through crystal structure analysis. Two switches were synthesized by binding the isolated isomers to the anti-HER2 affibody ZQAA1: ZQAA1-Cot(R) and ZQAA1-Cot(S).
  • the plate coated with hHER2-ECD-His protein at a concentration of 2 ⁇ g/mL was washed three times with TBS-T (0.05% Triton X-100) and then washed with 200 ⁇ l of TBS-T/SM (3% skim milk). Blocked for 120 minutes at room temperature. After washing the blocked plate three times with TBS-T, two anti-HER2 switches each containing different cotinine isomers were fixed at a concentration of 2 ⁇ g/mL for 1 hour at room temperature. Afterwards, the plate was washed three times with TBS-T, and humanized antibodies were added at 1/10 dilution from 20 ⁇ g/mL to 9 points, and incubated at room temperature for 1 hour. After treatment with the secondary antibody, anti-hIgG-Fc-HRP (Invitrogen, H10007) at room temperature for 1 hour, TMB was added to perform a color development reaction. Next, the OD450 value was measured using an ELISA reader.
  • CAR-T containing the anti-cotinine antibody of the present invention has a high binding ability with the anti-HER2 switch (ZQAA1-Cot(S)) to which the S-isomer of cotinine is bound.
  • ZQAA1-Cot(S) ZQAA1-Cot(S)
  • I was able to confirm. This showed the same or higher level of binding ability compared to the results for the anti-HER2 switch (ZQAA1-Cot) to which mixed forms of cotinine were bound, and moreover, at high concentrations, the binding capacity to the S-type cotinine isomer was slightly higher. found to be high.
  • the h33B2-CART prepared in Example 4.2 was prepared at 2 x 10 5 cells/tube, and then centrifuged at 1,200 rpm for 3 minutes to collect the cells. After washing with PBS containing 5% FBS, two types of anti-HER2 switches were added at a concentration of 2 ⁇ g/mL and incubated at 4°C for 1 hour. After the cells were washed in the same manner as above, HER2-ECD-Fc was added at a concentration of 2 ⁇ g/mL and incubated at 4°C for 1 hour. Then, the cells were washed three times by centrifuging at 1,200 rpm for 3 minutes using 200 ⁇ l of PBS containing 5% FBS.
  • the CAR-T containing anti-cotinine of the present invention has a high binding ability with the anti-HER2 switch (ZQAA1-Cot(S)) to which the S-isomer of cotinine is bound. I was able to. In particular, while it showed the same or higher level of binding ability compared to the anti-HER2 switch (ZQAA1-Cot) to which mixed cotinine was bound, it was found to have almost no binding ability to the R-isomer of cotinine. This was confirmed to be identical to the ELISA assay results above.
  • the SKOV3-Luc cell line was distributed in a 96-well plate at 1 x 10 4 cells per well.
  • the prepared cytotoxic T cells were added to the plate on which the Luc cell line was dispensed at a ratio of SKOV3-Luc:cytotoxic T cells per well of 1:2.
  • the above two anti-HER2 affibodies were added at appropriate concentrations (0.0001, 0.001, 0.01, 0.1, 1, 10, and 100 nM), and 5% CO 2 and cultured at 37°C for 24 hours.
  • cytotoxic T cells and cytotoxicity were confirmed through luciferase measurement (Bio-Glo Luciferase assay system, Promega, G7941). Its cytotoxic effect is demonstrated after culturing cytotoxic T cells, cotinine-conjugated Affibody and Luc cell lines, and lysing the remaining SKOV3-Luc cell line with 3X Lysis buffer (75mM Tris (pH8.0), 30% glycerol, 3% Triton ) and confirmed by reacting the eluted luciferase with the substrate. Lysis rate was determined based on the signal (100%) from wells cultured only with the Luc cell line.
  • 3X Lysis buffer 75mM Tris (pH8.0), 30% glycerol, 3% Triton
  • the anti-cotinine antibody of the present invention shows differences in cotinine binding ability and cytotoxic activity of CAR-T using the same depending on the type of cotinine isomer.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Medicinal Chemistry (AREA)
  • Biomedical Technology (AREA)
  • Genetics & Genomics (AREA)
  • Zoology (AREA)
  • Cell Biology (AREA)
  • Public Health (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biotechnology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Biochemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Microbiology (AREA)
  • Wood Science & Technology (AREA)
  • Biophysics (AREA)
  • Epidemiology (AREA)
  • Hematology (AREA)
  • Virology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Toxicology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Mycology (AREA)
  • Developmental Biology & Embryology (AREA)
  • General Engineering & Computer Science (AREA)
  • Peptides Or Proteins (AREA)

Abstract

본 발명은 코티닌을 표적하는 항체 또는 그의 항원 결합 단편, 이를 포함하는 키메라 항체 수용체 및 이들의 용도에 관한 것이다. 본 발명의 항체는 코티닌에 특이적으로 결합하는 항체로서, 특히, 코티닌의 R-이성질체에 비하여, S-이성질체에 더 특이적으로 결합하는 항체이다. 또한, 종래의 코티닌 타겟 항체들의 CDR 서열과 비교하여 상동성이 매우 낮아, 그 서열의 독특함이 있다. 본 발명의 항-코티닌 항체 또는 항원 결합 단편을 포함하는 키메라 항원 수용체를 발현하는 세포는 코티닌이 결합된 스위치에 결합하여, 이의 표적하는 세포주에 반응함으로써 면역세포 활성을 유도한다. 따라서, 본 발명의 항체 또는 그의 항원 결합 단편을 이용하는 경우, 코티닌-매개의 키메라 항원 수용체 이펙터 세포의 활성화 조절을 통해 T 세포의 과활성으로 인한 면역 부작용을 억제할 수 있을 뿐 아니라, CAR-면역 세포 치료제로서 유용하게 사용할 수 있다.

Description

코티닌을 표적하는 항체 또는 그의 항원 결합 단편, 이를 포함하는 키메라 항원 수용체 및 이들의 용도
본 발명은 대한민국 산업통상자원부의 지원 하에서 과제고유번호 1415175509, 세부과제번호 20002893에 의해 이루어진 것으로서, 상기 과제의 연구관리 전문기관은 한국산업기술평가관리원, 연구사업명은 "바이오산업핵심기술개발사업", 연구과제명은 "혁신 스위처블 CART 기술을 이용한 HER2 표적 난소암 치료제 개발", 주관기관은 앱클론㈜, 연구기간은 2018.10.01-2022.06.30이다.
본 특허출원은 2022년 3월 11일에 대한민국 특허청에 제출된 대한민국 특허출원 제10-2022-0031019호, 2022년 9월 6일에 대한민국 특허청에 제출된 대한민국 특허출원 제10-2022-0113082호에 대하여 우선권을 주장하며, 상기 특허출원의 개시사항은 본 명세서에 참조로서 삽입된다.
본 발명은 코티닌을 표적하는 항체 또는 그의 항원 결합 단편, 이를 포함하는 키메라 항체 수용체 및 이들의 용도에 관한 것이다.
본 명세서 전체에 걸쳐 다수의 논문 및 특허문헌이 참조되고 그 인용이 표시되어 있다. 인용된 논문 및 특허문헌의 개시 내용은 그 전체로서 본 명세서에 참조로 삽입되어 본 발명이 속하는 기술 분야의 수준 및 본 발명의 내용이 보다 명확하게 설명된다.
면역세포 중 하나인 T-세포는 인간 및 동물에서 세포-매개 면역에 중요한 역할을 수행하는 것으로 잘 알려져 있다. CAR-T 치료제는 유전자가 재조합된 T-세포로, 표적분자를 발현하는 세포(암세포 등)를 특이적으로 인식하는 수용체 유전자를 도입하여 T-세포의 세포독성을 활성화시킴으로써, 표적세포의 세포사멸을 유도하는 세포치료제이다. 특히, CAR-T 치료제는 무력화된 면역시스템을 활성화시킴으로써, 기존 모든 치료에 불응했던 백혈병 환자를 대상으로 한 초기 임상시험에서 약 80%의 치료율을 보이며 꿈의 항암제로 인식되었고, 2017년 8월 Novartis 사의 킴리아와 10월 길리어드 자회사인 Kite Pharma의 예스카타가 FDA 승인을 획득하면서 상용화되었다.
하지만, 이러한 초기 단계의 성공적인 임상 효능에도 불구하고, 기존의 CAR-T 세포는 생체 내에서의 활성화 및 확장에 대한 제어가 불가하기에, 이에 대한 안정성 문제가 꾸준히 제기되고 있는 상황이다. 예를 들어, CAR-T 세포는 체내에서 오랜 기간 지속할 수 있어 잠재적인 위험성에 대한 우려가 있으며, 사이토카인 방출 증후군(cytokine release syndrome; CRS)으로 인한 심각한 증세를 초래할 수 있다. 이에, CAR-T 세포의 활성을 조절할 수 있는 스위치 기능을 부여하여 기존 CAR-T 치료제의 문제점을 극복한 차세대 CAR-T 플랫폼인 switchable CAR-T가 새롭게 개발되었다.
Switchable CAR-T 시스템에서 스위치 역할을 하는 매개체는 CAR-T의 키메라 항원 수용체에 의해 인지될 수 있는 동시에, 표적 분자를 인지할 수 있는 물질이 사용된다. 예를 들어, 최근 연구에서 기존의 암 면역요법에 사용되는 항체에 코티닌(cotinine)을 어댑터로서 결합시키고, 이를 스위치 분자(switch molecule)로 이용하여 코티닌에 특이적으로 결합하는 종래의 항체들을 활용한 switchable CAR-T 시스템을 구축하였다. 이로써, 스위치 분자의 ON/OFF 기작을 통하여, 기존의 문제로 제기되었던 CAR-T 세포의 활성화 조절을 가능케 하였다. 또한, 코티닌을 기존의 암 면역요법에 사용되는 항체에 결합시켜 사용함으로써, 코티닌이 결합된 형태의 다양한 스위치 분자에 따른 다표적형(multi-targeting) CAR-T 시스템의 제작을 가능케 하였다.
코티닌(cotinine)은 니코틴의 대사 산물로서, 체내에서 생합성되지 않고 생리적 활성도 유발하지 않으므로, 스위치 분자의 구성 요소로서의 유용성이 뛰어나다고 할 수 있다. 그러나, 코티닌을 스위치 분자의 어댑터로 이용하는 스위처블 CAR 시스템을 개선하기 위해서는 보다 우수한 세포독성 활성을 유도할 수 있는 개선된 코티닌 특이적 항체의 개발이 필요한 실정이다.
본 발명자들은 기존의 코티닌 타겟 항체들과 비교하여 보다 우수한 세포독성 활성을 유도할 수 있는 신규 항체를 개발하고자 하였다. 또한, 본 발명의 신규 항체를 활용한 키메라 항원 수용체를 개발하고자 예의 연구 노력하였다. 그 결과, 종래의 코티닌 타겟 항체들의 CDR 서열과 비교하여 상동성이 매우 낮은, 신규한 항체 또는 그의 항원 결합 단편을 개발하였다. 또한, 이의 인간화 항체를 활용한 키메라 항원 수용체 및 상기 키메라 항원 수용체를 발현하는 효과기 세포를 제조하여, 종래의 코티닌 타겟 항체에 비해 고농도에서 효과적인 면역세포 활성이 유도되는 것을 규명함으로써, 본 발명을 완성하였다.
따라서, 본 발명의 목적은 코티닌의 S-이성질체에 보다 특이적으로 결합하는, 코티닌 타겟의 항체 또는 그의 항원 결합 단편을 제공하는 것이다.
본 발명의 다른 목적은 상기 항체 또는 그의 항원 결합 단편을 포함하는 키메라 항원 수용체 및 이의 이펙터 세포(effector cell)를 제공하는 것이다.
본 발명의 또 다른 목적은 상기 이펙터 세포(effector cell)의 활성화를 조절하기 위한 스위치 분자(switch molecule) 및 이펙터 세포를 포함하는 면역 치료용 약제학적 조성물 및 이의 약제학적 키트를 제공하는 것이다.
본 발명은 하기 1 내지 27의 발명을 제공한다.
1. 코티닌의 R-이성질체에 비하여, S-이성질체에 더 특이적으로 결합하는 항체 또는 그의 항원 결합 단편.
2. 1에 있어서 상기 항체 또는 그의 항원 결합 단편은, 서열번호 1의 아미노산 서열을 포함하는 HCDR1, 서열번호 2의 아미노산 서열을 포함하는 HCDR2, 및 서열번호 3의 아미노산 서열을 포함하는 HCDR3를 포함하는 중쇄가변 영역; 및
서열번호 4의 아미노산 서열을 포함하는 LCDR1, 서열번호 5의 아미노산 서열을 포함하는 LCDR2, 및 서열번호 6의 아미노산 서열을 포함하는 LCDR3를 포함하는 경쇄가변 영역을 포함하는, 코티닌의 S-이성질체에 더 특이적으로 결합하는 항체 또는 그의 항원 결합 단편.
3. 1에 있어서, 상기 항체 또는 그의 항원 결합 단편은,
(i) 서열번호 7의 아미노산 서열을 포함하는 중쇄가변 영역 및 서열번호 8의 아미노산 서열을 포함하는 경쇄가변 영역을 포함하거나; 또는
(ii) 서열번호 9의 아미노산 서열을 포함하는 중쇄 가변 영역 및 서열번호 10의 아미노산 서열을 포함하는 경쇄가변 영역을 포함하는, 코티닌의 S-이성질체에 특이적으로 결합하는 항체 또는 그의 항원 결합 단편.
4. 1에 있어서, 상기 항체 또는 항원 결합 단편은 중쇄 가변영역 및 경쇄 가변 영역을 포함하는 모노클로날 항체, 폴리클로날 항체, 인간 항체, 인간화 항체, 키메라 항체, scFv, Fab, F(ab), 및 F(ab)2로 이루어진 군으로부터 선택되는 것인, 항체 또는 그의 항원 결합 단편.
5. 1 내지 4 중 어느 하나에 따른 항체 또는 그의 항원 결합 단편을 인코딩하는 뉴클레오타이드 서열을 포함하는 핵산 분자.
6. 5에 있어서, 상기 핵산 분자는,
(i) 중쇄가변 영역을 인코딩하는 서열번호 12의 뉴클레오타이드 서열 및 경쇄가변 영역을 인코딩하는 서열번호 13의 뉴클레오타이드 서열을 포함하거나; 또는
(ii) 중쇄가변 영역을 인코딩하는 서열번호 14의 뉴클레오타이드 서열 및 경쇄가변 영역을 인코딩하는 서열번호 15의 뉴클레오타이드 서열을 포함하는, 핵산 분자.
7. 5의 핵산 분자를 포함하는 재조합 벡터.
8. 7의 재조합 벡터를 포함하는 숙주세포.
9. 1 내지 4 중 어느 하나의 코티닌의 S-이성질체에 더 특이적으로 결합하는 항체 또는 그의 항원 결합 단편을 포함하는 키메라 항원 수용체.
10. 1 내지 4 중 어느 하나의 코티닌의 S-이성질체에 더 특이적으로 결합하는 항체 또는 그의 항원 결합 단편을 포함하는 키메라 항원 수용체를 발현하는, 키메라 항원 수용체 이펙터 세포(effector cell).
11. 10에 있어서, 상기 키메라 항원 수용체 이펙터 세포는 다음을 포함하는 스위치 분자(switch molecule)에 의해 활성화 조절이 되는 것인, 키메라 항원 수용체 이펙터 세포(effector cell):
(a) 코티닌의 S-이성질체, 및
(b) 표적세포 상에서 세포 표면 분자에 결합하는 표적화 모이어티(targeting moiety).
12. 11에 있어서, 상기 표적세포 상의 세포 표면 분자는 HER2, CD19, EGFR, VEGFR2, CD80, CD86, 메소텔린(mesothelin), PSMA(prostate specific membrane antigen), CD20, MUC1 및 이들의 조합으로 이루어진 군에서 선택되는 것인, 이펙터 세포.
13. 11에 있어서, 상기 활성화 조절을 위한 스위치 분자(switch molecule)를 구성하는 표적화 모이어티는 항체, 항체의 항원 결합 단편, 또는 타겟 결합 폴리펩타이드(target binding polypeptide)인 것인, 키메라 항원 수용체 이펙터 세포(effector cell).
14. 13에 있어서, 상기 활성화 조절을 위한 스위치 분자는 S-이성질체의 코티닌이 접합된 코티닌-접합 어피바디(cotinine-conjugated affibody)인 것인, 키메라 항원 수용체 이펙터 세포(effector cell).
15. 10의 키메라 항원 수용체 이펙터 세포(effector cell)를 유효성분으로 포함하는 면역 치료용 약제학적 조성물.
16. 10 내지 14의 키메라 항원 수용체 이펙터 세포(effector cell)를 유효성분으로 포함하는 면역 치료용 약제학적 키트.
17. 10 내지 14의 키메라 항원 수용체 이펙터 세포 및 상기 키메라 항원 수용체와 결합하는 스위치 분자를 치료가 필요한 대상체에 투여하는 단계를 포함하는 방법.
18. 17에 있어서, 상기 방법은 종양 또는 암과 관련된 질병 또는 상태를 치료하는 방법.
19. 17에 있어서, 상기 방법은 자기면역과 관련된 질병 또는 상태를 치료하는 방법.
20. 10 내지 14의 키메라 항원 수용체 이펙터 세포 및 상기 키메라 항원 수용체와 결합하는 스위치 분자를 치료가 필요한 대상체에 투여하는 단계; 및
키메라 항원 수용체 이펙터 세포의 활성을 억제하는 단계를 포함하는 방법.
21. 20의 방법은 키메라 항원 수용체 이펙터 세포의 투여로 인한 부작용을 억제하는 것인, 방법.
22. 20에 있어서, 키메라 항원 수용체 이펙터 세포의 활성을 억제하는 단계는, 키메라 항원 수용체에 결합하는 물질을 첨가하는 것인 방법.
23. 22에 있어서, 키메라 항원 수용체에 결합하는 물질은 코티닌인 것, 바람직하게는 S-코티닌닌인, 방법.
24. 20에 있어서, 키메라 항원 수용체 이펙터 세포의 활성을 억제하는 단계는, 스위치 분자에 결합하는 물질을 첨가하는 것인, 방법.
25. 24에 있어서, 스위치 분자에 결합하는 물질은, 코티닌과 결합하는 단리된 항체 또는 항원 결합 단편인 것인, 방법.
26. 24에 있어서, 스위치 분자에 결합하는 물질은, 스위치 분자의 표적화 모이어티에 결합하는 단리된 표적 세포의 표면 분자인 것인, 방법.
27. 10 내지 14의 키메라 항원 수용체 이펙터 세포 및 상기 키메라 항원 수용체와 결합하는 스위치 분자를 포함하는 키메라 항원 수용체-이펙터 세포 치료 시스템.
본 발명자들은 종래의 코티닌 타겟 항체들과 비교하여, 보다 우수한 세포 독성 활성을 유도할 수 있는 항체 또는 그의 항원 결합 단편을 개발하였다.
특히, 본 발명의 코티닌을 타겟하는 신규 항체 또는 그의 항원 결합 단편을 포함하는 키메라 항원 수용체 이펙터 세포는, 종래의 코티닌 타겟 항체에 비해, 코티닌의 이성질체의 종류에 따라 고농도에서 효과적인 면역세포 활성을 유도하는 것을 확인하였다.
본 발명의 일 양태에 따르면, 본 발명은 코티닌의 R-이성질체에 비하여 S-이성질체에 더 특이적으로 결합하는 항체 또는 그의 항원 결합 단편을 제공한다.
본 명세서에서, 용어 "코티닌(cotinine)"은 니코틴의 주요 대사 산물로서, 하기 화학식 1의 구조를 갖는 물질을 의미한다.
[화학식 1]
Figure PCTKR2023002676-appb-img-000001
상기 코티닌(cotinine)은 체내에서 생합성(de novo biosynthesis)되지 않고, 생리적 활성을 유발하지 않아 접합물질의 특성을 변화시키지 않으며, 코티닌을 특이적으로 인지하는 항체와 결합할 수 있는 것을 특징으로 한다. 또한, 카르복실기가 결합된 형태로 제조가 용이하여 접합물질과의 결합이 가능하다는 특징을 가진다.
상기 코티닌(cotinine)은 S-이성질체 및 R-이성질체로 구분되는 입체이성질체를 갖는다.
본 명세서에서, 용어 "이성질체(isomer)"는 분자식은 같으나 구성원자의 연결방식이나 공간적인 배열이 서로 다른 분자들을 의미한다. 이성질체는 크게 구조 이성질체(constitutional isomer 또는 structural isomer) 및 입체이성질체(stereoisomer)로 나눌 수 있다. 구조 이성질체는 분자식은 같으나, 분자 내 원자들의 연결 상태(결합의 종류, 수, 작용기의 종류 및 위치 등)가 다른 화합물을 지칭한다. 입체이성질체는 원자들의 연결 상태는 같지만, 원자 사이의 공간 배열이 달라 서로 겹쳐지지 않는 화합물을 지칭한다. 상기 입체이성질체(stereoisomer)는 다시 거울상 이성질체(enantiomer) 또는 광학 이성질체(optical isomer), 및 부분입체이성질체(diastreoisomer)로 구분된다. 상기 거울상 이성질체는 서로 거울상의 관계에 있어 원래 화합물과 겹쳐지지 않는 이성질체를 지칭한다.거울상 이성질체 이외의 입체이성질체, 즉, 거울상의 관계는 아니지만 겹쳐지지 않는 이성질체는 모두 부분입체이성질체로 구분하고, 여기에는 기하 이성질체(geometric isomer) 및 형태 이성질체(conformational isomer)가 포함된다.
따라서, 이성질체는 같은 분자식을 가지더라도 결과적으로 상이한 물리/화학적 성질을 갖는 다른 화합물로 구분될 수 있다. 예를 들어, 생체 내에서 물리적 성질이 같음에도 광학 활성에 의한 광학 이성질체에 대한 특이적 환경에 따라 한가지 광학 이성질체만 생리적 활성을 가질 수 있다. 그러므로, 상이한 물리/화학적 성질을 갖는 각 이성질체의 생물학적 또는 약학적 역할의 측면에서 그 중요성이 강조된다.
상기 코티닌은 입체이성질체를 가지며, 이의 이성질체는 하기 화학식 2의 구조를 갖는 물질로 나타낸다. 이는 접두사 "시스-트랜스(cis-trans)" 또는 "R-S"로 구분되는 것을 제외하면 같은 이름을 가지므로, 이하 본 명세서에서는 코티닌의 S-이성질체 및 R-이성질체로 명시된다.
[화학식 2]
Figure PCTKR2023002676-appb-img-000002
본 발명의 일 실시예에서, 두 개의 이성질체가 혼합된 코티닌을 chiral column을 이용하여 2개의 단일 이성질체로 분리하였고, 본 발명의 항체 및 그의 항원 결합 단편이 코티닌의 R-이성질체에 비해, S-이성질체에 더 특이적으로 결합하는 것을 확인하였다.
본 발명의 일 구현예에 있어서, 본 발명의 코티닌의 S-이성질체에 더 특이적으로 결합하는 항체 또는 그의 항원 결합 단편은, 서열번호 1의 아미노산 서열을 포함하는 HCDR1, 서열번호 2의 아미노산 서열을 포함하는 HCDR2, 및 서열번호 3의 아미노산 서열을 포함하는 HCDR3를 포함하는 중쇄가변 영역; 및 서열번호 4의 아미노산 서열을 포함하는 LCDR1, 서열번호 5의 아미노산 서열을 포함하는 LCDR2, 및 서열번호 6의 아미노산 서열을 포함하는 LCDR3를 포함하는 경쇄가변 영역을 포함하는, 항체 또는 그의 항원 결합 단편이다.
본 발명의 구체적인 일 구현예에 있어서, 본 발명의 코티닌의 S-이성질체에 더 특이적으로 결합하는 항체 또는 그의 항원 결합 단편은, (i) 서열번호 7의 아미노산 서열을 포함하는 중쇄가변 영역 및 서열번호 8의 아미노산 서열을 포함하는 경쇄가변 영역을 포함하거나; 또는 (ii) 서열번호 9의 아미노산 서열을 포함하는 중쇄 가변 영역 및 서열번호 10의 아미노산 서열을 포함하는 경쇄가변 영역을 포함하는, 항체 또는 그의 항원 결합 단편이다.
본 명세서에서, 용어 "항체(antibody)"는 특정 항원에 특이적으로 결합하는 항체로서, 완전한 항체 형태뿐만 아니라 항체 분자의 항원 결합 단편(antigen binding fragment)을 포함한다. 완전한 항체는 2개의 전장(full length) 경쇄 및 2개의 전장 중쇄를 가지는 구조이며 각각의 경쇄는 중쇄와 다이설파이드 결합으로 연결되어 있다. 항체의 불변 영역(constant region)은 중쇄 불변 영역과 경쇄 불변 영역으로 나뉘어지며, 중쇄 불변 영역은 감마(γ), 뮤(μ), 알파(α), 델타(δ) 및 엡실론(ε) 타입을 가지고, 서브 클래스로 감마1(γ1), 감마2(γ2), 감마3(γ3), 감마4(γ4), 알파1(α1) 및 알파2(α2)를 가진다. 경쇄의 불변 영역은 카파(κ) 및 람다(λ) 타입을 가진다(Cellular and Molecular Immunology, Wonsiewicz, M. J., Ed., Chapter 45, pp. 41-50, W. B. Saunders Co. Philadelphia, PA(1991); Nisonoff, A., Introduction to Molecular Immunology, 2nd Ed., Chapter 4,pp. 45-65, sinauer Associates, Inc., Sunderland, MA (1984)).
본 명세서에서, 상기 용어 "항체(antibody)"는 코티닌(cotinine)에 특이적으로 결합하는 항체로서, 이는 완전한 항체 형태 뿐만 아니라 항체 분자의 항원 결합 단편(antigen binding fragment)을 포함한다. 구체적으로 본 명세서에서, 용어 "항체"는 코티닌(cotinine)의 R-이성질체에 비하여, S-이성질체에 더 특이적으로 결합하는 항체로서, 이는 완전한 항체 형태 뿐만 아니라 항체 분자의 항원 결합 단편(antigen binding fragment)을 포함한다.
본 명세서에서, 용어 "항원 결합 단편(antigen binding fragment)"은 항원 결합 기능을 보유하고 있는 단편을 의미하며, Fab, F(ab´), F(ab´)2, 화학적으로 연결된 F(ab´)2 및 Fv 등을 포함한다. 항체 단편 중 Fab(fragment antigen binding)는 경쇄 및 중쇄의 가변 영역과 경쇄의 불변 영역 및 중쇄의 첫 번째 불변 영역(CH1)을 가지는 구조로 1개의 항원 결합 부위를 가진다. Fab´는 중쇄 CH1 도메인의 C-말단에 하나 이상의 시스테인 잔기를 포함하는 힌지 영역(hinge region)을 가진다는 점에서 Fab와 차이가 있다. F(ab´)2 항체는 Fab´의 힌지 영역의 시스테인 잔기가 다이설파이드 결합을 이루면서 생성된다. Fv는 중쇄 가변부위 및 경쇄 가변부위만을 가지고 있는 최소의 항체조각으로서, Fv 단편을 생성하는 재조합 기술은 PCT 국제 공개특허출원 WO 88/10649, WO 88/106630, WO 88/07085, WO 88/07086 및 WO 88/09344에 게시되어 있다. 이중쇄 Fv(two-chain Fv)는 비공유 결합으로 중쇄 가변부위와 경쇄 가변부위가 연결되어 있고 단쇄 Fv(single-chain variable fragment, scFv)는 일반적으로 펩타이드 링커를 통하여 중쇄의 가변 영역과 단쇄의 가변 영역이 공유 결합으로 연결되거나 또는 C-말단에서 바로 연결되어 있어서 이중쇄 Fv와 같이 다이머와 같은 구조를 이룰 수 있다. 이러한 항체 단편은 단백질 가수분해 효소를 이용해서 얻거나(예를 들어, 전체 항체를 파파인(papain)으로 제한 절단하면 Fab를 얻을 수 있고, 펩신으로 절단하면 F(ab´)2 단편을 얻을 수 있다). 또는 유전자 재조합 기술을 통하여 제작할 수 있다.
본 발명의 항체 또는 이의 항원 결합 단편은 구체적으로 scFv 형태이거나 완전한 항체 형태이다. 또한, 중쇄 불변 영역은 감마(γ), 뮤(μ), 알파(α), 델타(δ) 또는 엡실론(ε) 중의 어느 한 이소타입(isotype)으로부터 선택될 수 있다. 바람직하게, 중쇄 불변 영역은 감마1(IgG1), 감마2(IgG2), 감마3(IgG3) 또는 감마4(IgG4)이고, 가장 구체적으로는 감마 4(IgG4) 이소타입이다. 경쇄 불변 영역은 카파(κ) 또는 람다(λ) 형일 수 있으며, 바람직하게 카파(κ)형이다. 따라서, 본 발명의 구체적인 항체는 항체는 카파(κ) 경쇄와 감마4(IgG4) 중쇄를 가지는 scFv 형태 또는 IgG4 형태이나, 반드시 이에 한정되는 것은 아니다.
본 명세서에서, 용어 "중쇄(heavy chain)"는 항원에 특이성을 부여하기 위한 충분한 가변 영역 서열을 갖는 아미노산 서열을 포함하는 항체의 가변 영역 도메인 VH 및 3개의 불변 영역 도메인 CH1, CH2 및 CH3과 힌지(hinge)를 포함하는 전장 중쇄 및 이의 단편을 모두 의미한다. 또한 본 명세서에서, 용어 "경쇄(light chain)"는 항원에 특이성을 부여하기 위한 충분한 가변 영역 서열을 갖는 아미노산 서열을 포함하는 항체의 가변 영역 도메인 VL 및 불변 영역 도메인 CL을 포함하는 전장 경쇄 및 이의 단편을 모두 의미한다.
본 명세서에서, 용어 "CDR(complementarity determining region)"은 면역글로불린 중쇄 및 경쇄의 초가변 영역(hypervariable region)의 아미노산 서열을 의미한다(Kabat et al., Sequences of Proteins of Immunological Interest, 4th Ed., U.S. Department of Health and Human Services, National Institutes of Health (1987)). 중쇄(HCDR1, HCDR2 및 HCDR3) 및 경쇄(LCDR1, LCDR2 및 LCDR3)에는 각각 3개의 CDRs이 포함되어 있으며, 이들 CDRs 사이에는 프레임 워크 영역(framework region, FR) 부분이 존재하여 CDR 고리를 지지해주는 역할을 한다. 상기 CDR은 항원의 인식에 관여하는 고리모양의 부위로서, 항체가 항원 또는 항원결정부위(epitope)에 결합하는 데 있어서 주요한 접촉 잔기를 제공하여 항체의 항원에 대한 특이성을 결정한다.
상기 용어 "프레임 워크(Framework)" 또는 "FR"은 초가변 영역 잔기 이외의 가변 도메인 잔기를 나타낸다. 가변 도메인의 FR은 일반적으로 4개의 FR 도메인 FR1, FR2, FR3 및 FR4로 구성된다.
본 명세서에서, 용어 "가변 영역(variable region)" 또는 "가변 도메인(variable domain)"은 항체를 항원에 결합시키는 것과 관련되는 항체 중쇄 또는 경쇄의 도메인을 의미한다. Native 항체의 중쇄 및 경쇄의 가변 도메인(각각 VH 및 VL)은 일반적으로 유사한 구조를 가지며, 이의 각 도메인은 4개의 보존된 프레임워크 영역 및 3개의 초가변 영역(hypervariable regions, HVR)을 포함한다(Kindt et al., Kuby Immunology, 제 6 판, W.H. Freeman and Co., page 91 (2007)). 단일 VH 또는 VL 도메인은 항원-결합 특이성을 부여하기에 충분할 수 있다. 또한, 특정 항원에 결합하는 항체는, 항원과 결합하여 각각 상보적인 VH 또는 VL 도메인의 라이브러리를 스크리닝하는 항체로부터, VH 또는 VL 도메인을 사용하여 분리될 수 있다.
본 명세서에서, 용어 "특이적으로 결합한다" 또는 이와 같은 것은, 항체 또는 그의 항원 결합 단편, 또는 scFv와 같은 다른 구성물이 항원 또는 이에 상응하는 물질에 특이적으로 상호작용하여 면역학적 반응을 하는 것을 의미한다. 특이적 결합은 적어도 약 1 x 10-6 M 이하(예컨대, 9 x 10-7 M, 8 x 10-7 M, 7 x 10-7 M, 6 x 10-7 M, 5 x 10-7 M, 4 x 10-7 M, 3 x 10-7 M, 2 x 10-7 M, 또는 1 x 10-7 M), 바람직하게는 1 x 10-7 M 이하(예컨대, 9 x 10-8 M, 8 x 10-8 M, 7 x 10-8 M, 6 x 10-8 M, 5 x 10-8 M, 4 x 10-8 M, 3 x 10-8 M, 2 x 10-8 M, 또는 1 x 10-8 M), 보다 바람직하게는 1 x 10-8 M이하(예컨대, 9 x 10-9 M, 8 x 10-9 M, 7 x 10-9 M, 6 x 10-9 M, 5 x 10-9 M, 4 x 10-9 M, 3 x 10-9 M, 2 x 10-9 M, 또는 1 x 10-9 M)의 평형 해리 상수 (예를 들어, 이보다 작은 KD는 보다 특이적인 결합을 나타냄)로 특성화될 수 있다. 2 개의 분자가 특이적으로 결합하는지 여부를 결정하는 방법은 당 업계에 잘 알려져 있으며, 예를 들어 평형 투석, 표면 플라스몬 공명 등을 포함한다.
본 발명의 항체 또는 그의 항원 결합 단편은 전장 또는 원래 그대로의 폴리클로날(polyclonal-) 또는 모노클로날(monoclonal-) 항체뿐만 아니라, 이의 항원 결합 단편들(예를 들어, Fab, Fab', F(ab')2, Fab3, Fv 및 이의 변이체들), 하나 또는 그 이상의 항체 부분을 포함하는 융합 단백질, 인간항체, 인간화 항체, 키메라 항체, 미니바디, 다이아바디, 트리아바디, 테트라바디, 선형 항체, 단일 체인 항체(scFv), scFv-Fc, 이중특이적 항체, 다중특이적 항체, 필요한 특이성의 항원 인식 부위를 포함하는 면역 글로불린 분자의 다른 변형된 배열형태로서 항체의 글리코실화 변이체, 항체의 아미노산 서열 변이체 및 공유결합으로 변형된 항체를 포함한다. 변형된 항체 및 이의 항원 결합 단편의 구체적인 예에는 나노바디, AlbudAbs, DARTs(dual affinity re-targeting), BiTEs(bispecific T-cell engager), TandAbs(tandem diabodies), DAFs(dual acting Fab), two-in-one antibodies, SMIPs(small modular immunopharmaceuticals), FynomAbs(fynomers fused to antibodies), DVD-Igs(dual variable domain immunoglobulin), CovX-bodies(peptide modified antibodies), 듀오바디 및 triomAbs이 포함된다. 이와 같은 항체 및 그의 항원 결합 단편들의 목록은 상기에 한정되는 것은 아니다.
본 발명의 구체적인 일 구현예에 있어서, 본 발명의 항체 또는 그의 항원 결합 단편은 상술한 중쇄 가변영역 및 경쇄 가변 영역을 포함하는 모노클로날 항체, 폴리클로날 항체, 인간 항체, 인간화 항체, 키메라 항체, scFv, Fab, F(ab), 및 F(ab)2로 이루어진 군으로부터 선택되는 것이나, 이에 한정되는 것은 아니다.
바람직하게 상기 항체 또는 그의 항원 결합 단편은 인간화 항체일 수 있다.
본 명세서에서 용어 "인간화 항체"란, 비-인간(예를 들어 쥐) 항체의 비-인간 면역글로불린으로부터 유래된 최소 서열을 함유하는 키메릭 면역글로불린, 그의 면역글로불린 쇄 또는 단편(예를 들어 Fv, Fab, Fab', F(ab')2 또는 항체의 다른 항원-결합 하위서열)이다. 대부분의 경우에, 인간화된 항체는 수용자의 상보성-결정 영역(CDR)의 잔기가, 목적하는 특이성, 친화성 및 능력을 갖는 비-인간 종(공여자 항체), 예를 들어 마우스, 래트 또는 토끼의 CDR의 잔기에 의해 대체된 인간 면역글로불린(수용자 항체)이다. 일부의 경우에, 상기 인간 면역글로블린의 Fv 프레임워크 영역(FR) 잔기는 상응하는 비-인간 잔기에 의해 대체된다. 또한, 인간화된 항체는 수용자 항체 또는 공여자 항체의 CDR 또는 프레임워크 서열에서도 발견되지 않는 잔기를 포함할 수 있다. 이러한 변형은 항체 성능을 추가로 개선 및 최적화하기 위해 이루어진다. 일반적으로, 상기 인간화된 항체는 적어도 하나, 및 전형적으로 2개의 실질적으로 모든 가변 도메인을 포함할 것이며, 상기 도메인에서 상기 CDR 영역의 전부 또는 실질적 전부는 비-인간 면역글로불린의 CDR 영역에 상응하고, 상기 FR 영역의 전부 또는 실질적 전부는 인간 면역글로불린의 FR 영역의 서열을 가진다. 상기 인간화된 항체는 면역글로불린 불변 영역(Fc region)의 적어도 일부 내지 실질적인 인간 면역글로불린의 불변 영역(Fc region)서열을 포함한다.
본 발명의 다른 일 양태에 다르면, 본 발명은 상술한 코티닌의 S-이성질체에 더 특이적으로 결합하는 항체 또는 그의 항원 결합 단편을 인코딩하는 뉴클레오타이드 서열을 포함하는 핵산 분자를 제공한다.
본 발명의 일 구현예에 있어서, 본 발명의 상기 항체 또는 그의 항원 결합 단편을 구성하는 아미노산 서열을 인코딩하는 뉴클레오타이드 서열인 것으로 족하며, 어느 특정 뉴클레오타이드 서열에 한정되지 않는다는 것은 당업자에게 자명하다. 이는 뉴클레오타이드 서열의 변이가 발생하더라도 변이된 뉴클레오타이드 서열을 단백질로 발현하면 단백질 서열에서 변화를 가져오지 않는 경우도 있기 때문이다. 이를 코돈의 축퇴성이라고 한다. 따라서 상기 뉴클레오타이드 서열은 기능적으로 균등한 코돈 또는 동일한 아미노산을 코딩하는 코돈(예를 들어, 코돈의 축퇴성에 의해, 아르기닌 또는 세린을 코딩하는 코돈은 여섯 개이다), 또는 생물학적으로 균등한 아미노산을 코딩하는 코돈을 포함하는 뉴클레오타이드 서열을 포함한다.
본 발명의 구체적인 일 구현예에 있어서, 본 발명의 상기 핵산 분자는, (i) 중쇄가변 영역을 인코딩하는 서열번호 12의 뉴클레오타이드 서열 및 경쇄가변 영역을 인코딩하는 서열번호 13의 뉴클레오타이드 서열을 포함하거나; 또는 (ii) 중쇄가변 영역을 인코딩하는 서열번호 14의 뉴클레오타이드 서열 및 경쇄가변 영역을 인코딩하는 서열번호 15의 뉴클레오타이드 서열을 포함하는, 핵산 분자이다.
본 명세서에서, 용어 "핵산(nucleic acids)"은 DNA(gDNA 및 cDNA)와 RNA 분자를 포괄적으로 포함하는 것을 의미한다. 상기 핵산 분자에서 기본 구성 단위인 뉴클레오타이드는 자연의 뉴클레오타이드 뿐만 아니라, 당 또는 염기 부위가 변혇된 유사체(analogue)도 포함한다(Scheit, Nucleotide Analogs, John Wiley, New York(1980); Uhlman 및 Peyman, Chemical Reviews, 90:543-584(1990)).
상술한 생물학적 균등 활성을 갖는 변이를 고려한다면, 상기 항체 및 그의 항원 단편을 구성하는 아미노산 서열을 코딩하는 본 발명의 핵산 분자는 이와 실질적인 동일성(substantial identity)을 나타내는 서열도 포함하는 것으로 해석된다. 상기의 실질적인 동일성은, 상기한 본 발명의 서열과 임의의 다른 서열을 최대한 대응되도록 얼라인(align)하고, 당업계에서 통상적으로 이용되는 알고리즘을 이용하여 얼라인된 서열을 분석한 경우에, 최소 60% 이상의 상동성, 보다 구체적으로 70% 이상의 상동성, 보다 더 구체적으로 80% 이상의 상동성, 보다 더욱 더 구체적으로 90% 이상의 상동성, 가장 구체적으로 95% 이상의 상동성을 나타내는 서열을 의미한다. 이와 같은 서열비교를 위한 얼라인먼트(alignment) 방법은 당업계에 공지되어 있다. 얼라인먼트에 대한 다양한 방법 및 알고리즘은 Smith and Waterman, Adv. Appl. Math. 2:482(1981); Needleman and Wunsch, J. Mol. Bio. 48:443(1970); Pearson and Lipman, Methods in Mol. Biol. 24: 307-31(1988); Higgins and Sharp, Gene 73:237-44(1988); Higgins and Sharp, CABIOS 5:151-3(1989); Corpet et al., Nuc. Acids Res. 16:10881-90(1988); Huang et al., Comp. Appl. BioSci. 8:155-65(1992) and Pearson et al., Meth. Mol. Biol. 24:307-31(1994)에 개시되어 있지만, 이에 한정되는 것은 아니다.
본 발명의 다른 일 양태에 따르면, 본 발명은 상기 핵산 분자를 포함하는 재조합 벡터를 제공한다.
본 명세서에서 용어 "벡터"는 숙주 세포에서 목적 유전자를 발현시키기 위한 수단으로 플라스미드 벡터; 코즈미드 벡터; 그리고 박테리오파아지 벡터, 아데노바이러스 벡터, 레트로바이러스 벡터 및 아데노-연관 바이러스 벡터 같은 바이러스 벡터 등을 포함된다.
본 발명의 구체적인 구현예에 따르면, 본 발명의 벡터에서 상기 항-CD19 항체 또는 그의 항원 결합 단편을 인코딩하는 핵산 분자는 프로모터와 작동적으로 결합(operatively linked)되어 있다.
본 명세서에서, 용어 "작동적으로 결합된"은 핵산 발현 조절 서열(예: 프로모터, 시그널 서열, 또는 전사조절인자 결합 위치의 어레이)과 다른 핵산 서열사이의 기능적인 결합을 의미하며, 이에 의해 상기 조절 서열은 상기 다른 핵산 서열의 전사 및/또는 해독을 조절하게 된다.
본 발명의 재조합 벡터 시스템은 당업계에 공지된 다양한 방법을 통해 구축될 수 있으며, 이에 대한 구체적인 방법은 Sambrook et al., Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory Press(2001)에 개시되어 있으며, 이 문헌은 본 명세서에 참조로서 삽입된다.
본 발명의 벡터는 전형적으로 클로닝을 위한 벡터 또는 발현을 위한 벡터로서 구축될 수 있다. 또한, 본 발명의 벡터는 원핵 세포 또는 진핵 세포를 숙주로 하여 구축될 수 있다.
예를 들어, 본 발명의 벡터가 발현 벡터이고, 진핵 세포를 숙주로 하는 경우에는, 포유동물 세포의 지놈으로부터 유래된 프로모터(예: 메탈로티오닌 프로모터, β-액틴 프로모터, 사람 헤로글로빈 프로모터 및 사람 근육 크레아틴 프로모터) 또는 포유동물 바이러스로부터 유래된 프로모터(예: 아데노바이러스 후기 프로모터, 백시니아 바이러스 7.5K 프로모터, SV40 프로모터, 사이토메갈로바이러스 프로모터, HSV의 tk 프로모터, 마우스 유방 종양 바이러스(MMTV) 프로모터, HIV의 LTR 프로모터, 몰로니 바이러스의 프로모터 엡스타인 바 바이러스(EBV)의 프로모터 및 로우스 사코마 바이러스(RSV)의 프로모터)가 이용될 수 있으며, 전사 종결 서열로서 폴리아데닐화 서열을 일반적으로 갖는다.
본 발명의 벡터는 그로부터 발현되는 항체 도는 항원 결합 단편의 정제를 용이하게 하기 위하여, 다른 서열과 융합될 수도 있다. 융합되는 서열은 예컨대, 글루타티온 S-트랜스퍼라제(Pharmacia, USA), 말토스 결합 단백질(NEB, USA), FLAG(IBI, USA) 및 6x His(hexahistidine; Quiagen, USA) 등이 있다.
한편, 본 발명의 발현 벡터는 선택표지로서, 당업계에서 통상적으로 이용되는 항생제 내성 유전자를 포함하며, 예를 들어 암피실린, 겐타마이신, 카베니실린, 클로람페니콜, 스트렙토마이신, 카나마이신, 제네티신, 네오마이신 및 테트라사이클린에 대한 내성 유전자가 있다.
본 발명의 또 다른 일 양태에 따르면, 본 발명은 상기 재조합 벡터로 형질 전환된 숙주세포를 포함한다.
본 발명의 벡터를 안정되면서 연속적으로 클로닝 및 발현시킬 수 있는 숙주 세포는 당업계에 공지되어 어떠한 숙주 세포도 이용할 수 있으며, 예컨대, 상기 벡터의 적합한 진핵세포 숙주 세포는 원숭이 신장 세포7(COS7: monkey kidney cells), NSO 세포, SP2/0, 차이니즈 햄스터 난소(CHO: Chinese Hamster Ovary) 세포, W138, 어린 햄스터 신장(BHK: baby hamster kidney) 세포, MDCK, 골수종 세포주, HuT 78 세포 및 HEK-293 세포를 포함하나 이에 한정되지 않는다.
본 명세서에서 용어 "형질전환된", "형질도입된" 또는 "형질감염된"은 외인성 핵산이 숙주세포 내로 전달되거나 도입되는 과정을 지칭한다. "형질전환된", "형질도입된" 또는 "형질감염된" 세포는 외인성 핵산으로 형질전환, 형질도입 또는 형질감염된 세포이며, 상기 세포는 당해 세포 및 그의 계대 배양으로 인한 자손 세포를 포함한다.
본 발명의 또 다른 일 양태에 따르면, 본 발명은 상술한 코티닌에 특이적으로 결합하는 항체 또는 그의 항원 결합 단편을 포함하는 키메라 항원 수용체(Chimeric Antigen Receptor)를 제공한다.
상기 키메라 항원 수용체의 항체 또는 그의 항원 결합 단편은 항-코티닌 항체 또는 그의 항원 결합 단편이다.
본 발명의 구현예에 있어서, 항-코티닌 항체 또는 그의 항원 결합 단편, 힌지 도메인, 막관통 도메인 및 신호전달 도메인을 포함하는 항-코티닌 항체가 연결된 키메라 항원 수용체를 제공한다.
본 명세서에서, 용어 "키메라 항원 수용체(Chimeric Antigen Receptor; CAR)"는 이펙터 세포(effector cell) 신호전달 도메인 또는 이펙터 세포(effector cell) 활성화 도메인(예를 들어, T-세포 신호전달 도메인 또는 T-세포 활성화 도메인)에 연결된, 타겟 결합 도메인을 포함하는 인공적으로 제작된 하이브리드 단백질 또는 폴리펩타이드를 의미한다. 키메라 항원 수용체(CAR)는 일반적으로 단일클론항체의 항원-결합 성질을 이용하여 비-MHC-제한 방식으로, 선택된 표적에 대한 T-세포 특이성 및 반응성을 재유도하는 능력을 갖는다. 비-MHC-제한된 항원 인식은 키메라 항원 수용체를 발현하는 T-세포에게 항원 처리와 무관하게 항원을 인식하는 능력을 제공하며, 종양 도피의 주요 메커니즘을 회피시킨다. 또한, 키메라 항원 수용체는 T-세포에서 발현될 때, 유리하게는 내재성 T-세포 수용체(TCR) 알파 및 베타 사슬과 이량체화되지 않는다.
구체적으로, 본 발명의 키메라 항원 수용체는 "스위처블 키메라 항원 수용체(switchable chimeric antigen receptor; sCAR)를 의미한다. 종래의 일반적인 클래식 키메라 항원 수용체(classical chimeric antigen receptor)의 세포 외 도메인은 표적세포의 세포 표면의 특정 항원을 직접적으로 표적화하는, 항체 또는 항체의 항원 결합 단편을 포함한다. 그러나, 본 발명의 키메라 항원 수용체의 세포 외 도메인은 직접적으로 표적세포의 세포 표면 항원을 표적화하는 것이 아니라, 상술한 코티닌에 특이적으로 결합하는 항체 또는 그의 항원 결합 단편을 포함함으로써, 코티닌(구체적으로는 스위치 분자의 접합된 코티닌)을 표적화한다.
상기 "힌지 도메인(hinge domain)"은 항-코티닌 항체 또는 이의 단편과 막관통 도메인을 연결하는 도메인을 의미한다. 이는 시스테인 잔기를 포함할수 있고, 상기 시스테인 잔기는 힌지 도메인이 항체와 결합하는데 관여할 수 있다. 예를 들어, 상기 힌지 도메인은 CD8 또는 CD28에서 유래한 힌지 도메인, IgG1, IgG2, IgG4, 또는 IgGD에서 유래한 힌지 도메인, KIR(killer immunoglobulin-like receptor) 세포외 영역 및 이의 조합일 수 있으나, 이에 한정되는 것은 아니다.
상기 "막관통 도메인(transmembrane domain)"은 키메라 항원 수용체의 힌지 도메인과 신호전달 도메인을 연결할 수 있는 부위를 의미한다. 막관동 도메인은, 키메라 항원 수용체의 항-코티닌 항체 또는 그의 항원 결합 단편이 세포 표면에 위치하고, 신호전달 도메인이 세포 내에 위치하도록 세포의 세포막을 관통할 수 있다. 상기 막관통 도메인은 T-세포 수용체, CD27, CD28, CD3 엡실론(ε), CD45, CD4, CD5, CD8(CD8α), CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137 및 CD154의 알파, 베타 또는 제타 사슬로 이루어진 군으로부터 선택될 수 있으나, 이에 한정되는 것은 아니다.
상기 "신호전달 도메인(intracellular signlaing domain)"은 면역세포의 세포막 안쪽, 즉 세포질에 위치하게 되는 부분으로서, 세포외 도메인에 포함된 항체 또는 그의 항원 결합 단편이 표적 항원에 결합하였을 때, 세포 내에 신호를 전달하여 면역세포의 면역반응을 활성화시키는 부위를 의미한다.
본 발명의 세포내 신호전달 도메인은 CD3 제타(ζ), CD3 감마(γ), CD3 델타(δ), CD3 엡실론(ε), FcR 감마, FcR 베타, CD5, CD22, CD79a, CD79b 및 CD66d로 구성된 군에서 선택된 하나 이상의 세포내 신호전달 도메인일 수 있으나, 이에 한정되는 것은 아니며, 바람직하게는 CD3 제타(ζ)일 수 있다.
또한, 본 발명에 따른 상기 세포내 신호전달 도메인은 추가적으로 공동자극(co-stimulatory) 도메인을 포함할 수 있으며, 이는 CD2, CD7, CD27, CD28, CD30, CD40, 4-1BB(CD137), OX40(CD134), ICOS, LFA-1, GITR, MyD88, DAP1, PD-1, LIGHT, NKG2C, B7-H3 및 CD83과 특이적으로 결합하는 리간드로 구성된 군에서 선택된 하나 이상의 공동자극 도메인일 수 있으나, 이에 한정되는 것은 아니다.
추가적으로, 본 발명의 키메라 항원 수용체는 상기 서술한 바와 같은 항체 및 도메인들의 변형된 형태를 포함할 수 있다. 이때, 상기 변형은 상기 항체 및 도메인들의 기능을 변형시키지 않고, 야생형의 항체 및 도메인의 아미노산 서열에서 하나 이상의 아미노산을 치환, 결실 또는 추가하여 수행할 수 있다. 통상적으로, 상기 치환은 알라닌(alanine)이거나, 전체 단백질의 전하, 극성 또는 소수성에 영향을 주지 않는 보존적 아미노산 치환(conservative amino acid substitution)에 의해 수행될 수 있다.
본 발명의 또 다른 일 양태에 따르면, 본 발명은 상술한 코티닌에 특이적으로 결합하는 항체 또는 그의 항원 결합 단편을 포함하는 키메라 항원 수용체를 발현하는, 키메라 항원 수용체 이펙터 세포(effector cell)를 제공한다.
본 명세서에서, 용어 "이펙터 세포(effector cell)"는 키메라 항원 수용체 폴리펩타이드를 인코딩하는 유전자를 포함하는 벡터로 형질전환된 세포로서, 상기 도입된 키메라 항원 수용체를 세포막에서 발현하는 세포를 의미한다.
본 발명의 일 구현예에 있어서, 이펙터 세포(effector cell)는 선천성 및/또는 후천성 면역 반응의 개시 및/또는 실행을 담당하는 조혈기원의 면역세포를 지칭한다.
본 발명에 따른 상기 면역세포는 수지상 세포, 킬러 수지상 세포, 비만세포, T세포, NKT 세포, 조절 T 세포(regulator T cell), NK 세포(natural killer cell) 또는 B 세포(B cell)등의 면역세포일 수 있으며, 골수, 말초혈액, 말초혈액 단핵세포 또는 제대혈로부터 수득할 수 있다.
본 발명의 일 구현예에 있어서, 상기 세포는 투여되는 대상체에 대해 동종 동물유래 또는 자가유래 세포일 수 있다.
본 발명의 구체적인 구현예에 있어서, 이펙터 세포(effector cell)는 상기 키메라 항원 수용체를 표면에 발현하는 면역세포인, T 세포일 수 있다.
본 발명의 일 구현예에 있어서, 이펙터 세포(effector cell)는 본 발명의 항체 또는 그의 항원 결합 단편이 연결된 형태로, 상술한 키메라 항원 수용체를 발현하여 코티닌이 표지된 접합물질을 표적화한다. 이때, 상기 이펙터 세포(effector cell)와 코티닌이 표지된 접합 물질의 결합은, 키메라 항원 수용체의 항-코티닌 항체 또는 그의 항원 결합 단편과 코티닌 사이의 항원-항체 결합일 수 있다.
또한, 이펙터 세포(effector cell)는 코티닌이 표지된 접합물질과 결합하여, 이의 활성이 유도될 수 있다. 여기에서 코티닌이 표지된 접합 물질은 상기 이펙터 세포(effector cell)의 활성화를 조절하는 스위치 분자(switch molecule)의 역할을 수행한다. 상기 이펙터 세포(effector cell)의 활성화는 표적세포에 대한 세포독성 기능 발휘, 사이토카인 분비, 및 이들의 조합이다.
본 발명의 구체적인 구현예에 있어서, 상기 키메라 항원 수용체 이펙터 세포(effector cell)는 다음을 포함하는 스위치 분자(switch molecule)에 의해 활성화가 조절된다:
(a) 코티닌의 S-이성질체, 및
(b) 표적세포 상에서 세포 표면 분자에 결합하는 표적화 모이어티(targeting moiety).
본 발명의 보다 구체적인 구현예에 있어서, 상기 스위치 분자의 표적화 모이어티는 항체, 항체의 항원 결합 단편, 또는 타겟 결합 폴리펩타이드(target binding polypeptide)이다.
본 발명의 보다 더 구체적인 구현예에 있어서, 상기 스위치 분자는 S-이성질체의 코티닌이 접합된 코티닌-접합 어피바디(cotinine-conjugated affibody)이다.
본 명세서에서, 용어 "스위치 분자(switch molecule)"는 키메라 항원 수용체를 이용한 이펙터 세포(effector cell)에 있어서, 키메라 항원 수용체의 타겟 인식 도메인과, 키메라 항원 수용체의 세포 시그널링 도메인을 분리하고, 이를 매개하는 어댑터 분자(adaptor molecule)를 의미한다. 스위치 분자는 heterogenous target, 또는 resistant tumor에 대해서 키메라 항원 수용체의 타겟을 교체하거나, 키메라 항원 수용체를 발현하는 세포의 과도한 활성화로 인해 부작용이 발생할 경우, 스위치 분자의 투여를 조절함으로써 키메라 항원 수용체 이펙터 세포의 활성 감소를 가능케 한다(Cao et al., Angew Chem Int Ed Engl. 2016 June 20; 55(26): 7520-7524.).
본 명세서에서, 용어 "타겟 결합 폴리펩타이드(target binding polypeptide)"는 항체와 같이 타겟 항원에 대한 결합 친화성을 가지나, 항체와는 구조적으로 관련성이 없는 비면역글로불린 폴리펩타이드 분자를 의미한다. 상기 타겟 결합 폴리펩타이드는 항체 유사 분자(antibody-like molecule) 또는 항체 유사체(antibody minetics)라고도 불리우며, 약 150 Kda의 분자량을 가지는 항체와는 달리 일반적으로는 3KDa 내지 20 KDa의 분자량을 가진다. 상기 타겟 결합 폴리펩타이드는 상기한 단백질 A(protein A)의 Z-도메인에서 유래한 어피바디, 감마-B 크리스탈린 또는 유비퀴틴에서 유리한 어필린(affilin), 스시타틴(cystatin)에서 유래한 어피머(Affimer), 알파바디(Alphabody), 리포칼린(lipocalin)으로부터 유래한 안티칼린(Anticalin), 세포막 수용체의 도메인으로부터 유래한 아비머(Avimer), 안키린 반복 모티프(ankyrin repeat motif)로부터 유래한 DARPin, Fyn의 SH3 도메인으로부터 유래한 피노머(Fynomer), 프로테아제 억제제(protease inhibitor)의 쿠니츠 도메인으로부터 유래한 쿠니츠 도메인 펩타이드(Kunits domain peptide), 피브로넥틴의 10번째 타입 3 도메인(10th type III domain of fibronectin)으로부터 유래한 모노바디(Monobody), clostridium perfringens의 NagH의 탄수화물 결합 모듈 32-2(carbohydrate binding module 32-2)로부터 유래한 나노클램프(nanoCLAMP) 등을 포함하나, 이에 한정되는 것은 아니다.
상기 타겟 결합 폴리펩타이드는 파지 디스플레이(phage display), 리보솜 디스플레이(ribosome display) 등 당업계에 알려진 다양한 스크리닝 방법을 통하여 임의의 타겟 항원에 대한 결합친화성을 갖도록 엔지니어링 될 수 있다.
본 명세서에서, 용어 "어피바디(Affibody)"는 황색포도상구균(Staphylococcus aureus)의 단백질 A(Protein A) 중 IgG에 친화성이 있는 부위인 Z-도메인(Z domain)을 의미한다. 어피바디는 58개의 아미노산 잔기로 이루어진 작은 단백질로서, 이러한 어피바디 분자의 단백질 서열에서 IgG와 결합면을 형성하는 13개의 아미노산은 아미노산 서열에 따라 다양한 타겟 항원에 대한 결합이 가능하며, 무작위적인 배열이 가능하여 라이브러리(library)를 구축할 수 있다. 어피바디 분자는 항체와 유사하게 라이브러리로부터 파지 라이브러리(phage library), 효모단백질 잡종법(yeast two hybrid; Y2H) 등의 스크리닝 방법을 통해 다양한 타겟 항원에 대하여 결합할 수 있는 어피바디 분자들을 선별할 수 있다. 항원과 결합이 가능한 어피바디 분자의 특성을 이용하여 최근 HER2 및 아밀로이드 베타(amyloid-β)에 특이적으로 결합하는 어피바디가 개발된 바 있다(Orlova et al. 2006, Cancer Res., Gronwall et al., 2007, J. Biotechnol.). 또한, 어피바디는 분자량이 6 Kda으로 매우 작아, 일반적으로 150 Kda의 분자량을 가진 IgG 형태의 항체와 비교하여 인체 투여시 전신적으로 확산되고, 신장여과로 빠르게 제거되는 특징이 있다. 따라서, 어피바디는 주로 진단시료 연구개발에 응용되고 있다(Goldstein R et al., 2013, Expert Rev Anticancer Ther.).
본 발명의 일 구현예에 있어서, 상기 스위치 분자를 구성하는 어피바디와 코티닌(cotinine)은 화학적 컨쥬게이션(chemical conjugation)에 의해 결합될 수 있다.
상기 화학적 컨쥬게이션은 화학적 가교제에 의해 이루어질 수 있다. 상기 화학적 가교제로는 EDC (1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride), DCC (dicyclohexyl carbodiimide), NHS (Nhydroxysuccinimide), Sulfo-NHS (N-hydroxysulfosuccinimide), imidoester 계열 가교제, Sulfo-SMCC (sulfosuccinimidyl 4-(N-maleimidomethyl)cyclohexane-1-carboxylate) 등이 있으나, 이에 한정되는 것은 아니며, 본 발명이 속하는 분야에서 통상적으로 사용되는 화학적 가교제를 제한없이 사용할 수 있다.
또한, 상기 스위치 분자를 구성하는 어피바디와 코티닌은 링커(linker)를 통해 간접적으로 연결될 수 있다.
통상의 기술자라면, 융합 단백질의 제작시 보통 융합하고자 하는 기능적 일부분(moiety) 사이에 링커를 사용하는 것을 포함할 수 있으며, 서로 다른 특성을 가진 다른 종류의 링커, 예를 들어 유연성 아미노산 링커, 비유연성 링커 및 절단 가능한 아미노산 링커가 있다는 것을 알고 있을 것이다. 링커는 융합단백질의 발현량 증가, 생물학적 활성 향상, 타겟팅을 가능하게 하거나, 약동학을 변경시키기 위한 목적으로, 또는 융합단백질의 안정성을 증가시키고 폴딩(folding)을 향상시키기 위해 사용되어 왔다.
본 발명의 또 다른 일 양태에 따르면, 본 발명은 상술한 키메라 항원 수용체 이펙터 세포(effector cell)를 유효성분으로 포함하는 면역 치료용 약제학적 조성물을 제공한다.
본 발명의 일 구현예에 있어서, 상기 면역 치료용 약제학적 조성물은 키메라 항원 수용체 이펙터 세포(effector cell)의 활성을 조절하기 위하여, 상술한 스위치 분자(switch molecule)를 추가적으로 포함할 수 있다.
본 명세서에서, 용어 "면역 치료(immunotherapy)"는 면역 체계가 암을 제거하도록 돕는 암의 치료 방법을 의미한다. 면역 치료는 능동적 면역 치료와 수동적 면역 치료로 구분된다. 능동적 면역 치료는 i) 암세포 또는 암세포에 의해 생성된 물질을 인체에 주입하여 면역체계를 활성화시키는 암 백신 치료(cancer vaccine therapy), ii) 사이토카인(인터페론, 인터류킨 등), 성장인자 등 면역조절제(immune-modulating agents)를 투여하여 특정 백혈구를 활성화시키는 면역조절 치료를 포함한다. 수동적 면역 치료는 특정 암세포에 결합하는 치료적 항체(therapeutic antibody)와 면역세포치료(immune cell therapy)를 포함한다. 면역세포 치료는 구체적으로 수지상 세포 백신 치료(dendritic cell vaccine therapy)와 CAR-T(chimeric antigen receptor T cell)치료, NK 세포 치료(natural killer cell therapy), CTL 치료(cytotoxic T lymphocyte therapy), 입양 세포 전이(adoptive cell transfer)등을 포함하나, 이에 한정되는 것은 아니다. 본 발명에서 면역 치료는 주로 상술한 면역세포 치료를 의미한다.
상기 용어 "암"은 이상 세포의 급속하고 조절되지 않는 성장 및 증식을 특징으로 하는 질병을 의미한다. 암세포는 국소적으로 또는 혈류 및 림프계를 통해 신체의 다른 부분으로 확산될 수 있다. 상기 암은 고형 종양 및 비고형 종양(예를 들어 혈액학적 종양, 예를 들어 백혈병 및 림프종)을 포함한다.
상기 "종양"은 양성, 전-암성, 악성 또는 전이성의 조직의 이상 성장을 의미한다. 특히, 고형 종양은 대개 낭종 또는 액체 영역을 함유하지 않는 비정상적인 조직 덩어리이고, 양성 또는 악성일 수 있다. 상이한 유형의 고형 종양은 상기 종양을 형성하는 세포의 유형에 따라 명명된다(예를 들어, 육종, 암종 및 림프종).
바람직하게 본 발명의 면역 치료의 대상이 되는 질환 또는 질병은 암일 수 있고, 상기 암은 고형암 또는 혈액암일 수 있다. 여기에서 상기 고형암은 폐암, 대장암, 전립선암, 갑상선암, 유방암, 뇌암, 두경부암, 식도암, 피부암, 흑색종, 망막모세포종, 흉선암, 위암, 결장암, 간암, 난소암, 자궁암, 방광암, 직장암, 담낭암, 담도암 또는 췌장암일 수 있다. 또한 상기 혈액암은 혈액 또는 골수의 암으로, 예를 들어 림프종, 백혈병 또는 다발성 골수종일 수 있다.
따라서, 본 발명에 따른 키메라 항원 수용체 이펙터 세포(effector cell)의 치료적 시스템을 이용하여 상기 키메라 항원 수용체를 발현하는 이펙터 세포(effector cell)를 함유하는 약제학적 조성물을 투여함으로써 암을 치료할 수 있을 뿐 아니라, 스위치 분자(switch molecule)를 추가로 투여하여 상기 이펙터 세포(effector cell)의 활성을 조절함으로써, 효율적인 치료의 수행을 가능케 한다.
특히, 본 발명의 실시예에서 입증된 바와 같이, 본 발명의 스위치 분자는 HER2 항원에 특이적으로 결합하는 어피바디를 포함하는 바, 상술한 약제학적 조성물을 사용하여 치료할 수 있는 질환은 HER2를 발현하는 세포와 연관된 인간 및 포유동물의 질환일 수 있다.
구체적으로, 본 발명의 코티닌과 결합된 항-HER2 어피바디를 포함하는 스위치 분자 및 상기 스위치 분자의 코티닌을 표적화하는 키메라 항원 수용체를 발현하는 이펙터 세포(effector cell)는, 표면에 HER2를 과발현하는 암세포주인 SKOV3 및 HER2를 발현하는 암세포주인 OVCAR3를 효과적으로 사멸시킨다. 따라서, 본 발명의 코티닌의 S-이성질체에 더 특이적으로 결합하는 항체 또는 그의 항원 결합 단편을 포함하는 키메라 항원 수용체를 발현하는 이펙터 세포(effector cell)는 HER2를 발현하는 암종에 대한 치료용 약제학적 조성물의 유효성분으로서 유용하게 사용될 수 있다.
보다 구체적으로 상기 치료의 대상이 되는 질환은 유방암, 위암, 난소암, 직결장암, 자궁내막암일 수 있으나, 이에 한정되는 것은 아니다.
추가적으로, 본 발명의 약제학적 조성물은 표적세포의 세포 표면 분자에 결합하는 표적화 모이어티를 포함하는 스위치 분자를 추가적으로 포함할 수 있으므로, 표적화 모이어티의 표적항원의 조작을 수행하여 보다 더 다양한 질환의 예방 또는 치료에 효과적으로 사용할 수 있다.
본 발명의 약제학적 조성물에 포함되는 약제학적으로 허용되는 담체는 제제시에 통상적으로 이용되는 것으로서, 락토오스, 덱스트로오스, 수크로오스, 솔비톨, 만니톨, 전분, 아카시아 고무, 인산 칼슘, 알지네이트, 젤라틴, 규산칼슘, 미세결정성 셀룰로오스, 폴리비닐피롤리돈, 셀루로오스, 물, 시럽, 메틸 셀룰로오스, 메틸히드록시벤조에이트, 프로필히드록시벤조에이트, 활석, 스테아르산 마그네슘 및 미네랄 오일 등을 포함하나, 이에 한정되는 것은 아니다.
본 발명의 약제학적 조성물은 상기 성분들 이외에 윤활제, 습윤제, 감미제, 향미제, 유화제, 현탁제, 보존제 등을 추가로 포함할 수 있다. 적합한 약제학적으로 허용되는 담체 및 제제는 Remington's Pharmaceutical Sciences (19th ed., 1995)에 상세히 기재되어 있다.
본 발명의 약제학적 조성물은 경구 또는 비경구로 투여할 수 있고, 예컨대 정맥내 주입, 피하 주입, 피내 주입, 근육내 주입, 복강내 주입, 흉골 내 주입, 종양 내 주입, 국소 투여, 비내 투여, 뇌내 투여, 두개골 내 투여, 폐내 투여 및 직장내 투여 등으로 투여할 수 있으나, 이에 한정되는 것은 아니다.
본 발명의 약제학적 조성물의 적합한 투여량은 질환의 종류, 질환의 중증도, 약학 조성물에 함유된 유효성분 및 다른 성분의 종류 및 함량, 제형의 종류, 투여방식 및 환자의 연령, 체중, 성별 및 식이, 투여 시간, 투여 경로, 치료기간 및 동시에 사용되는 약물을 비롯한 다양한 인자에 따라 조절될 수 있으며, 보통으로 숙련된 의사는 소망하는 치료에 효과적인 투여량을 용이하게 결정 및 처방할 수 있다. 본 발명의 바람직한 구현예에 따르면, 본 발명의 약제학적 조성물의 1일 투여량은 0.1-9 x105 내지 0.1-9 x109 CAR-positive viable cells/kg 이다. 본 명세서에서 용어 "약제학적 유효량"은 상술한 질환을 치료하는데 충분한 양을 의미한다.
본 발명의 약제학적 조성물은 당해 발명이 속하는 기술분야에서 통상의 지식을 가진 자가 용이하게 실시할 수 있는 방법에 따라, 약제학적으로 허용되는 담체 및/또는 부형제를 이용하여 제제화 함으로써 단위 용량 형태로 제조되거나 또는 다용량 용기 내에 내입시켜 제조될 수 있다. 이때 제형은 오일 또는 수성 매질 중의 용액, 현탁액 또는 유화액 형태이거나 엑스제, 산제, 좌제, 분말제, 과립제, 정제 또는 캅셀제 형태일 수도 있으며, 분산제 또는 안정화제를 추가적으로 포함할 수 있다.
본 발명의 약제학적 조성물은 또한 상술한 스위치 분자 이외에 다른 약제학적 활성 약제 또는 약물, 예를 들어, 아스파라기나제, 부설판, 카보플라틴, 시스플라틴, 다우노루비신, 독소루비신, 플루오로우라실, 겜시타빈, 하이드록시우레아, 메토트렉세이트, 파클리탁셀, 리툭시맙, 빈블라스틴, 빈크리스틴 등의 화학치료제를 추가적으로 포함할 수 있으나, 이에 한정되는 것은 아니다.
본 발명의 또 다른 일 양태에 따르면, 본 발명은 상술한 키메라 항원 수용체 이펙터 세포(effector cell)를 유효성분으로 포함하는 면역 치료용 약제학적 키트를 제공한다.
본 발명의 일 구현예에 있어서, 상기 약제학적 키트는 키메라 항원 수용체 이펙터 세포(effector cell)의 활성화를 조절하기 위하여, 상술한 스위치 분자(switch molecule)을 추가적으로 포함할 수 있다.
본 발명의 면역치료용 약제학적 키트는 상술한 본 발명의 다른 일 양태인 키메라 항원 수용체 이펙터 세포(effector cell) 및 스위치 분자(switch molecule)를 포함하므로, 본 명세서 기재의 과도한 복잡성을 피하기 위해 중복되는 내용을 원용하며, 그 기재를 생략한다.
본 발명의 특징 및 이점을 요약하면 다음과 같다:
(a) 본 발명은 코티닌의 R-이성질체에 비하여, S-이성질체에 더 특이적으로 결합하는 코티닌을 타겟하는 항체 또는 그의 항원 결합 단편을 제공한다.
(b) 본 발명은 상기 코티닌의 S-이성질체에 더 특이적으로 결합하는 코티닌을 타겟하는 항체 또는 그의 항원 결합 단편을 포함하는 키메라 항원 수용체(chimeric antigen receptor) 및 상기 키메라 항원 수용체를 발현하는 이펙터 세포(effector cell)을 제공한다.
(c) 본 발명은 상기 키메라 항원 수용체를 발현하는 이펙터 세포를 활성화하기 위한 스위치 분자(switch molecule)을 제공한다.
(d) 본 발명은 상기 키메라 항원 수용체 및 스위치 분자를 포함하는 면역 치료용 약제학적 조성물 및 면역 치료용 약제학적 키트를 제공한다.
(e) 본 발명의 코티닌의 S-이성질체에 더 특이적으로 결합하는 코티닌을 타겟하는 항체 또는 그의 항원 결합 단편을 이용하는 경우, 종래의 항체에 비하여, 우수한 세포독성 활성을 유도할 수 있다. 또한, 항체와 스위치 분자간 결합의 특이성이 더욱 향상되므로, CAR-T와 같은 키메라 항원 수용체 이펙터 세포의 작용을 더욱 미세하게 조절할 수 있으므로 이펙터 세포의 체내 잔류로 인한 부작용을 효과적으로 조절할 수 있다.
도 1은 코티닌에 특이적인 항체의 결합을 ELISA 분석법으로 정량적으로 확인한 도이다.
도 2는 HER2 발현세포인 NCI-N87 세포를 대상으로 HER2에 결합하는 스위치(코티닌이 결합된 trastuzumab)의 세포 결합 능력을 확인하고, MFI(mean fluorescence intensity) 값을 그래프화 한 도이다.
도 3은 hz33B2 항체의 결합을 ELISA 분석법으로 정량적으로 비교 확인한 도이다.
도 4는 hz33B2 항체의 결합을 Flow cytometry 분석법으로 확인한 도이다.
도 5는 hz33B2 항체와 대조군으로 사용된 SUN10 항체가 포함된 CAR 구조의 모식도이다.
도 6은 HER2 과발현 세포주인 SKOV-3와 HER2 발현 세포주인 OVCAR-3 세포주에 대해 코티닌이 결합된 어피바디와 항-코티닌 항체가 포함된 CAR-T의 세포독성효과를 측정한 도이다.
도 7은 각각의 코티닌 이성질체가 결합된 스위치에 대한 hz33B2 항체의 결합을 ELISA 분석법으로 확인한 도이다.
도 8은 hz33B2 항체가 포함된 CAR-T에 대한 각각의 코티닌 이성질체가 결합된 스위치의 결합을 Flow cytometry 분석법으로 확인한 도이다.
도9는 HER2 과발현 세포주인 SKOV-3 세포주에 대해 각각의 코티닌 이성질체가 결합된 스위치와 항-코티닌 항체가 포함된 CAR-T의 세포독성효과를 측정한 도이다.
이하, 실시예를 통하여 본 발명을 더욱 상세히 설명하고자 한다. 이들 실시예는 오로지 본 발명을 보다 구체적으로 설명하기 위한 것으로, 본 발명의 요지에 따라 본 발명의 범위가 이들 실시예에 의해 제한되지 않는다는 것은 당업계에서 통상의 지식을 가진 자에 있어서 자명할 것이다.
본 명세서 전체에 걸쳐, 특정 물질의 농도를 나타내기 위하여 사용되는 "%"는 별도의 언급이 없는 경우, 고체/고체는 (중량/중량) %, 고체/액체는 (중량/부피) %, 그리고 액체/액체는 (부피/부피) %이다.
실시예
실시예 1. 코티닌(cotinine)에 결합하는 항체 개발
1.1. 코티닌에 특이적으로 결합하는 항체 생산 세포 개발
1.1.1. 코티닌에 특이적으로 결합하는 항체 생산 세포 선별
코티닌에 특이적으로 결합하는 항체를 개발하고자, 코티닌에 특이적으로 결합하는 항체를 생산하는 세포를 제작 및 선별하였다.
먼저, KLH(Thermo, 77600) 에 SMCC(Thermo, 22122)를 링커(linker)로 사용하여 코티닌과 결합하였다. KLH와 SMCC는 각각 중량비 2:1 비율로 혼합한 후 RT에서 1시간 동안 반응시켜 결합시켜준 후, 잔여 SMCC는 ultra-centrifugal filter를 통해 제거하였다. SMCC와 결합된 KLH에 코티닌을 1:1 비율로 각각 혼합한 후 4℃에서 밤새도록 결합시켜주었다. KLH-Cotinine 100 ㎍은 Freund's 어쥬번트(Sigma, F5506)와 혼합하고, BALB/c 마우스(㈜대한바이오)의 복강에 주사하였다. 2주 후, KLH-Cotinine 100 ㎍을 PBS에 희석하여 추가 주사하고, 3일 뒤 상기 마우스의 비장을 적출하여 림프구를 분리하였다. 분리한 림프구를 마이엘로바 세포주(myeloma cell)인 SP2/0-Ag14(ATCC, CRL-1581)와 5:1 비율로 혼합하고, PEG-1500(Roche, 10783641001)을 이용하여 융합(fusion)시켰다. 융합된 세포를 HAT supplement(Sigma, H0262)가 포함된 배지에 배양하여 융합된 세포(하이브리도마, hybridoma)를 선택적으로 선별하여 배양하였다.
1.1.2. 코티닌에 특이적으로 결합하는 세포의 항체 생산능 확인
ELISA 방법을 이용하여 상기 선별된 하이브리도마 세포의 항원과 결합하는 항체의 생산 여부를 확인하고자 하였다. 먼저, 상기 KLH-Cotinine의 제조 방법과 동일한 방법을 사용하여, 코티닌에 특이적으로 결합하는 항체를 검출할 수 있는 BSA-Cotinine을 제조하였다. 1 ㎍/mL의 농도로 BSA-Cotinine을 Costar 96-웰 플레이트(Corning, 3590)에 상온에서 1시간 동안 고착시켰다. TBS-T(0.05% Triton X-100)로 3회 세척 후, 300 ㎕의 TBS-T/SM(2% skim milk)로 상온에서 30분 동안 블록킹(blocking)하였다. 블록킹 된 플레이트를 TBS-T로 3회 세척 후, 상기 선별된 하이브리도마 배양액을 첨가하여 37℃에서 1시간 동안 항원-항체 반응을 수행하였다. 여기에서 SUN10 항체(US 2008-0226650 A1)를 양성대조군으로 사용하였다. 그런 다음 TBS-T로 3회 세척 후, 2차 항체로 항-mIgG-HRP(Pierce, 31439)을 TBS-T/SM에 1:5,000으로 희석하여 첨가하고 37℃에서 1시간 동안 반응시켰다. 다음으로 TBS-T로 3회 세척하였고, TMB(Surmodics, TMBC-1000-01)를 첨가하여 상온에서 5분간 발색시킨 후, 추가로 1 N 황산(sulfuric acid, Duksan, 254)을 첨가하여 발색을 정지시켰다. Victor X3(PerkinElmer, 2030-0030)를 이용하여 450 nm에서 흡광도를 측정하였고, 그 결과, 상기 선별된 하이브리도마 세포가 코티닌에 특이적으로 결합하는 항체를 생산함을 확인할 수 있었다.
그 결과, 도 1에 나타낸 바와 같이, 20E12, 30G5 및 33B2가 BSA-Cotinine에 특이적으로 결합하는 항체로 선별되었다.
1.2. 코티닌에 특이적으로 결합하는 항체의 세포 결합능 확인
상기 선별된 BSA-Cotinine에 특이적으로 결합하는 항체의 세포 결합능을 확인하고자, HER2를 발현하는 암세포인 NCI-N87(ATCC, CRL5822) 및 항-HER2 스위치(코티닌이 결합된 trastuzumab)를 이용하여 Cell binding affinity assay를 수행함으로써 세포 결합능을 평가하였다.
코티닌이 결합된 HER2-표적화 스위치 분자 제조
먼저, EDC 반응을 통하여 인간 IgG 형태의 trastuzumab에 Trans-4-cotininecarboxylic acid(Sigma, 33224-01-0)을 결합시키어 항-HER2 스위치를 제작하였다. 상기 항-HER2 스위치는 Protein assay dye(Bio-Rad, Cat. No. 500-0006)를 이용하여 정량하였고, 농도 및 순도는 SDS-PAGE를 수행하여 coomassie blue staining을 통하여 확인하였다.
코티닌에 특이적으로 결합하는 항체와 표적화 스위치간의 세포 결합능력 확인
그런 다음, NCI-N87 세포를 5 x 105 cells/tube로 준비하였고, 1,200 rpm으로 3분 동안 원심 분리하여 cell을 모아주었다. 5% FBS를 포함하는 PBS로 세척한 후, 항-HER2 스위치를 처리하여 4℃에서 1시간 동안 인큐베이션하였다. 200 ㎕의 5% FBS를 포함하는 PBS를 이용하여 1,200 rpm에서 3분 동안 원심 분리하는 방법으로 cell을 3회 세척하였다. 그 다음 하이브리도마 배양액을 처리하고 4℃에서 1시간 동안 인큐베이션하였다. 상기 동일한 방법으로 cell을 3회 세척하였다. 다음으로 anti-mouse IgG-FITC(Jackson, 715-095-150)를 1 ㎍/mL로 cell에 처리하고, 빛을 차단한 채로 4℃에서 45분 동안 인큐베이션하였다. 상기 동일한 방법으로 cell을 3회 세척하였다. FACS 기기를 이용하여 상기 선별된 항체의 세포 결합 여부를 판단하였다.
그 결과, 도 2에서 나타낸 바와 같이, 33B2 항체가 표적화 스위치와 결합능력이 가장 우수함을 확인할 수 있었다. 하기 표 1은 선별된 33B2 항체에 대한 서열정보를 나타낸다.
코티닌(cotinine)에 특이적으로 결합하는 항체:33B2
서열
번호		 명칭 서열 종류
1 33B2_HCDR1 SYWIQ PRT
2 33B2_HCDR2 EIFPGTGTTYYNEKFKG PRT
3 33B2_HCDR3 GGYYYDSRAWFAY PRT
4 33B2_LCDR1 RSSTGTVTTSNYAN PRT
5 33B2_LCDR2 GTNNRAP PRT
6 33B2_LCDR3 ALWFSNHWV PRT
7 33B2_VH EVQLQQSGAELVKPGASVKLSCKTSGYTFTSYWIQWIKQRPGQGLGWVGEIFPGTGTTYYNEKFKGKATLTIDTSSSTAYMQLSSLTSEDSAVYFCARGGYYYDSRAWFAYWGQGTLVTVSA PRT
8 33B2_VL DAVVTQESALTTSPGETVTLTCRSSTGTVTTSNYANWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLIGDEAALTITGAQTEDEAIYFCALWFSNHWVFGGGTKLTVLG PRT
12 33B2_VH GAGGTGCAGCTTCAGCAGTCTGGAGCTGAGCTGGTGAAGCCTGGGGCTTCAGTGAAGCTGTCCTGCAAGACTTCTGGCTACACCTTCACCAGCTACTGGATTCAGTGGATAAAACAGAGGCCTGGACAGGGCCTTGGGTGGGTTGGAGAGATATTTCCTGGAACTGGCACTACTTACTACAATGAGAAGTTCAAGGGCAAGGCCACACTGACTATAGACACATCCTCCAGCACAGCCTACATGCAGCTCAGCAGCCTGACCTCTGAGGACTCTGCTGTCTATTTCTGTGCAAGAGGGGGTTATTACTACGATAGTAGAGCCTGGTTTGCTTACTGGGGCCAAGGGACTCTGGTCACTGTCTCTGCAG DNA
13 33B2_VL GATGCTGTTGTGACTCAGGAATCTGCACTCACCACATCACCTGGTGAAACAGTCACACTCACTTGTCGCTCAAGTACTGGGACTGTTACAACTAGTAACTATGCCAACTGGGTCCAAGAAAAACCAGATCATTTATTCACTGGTCTAATAGGTGGTACCAACAACCGAGCTCCAGGTGTTCCTGCCAGATTCTCAGGCTCCCTGATTGGAGACGAGGCTGCCCTCACCATCACAGGGGCACAGACTGAAGATGAGGCAATATATTTCTGTGCTCTATGGTTCAGCAACCATTGGGTGTTCGGTGGAGGAACCAAACTGACTGTCCTAGGT DNA
실시예 2. 인간화 항체의 제작 및 생산
상기 선별된 항체를 보다 의약적합성(druggable) 형태로 만들기 위하여, 인간화 항체의 제조를 수행하였다.
2.1. 인간화 항체의 제작
CDR 그래프팅 방법을 이용하여 상기 실시예 1에서 개발된 마우스 33B2 항체의 인간화 항체를 개발하였다. 개발된 항체의 CDR을 이식받을 인간 항체는 IMGT/V-QUEST를 이용하여 염기서열을 기준으로 유사성이 높은 인간 생식선(germline) 항체 유전자의 V 및 J 유전자를 선별하였다(Brochet, X. et al., Nucl Acids Res. 36:503-508(2008)). 중쇄사슬의 V 유전자 및 J 유전자로 각각 IGHV1-46*01 및 IGHJ4*03 유전자가 선별되었고, 이들의 유사성은 각각 74.65% 및 81.25% 였다. 그리고 경쇄사슬의 V 유전자 및 J 유전자로 각각 IGLV7-46*01 및 IGLJ3*02 유전자가 선별되었고, 이들의 유사성은 각각 63.54% 및 88.24% 였다. 합성시, 정방향에는 ClaI 제한효소 부위를 넣고, 역방향의 중쇄에는 NheI 제한효소 부위 및 경쇄에는 BsiWI 제한효소 부위를 각각 넣어주었다. 그리고 가변영역의 정방향에는 하기 표 2의 시그널 서열을 추가하여 인간화 항체가 세포 배양액으로 분비될 수 있도록 하였다.
Mouse IgG kappa의 signal peptide 서열
서열
번호		 명칭 서열 종류
11 Mouse IgG κ_Signal peptide METDTLLLWVLLLWVPGSTG PRT
합성이 완료된 각각의 가변 영역을, 인간 불변영역 Cκ와 CH에 연결하여 중쇄부분은 pcDNA3.3-TOPO(Invitrogen, K8300-01) 벡터로 TA 클로닝하고, 경쇄부분은 pOptiVEC-TOPO(Invitrogen, 12744-017) 벡터로 TA 클로닝을 수행하였다. 하기 표 3은 코티닌에 특이적으로 결합하는 인간화 항체(hz33B2)의 서열정보를 나타낸다.
코티닌(cotinine)에 특이적으로 결합하는 인간화 항체: hz33B2
서열
번호		 명칭 서열 종류
9 hz33B2_VH QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYWIQWVRQAPGQGLEWMGEIFPGTGTTYYNEKFKGRVTMTIDTSTSTVYMELSSLRSEDTAVYYCARGGYYYDSRAWFAYWGQGTLVTVSS PRT
10 hz33B2_VL QAVVTQEPSLTVSPGGTVTLTCRSSTGTVTTSNYANWVQQKPGQAPRGLIGGTNNRAPWTPARFSGSLLGDKAALTLSGAQPEDEAEYYCALWFSNHWVFGGGTKLTVLG PRT
14 hz33B2_VH CAAGTGCAGTTGGTCCAGTCAGGCGCAGAAGTAAAGAAACCAGGAGCGTCAGTTAAGGTCAGCTGCAAGGCGAGCGGCTATACGTTCACTTCATATTGGATTCAGTGGGTACGGCAAGCGCCTGGTCAGGGCTTGGAATGGATGGGCGAAATTTTTCCTGGGACCGGGACGACATATTACAACGAAAAGTTCAAGGGAAGAGTTACCATGACGATCGATACATCTACCAGTACAGTCTACATGGAACTTAGCAGTCTTAGGAGCGAGGATACAGCAGTATATTATTGTGCGAGAGGTGGATACTACTATGATAGCCGGGCGTGGTTCGCGTATTGGGGCCAGGGGACACTTGTGACCGTCAGTAGT DNA
15 hz33B2_VL CAAGCGGTTGTGACACAAGAGCCCTCTTTGACTGTAAGCCCGGGTGGTACGGTCACACTTACATGCCGCAGCTCTACCGGGACTGTAACAACCAGCAACTACGCGAACTGGGTACAACAGAAACCTGGACAAGCGCCACGCGGTTTGATAGGAGGGACGAATAATCGCGCCCCTTGGACCCCTGCGAGATTCTCTGGATCTTTGCTTGGGGACAAAGCAGCCCTTACCCTTAGCGGCGCACAGCCAGAGGATGAAGCTGAGTATTATTGCGCGCTGTGGTTTTCAAACCACTGGGTGTTCGGCGGCGGCACGAAATTGACCGTTCTTGGG DNA
2.2. 인간화 항체의 생산 및 정제
FreeStyleTM 293F(Invitrogen, R790-07) 동물세포에 폴리에틸렌이민(polyscience Inc., 23966)을 이용하여 상기 클로닝된 벡터를 일시 형질전환(transient transfection)시키고, 세포 배양액으로부터 Protein-A Ceramic HyperD F 레진(PALL, 20078-028)을 이용하여 인간화 항체를 정제하였다.
정제된 인간화 항체는 BCA 분석(Pierce, 23227)을 이용하여 정량하였고, SDS-PAGE를 수행하여 coomassie blue staining을 통하여 농도 및 순도를 확인하였다.
실시예 3. 인간화 항체(hz33B2)의 결합능 확인
3.1. 인간화 항체(hz33B2)의 코티닌 결합능 확인
상기 실시예 2에서 개발된 인간화 항체(hz33B2)의 코티닌 결합 능력을 확인하고자, 코티닌이 결합된 항-HER2 어피바디를 이용하여 ELISA 및 유세포 분석(Flow cytometry)를 수행하였다.
2 ㎍/mL의 농도로 hHER2-ECD-His 단백질이 코팅된 플레이트를 TBS-T(0.05% Triton X-100)로 3회 세척 후, 200 ㎕의 TBS-T/SM(3% skim milk)로 상온에서 120분 동안 블로킹(blocking) 하였다. 블로킹 된 플레이트를 TBS-T로 3회 세척 후, 코티닌이 결합된 항-HER2 어피바디(ZQAA1-Cot)를 2 ㎍/mL의 농도로 상온에서 1시간 동안 고착시켰다. 플레이트를 TBS-T로 3회 세척 후, 인간화된 항체를 20 ㎍/mL부터 1/10 dilution하여 9 point로 처리하고, 실온에서 1시간 동안 인큐베이션 하였다. 여기에서, SUN10 항체(US 2008-0226650 A1)를 양성대조군으로 사용하였다. 그런 다음, 2차 항체로써 anti-hIgG-Fc-HRP(Invitrogen, H10007)를 실온에서 1시간 동안 처리하였다. 마지막으로 TMB을 이용하여 발색반응을 수행하고, ELISA reader를 이용하여 OD450 값을 측정하였다.
그 결과, 도 3에 나타낸 바와 같이, 인간화 항체(hz33B2)가 코티닌에 높은 결합능을 가지는 것을 확인할 수 있었다.
3.2. 인간화 항체(hz33B2)의 세포 결합능 확인
인간화된 항체의 세포 결합 정도를 확인하기 위하여, HER2를 발현하는 SKOV-3 및 코티닌이 결합된 항-HER2 어피바디를 이용하여 Cell binding affinity assay를 수행함으로써 세포 결합능을 평가하였다.
HER2를 발현하는 SKOV-3(한국세포주은행, 30077)을 2 x 105 cells/tube로 준비한 다음, 1,200 rpm으로 3분간 원심분리하여 cell을 모아주었다. 그런 다음, 5% FBS가 포함된 PBS로 3회 세척한 후, 코티닌이 결합된 항-HER2 어피바디(ZQAA1-Cot)를 2 ㎍/mL의 농도로 4℃에서 1시간 동안 인큐베이션 하였다. Cell을 5% FBS가 포함된 PBS로 3회 세척한 후, 인간화된 항체를 20 ㎍/mL부터 1/10 dilution하여 6 point로 처리하고, 4℃에서 1시간 동안 인큐베이션 하였다. 여기에서, SUN10 항체(US 2008-0226650 A1)를 양성대조군으로 사용하였다. 다음으로, 200 ㎕의 5% FBS를 포함하는 PBS를 이용하여 1,200 rpm에서 3분동안 원심분리하는 방법으로 cell을 3회 세척하였다. 그 다음, 2차 항체로써 anti-human-IgG-BV421(BD, 562581)를 1 ㎍/mL를 처리하고 빛을 차단한 채로 4℃에서 30분간 인큐베이션 하였다. 상기 동일한 방법으로 세척한 후, FACS 기기를 이용하여 형광의 세기를 측정하였다.
그 결과, 도 4에 나타낸 바와 같이, 인간화 항체(hz33B2)가 코티닌이 결합된 표적 스위치와의 결합함으로써 높은 세포 결합능을 가지는 것을 확인할 수 있었다.
실시예 4. 인간화 항-코티닌 항체가 포함된 CAR-T의 개발 및 이의 활성 확인
4.1. 항-코티닌 항체 단편이 연결된 키메라 항원 수용체를 포함하는 렌티바이러스의 제작
항-코티닌 항체 단편을 이용하여 키메라 항원 수용체를 개발하였다. 키메라 항원 수용체는 CD8리더, scFV 형태의 항-코티닌, CD8 힌지 및 막관통 영역, CD137 세포질 영역, 및 CD3제타의 세포질 영역으로 구성되었다. 키메라 항원 수용체에 대한 코돈 최적화 후, 하기 표 4의 EF-1 alpha 프로모터로 변경된 pLenti6-V5/DEST렌티바이러스 벡터(Invitrogen, V53306)에 SpeI/XhoI으로 절단 및 결찰시켰다.
EF-1 alpha 프로모터 서열
서열
번호		 명칭 서열 종류
16 EF-1 alpha promoter GATGGAGTTTCCCCACACTGAGTGGGTGGAGACTGAAGTTAGGCCAGCTTGGCACTTGATGTAATTCTCCTTGGAATTTGCCCTTTTTGAGTTTGGATCTTGGTTCATTCTCAAGCCTCAGACAGTGGTTCAAAGTTTTTTTCTTCCATTTCAGGTGTCGTGA DNA
상기 제조된 컨스트럭트는 염기서열 분석을 통해 확인하였으며, 하기 표 5는 이에 대한 서열정보를 나타낸다.
CAR 컨스트럭트 서열
서열
번호		 명칭 서열 종류
17 CAR construct ATCGAGGTGATGTACCCTCCTCCCTATCTCGATAACGAGAAATCTAACGGCACCATCATCCATGTGAAAGGGAAACACCTCTGCCCTTCACCACTCTTCCCAGGTCCGAGCAAGCCAATTTATATCTGGGCACCGTTGGCGGGGACTTGCGGAGTGCTTTTACTTTCACTGGTTATTACGCTGTACTGTAAACGCGGTCGGAAGAAGCTCCTTTACATTTTCAAGCAGCCTTTTATGCGCCCAGTGCAGACCACACAGGAGGAAGATGGCTGTAGTTGCAGATTTCCCGAGGAAGAAGAGGGAGGGTGTGAACTGAGAGTCAAATTCAGCCGTTCCGCTGATGCCCCAGCCTATCAACAGGGGCAGAATCAACTGTATAATGAATTGAATCTGGGCAGGAGAGAAGAATACGACGTCCTGGATAAGAGGCGAGGCAGAGACCCCGAGATGGGCGGTAAACCCCGGCGGAAGAACCCCCAGGAAGGCCTGTACAACGAGCTGCAGAAGGACAAGATGGCTGAGGCCTACTCCGAAATAGGAATGAAGGGGGAGAGAAGGAGAGGCAAAGGACATGACGGCCTGTACCAGGGACTGTCTACAGCTACTAAGGACACCTATGATGCATTGCACATGCAAGCCCTACCCCCTAGA DNA
제조된 렌티바이러스 컨스트럭트를 바이러스 외피 단백질인 VSV-G(vesicular stomatitis indiana virus G protein)를 코딩하는 핵산과 gag, pol 및 rev 유전자를 포함하는 플라스미드인 pCMV-dR8.91과 함께 Lenti-X 293T(Takara Bio Incl., 632180) 세포주에 형질도입시켰다. 형질도입은 리포펙타민 2000(Invitrogen, 11668019)을 사용하여 제조사의 프로토콜에 따라 수행하였다. 72시간 후, 렌티바이러스가 함유된 배양액을 원심분리형 필터장치(Millipore, UFC910024)를 사용하여 10배 농축하여 -80℃에서 냉동 보관하였다.
4.2. 항-코티닌 항체 단편을 포함하는 키메라 항원 수용체가 표면에 제시된 세포독성 T 세포의 제조
실시예 4.1에서 제조된 렌티바이러스를 이용하여, 항-코티닌 항체 단편을 포함하는 키메라 항원 수용체가 표면에 제시된 세포독성 T 세포를 제조하였다.
먼저, 인간의 naive T 세포를 분리하여 DynabeadsTM Human T-Activator CD3/CD28(Thermofisher scientific, 11131D)로 24시간 동안 자극하고, 폴리브렌(Sigma-Aldrich, H9268) 및 상기 렌티바이러스를 상기 세포에 첨가하여 24시간 동안 배양하며 형질도입시켰다. 이후, IL-2(Gibco, CTP0021)가 포함된 배지로 교체하여 5% CO2, 37℃의 조건에서 배양하였다. 제조된 항-코티닌 항체 단편을 포함하는 키메라 항원 수용체가 표면에 제시된 T 세포는, 제조 후 24시간 이내로 이후의 실험에 사용되었다.
4.3. 항-코티닌 항체가 포함된 CAR-T를 이용한 세포독성효과 확인
상기 실시예 4.2.에서 제조된 CAR-T와 코티닌이 결합된 항-HER2 어피바디를 사용하여, 이들의 복합체가 세포 표면의 HER2를 인식함으로써, 키메라 항원 수용체 세포의 활성화를 유도하는지 여부를 확인하였다.
구체적으로, HER2 과발현 세포주인 SKOV-3 및 HER2 발현 세포주인 OVCAR-3에 GFP-Luciferase가 발현되는 렌티바이러스(Biosettia, GlowCell-16p-1)를 도입하여 유전자 도입 세포주인 SKOV3-Luc 및 OVCAR3-Luc 세포주를 구축하여 실험에 사용하였다. 먼저, SKOV3-Luc 세포주 및 OVCAR3-Luc 세포주를 96-웰 플레이트에 웰 당 1 x 104개가 되도록 분주하였다. Luc 세포주가 분주된 플레이트에 웰 당 SKOV3-Luc 또는 OVCAR3-Luc:세포독성 T 세포가 2:1의 비율(세포수 비율)이 되도록, 제조한 세포독성 T 세포를 첨가하였다. Luc 세포주와 세포독성 T 세포가 처리된 시험군에 코티닌이 결합된 항-HER2 어피바디를 농도에 맞게 첨가(0.1, 1, 10, 100 nM)하고, 5% CO2 및 37℃의 조건으로 24시간 동안 배양하였다. 여기에서, SUN10-CAR-T 세포(US 2008-0226650 A1)는 양성대조군으로 사용되었다. 배양 후, 세포독성 T 세포의 독성 효과는 luciferase 측정(Bio-Glo Luciferase assay system, Promega, G7941)을 통하여 확인하였다. 이는 세포독성 T 세포, 코티닌과 결합된 어피바디 및 Luc 세포주의 배양 후, 남아있는 SKOV3-Luc 또는 OVCAR3-Luc 세포주를 3X Lysis buffer(75mM Tris(pH8.0), 30% glycerol, 3% Triton X100)로 파쇄하여 용출되어 나오는 luciferase를 기질과 반응시켜 확인하였다. Lysis 비율은 Luc 세포주만 배양한 웰에서 나오는 시그널을 기준(100%)으로 하여 결정하였다.
도 6에서 나타낸 바와 같이, 모든 세포주에 대해 코티닌이 결합된 어피바디의 처리 농도가 증가함에 따라 세포 독성 효과가 증가하는 것을 확인할 수 있었다. 특히, 세포독성 효과가 기보고된 SUN10-CAR-T(US 2008-0226650 A1)와 대비하여, 동등한 세포독성을 보이거나, 고농도에서 상대적으로 우수한 세포독성 효과를 갖는 것을 확인하였다.
실시예 5. 코티닌 이성질체에 따른 CAR-T의 결합능 및 세포독성 활성 확인
코티닌은 두 개의 이성질체가 혼합된 형태로 존재하므로, 상기 개발된 항-코티닌 결합 항체가 각각의 코티닌 이성질체에 대하여 다른 결합 특성 및 세포독성 활성을 갖는지 확인하고자 하였다.
코티닌 이성질체에 따른 항-HER2 어피바디 제조
두 개의 이성질체가 혼합된 코티닌을 chiral column을 이용하여 2개의 단일 이성질체로 분리하였다. 분리된 각각의 이성질체는 crystal structure 분석을 통하여, R-이성질체와 S-이성질체로 결정되었다. 분리된 이성질체를 항-HER2 어피바디인 ZQAA1에 각각 결합하여 2개의 스위치를 합성하였다: ZQAA1-Cot(R) 및 ZQAA1-Cot(S).
5.1. 코티닌 이성질체에 따른 CAR-T의 결합능 확인
상기 제조된 각각의 상이한 코티닌 이성질체를 갖는 항-HER2 스위치에 대한 CAR-T의 결합능을 확인하고자, ELISA assay 및 Flow cytometry를 이용하여 분석하였다.
5.1.1. ELISA assay에 의한 CAR-T의 결합능 확인
먼저, ELISA assay를 이용하여 상기 2종의 항-HER2 스위치에 대한 CAR-T의 결합능을 확인하였다.
2 ㎍/mL의 농도로 hHER2-ECD-His 단백질이 코팅된 플레이트를 TBS-T(0.05% Triton X-100)로 3회 세척 후, 200 ㎕의 TBS-T/SM(3% skim milk)로 상온에서 120분 동안 블록킹하였다. 블록킹 된 플레이트를 TBS-T로 3회 세척 후, 상이한 코티닌 이성질체가 각각 결합된 2개의 항-HER2 스위치를 2 ㎍/mL의 농도로 상온에서 1시간 동안 고착시켰다. 이후, 플레이트를 TBS-T로 3회 세척 후, 인간화된 항체를 20 ㎍/mL부터 1/10 dilution하여 9 point로 첨가하고, 실온에서 1시간동안 인큐베이션 하였다. 2차 항체인 anti-hIgG-Fc-HRP(Invitrogen, H10007)을 실온에서 1시간 처리한 후, TMB를 첨가하여 발색반응을 수행하였다. 그 다음, ELISA 리더기를 이용하여 OD450 값을 측정하였다.
그 결과, 도 7에서 나타낸 바와 같이, 본 발명의 항-코티닌 항체를 포함하는 CAR-T가 코티닌의 S-이성질체가 결합된 항-HER2 스위치(ZQAA1-Cot(S))와 높은 결합능을 가지는 것을 확인할 수 있었다. 이는 혼합된 형태의 코티닌이 결합된 항-HER2 스위치(ZQAA1-Cot)에 대한 결과와 비교하여, 동일 또는 높은 수준의 결합능을 나타내었고, 더욱이, 고농도에서 S 타입의 코티닌 이성질체와의 결합능이 조금 더 높은 것으로 나타났다.
반면, 코티닌의 R-이성질체가 결합된 항-HER2 스위치(ZQAA1-Cot(R))와 거의 결합하지 못하는 것을 확인하였고, 이를 통해 본 발명의 항-코티닌 항체가 포함된 CAR-T는 코티닌의 S-이성질체와 특이적으로 결합하는 것임을 확인할 수 있었다.
5.1.2. Flow cytometry에 의한 CAR-T의 결합능 확인
다음으로, Flow cytometry를 이용하여, 항-코티닌 항체가 포함된 CAR-T에 대해, 상기 2종의 항-HER2 스위치가 결합하는지 확인하였다.
실시예 4.2를 통하여 제조된 h33B2-CART를 2 x 105 cells/tube로 준비한 다음, 1,200 rpm으로 3분간 원심분리하여 cell을 모아주었다. 5% FBS가 포함된 PBS로 세척한 후, 2종의 항-HER2 스위치를 2 ㎍/mL의 농도로 첨가하여 4℃에서 1시간 동안 인큐베이션 하였다. Cell을 상기 동일한 방법으로 세척한 후, HER2-ECD-Fc를 2 ㎍/mL의 농도로 첨가하여 4℃에서 1시간 동안 인큐베이션 하였다. 그런 다음, 200 ㎕의 5% FBS가 포함된 PBS를 이용하여 1,200 rpm으로 3분 동안 원심분리하는 방법으로 cell을 3회 세척하였다. 다음으로, 2 ㎕의 anti-CD3-APC-H7(BD, 560176), 2 ㎕의 an-human-Fc-PE(BioLegend, 410708), 및 5 ㎕의 7-ADD(BD, 559925)를 cell에 처리하고 빛을 차단한 채로 4℃에서 1시간 동안 인큐베이션 하였다. 그런 다음, 200 ㎕의 5% FBS가 포함된 PBS를 이용하여 1,200 rpm에서 3분 동안 원심분리하는 방법으로 cell을 3회 세척해주었다. 형광의 세기를 FACS 기기를 이용하여 측정하였다.
그 결과, 도 8에 나타낸 바와 같이, 본 발명의 항-코티닌을 포함하는 CAR-T는 코티닌의 S-이성질체가 결합된 항-HER2 스위치(ZQAA1-Cot(S))와 높은 결합능을 가지는 것을 확인할 수 있었다. 특히, 혼합된 형태의 코티닌이 결합된 항-HER2 스위치(ZQAA1-Cot)에 대한 것과 비교하여 동일 또는 높은 수준의 높은 결합능을 나타낸 반면, 코티닌의 R-이성질체에 대해서는 거의 결합능을 가지지 않는 것으로 나타났다. 이는 상기 ELISA assay 결과와 동일하게 확인되었다.
5.2. 코티닌 이성질체에 따른 CAR-T의 세포독성 활성 확인
본 발명의 항-코티닌 항체가 포함된 CAR-T를 이용하여, 상기 2종의 항-HER2 스위치에 따른 CAR-T의 세포독성 활성화를 확인하고자 하였다. 따라서, 실시예 4.2.를 통하여 제조된 hz33B2-CART를 이용하여, 실시예 4.3.과 동일한 방법으로 세포독성 활성을 평가하였다.
구체적으로, SKOV3-Luc 세포주를 96-웰 플레이트에 웰 당 1 x 104개가 되도록 분주하였다. Luc 세포주가 분주된 플레이트에 웰 당 SKOV3-Luc : 세포독성 T 세포가 1:2의 비율이 되도록, 제조한 세포독성 T 세포를 첨가하였다. Luc 세포주와 세포독성 T 세포가 처리된 시험군에 상기 2종의 항-HER2 어피바디를 농도에 맞게 첨가(0.0001, 0.001, 0.01, 0.1, 1, 10, 및 100 nM)하고, 5% CO2 및 37℃의 조건으로 24시간 동안 배양하였다. 배양 후, 세포독성 T 세포와 독성 효과(cytotoxicity)를 luciferase 측정(Bio-Glo Luciferase assay system, Promega, G7941)을 통하여 확인하였다. 이의 세포독성 효과는 세포독성 T 세포, 코티닌이 결합된 어피바디 및 Luc 세포주의 배양 후, 남아있는 SKOV3-Luc 세포주를 3X Lysis buffer(75mM Tris(pH8.0), 30% glycerol, 3% Triton X100)로 파쇄하여 용출되어 나오는 luciferase를 기질과 반응시켜 확인하였다. Lysis 비율은 Luc 세포주만 배양한 웰에서 나오는 시그널을 기준(100%)으로 하여 결정하였다.
그 결과, 도 9에서 코티닌의 S-이성질체가 결합된 항-HER2 스위치(ZQAA1-Cot(S))에 따른 우수한 세포독성 활성을 확인할 수 있었다. 특히, 이는 혼합된 형태의 코티닌이 결합된 항-HER2 스위치(ZQAA1-Cot)에 대한 것과 비교하여 동일한 수준의 높은 세포독성 활성을 나타내었다. 반면, 코티닌의 R-이성질체에 따른 세포독성 활성은 고농도 처리시에만 조금 증가했을 뿐, 현저히 낮은 수준의 활성을 갖는 것으로 나타났다.
따라서, 본 발명의 항-코티닌 항체는 코티닌 이성질체의 종류에 따라 코티닌 결합능 및 이를 이용한 CAR-T의 세포독성 활성에서도 차이를 보이는 것을 확인할 수 있었다.

Claims (15)

  1. 코티닌의 R-이성질체에 비하여, S-이성질체에 더 특이적으로 결합하는 항체 또는 그의 항원 결합 단편.
  2. 제 1항에 있어서, 상기 항체 또는 그의 항원 결합 단편은,
    서열번호 1의 아미노산 서열을 포함하는 HCDR1, 서열번호 2의 아미노산 서열을 포함하는 HCDR2, 및 서열번호 3의 아미노산 서열을 포함하는 HCDR3를 포함하는 중쇄가변 영역; 및
    서열번호 4의 아미노산 서열을 포함하는 LCDR1, 서열번호 5의 아미노산 서열을 포함하는 LCDR2, 및 서열번호 6의 아미노산 서열을 포함하는 LCDR3를 포함하는 경쇄가변 영역을 포함하는, 코티닌의 S-이성질체에 더 특이적으로 결합하는 항체 또는 그의 항원 결합 단편.
  3. 제 1항에 있어서, 상기 항체 또는 그의 항원 결합 단편은,
    (i) 서열번호 7의 아미노산 서열을 포함하는 중쇄가변 영역 및 서열번호 8의 아미노산 서열을 포함하는 경쇄가변 영역을 포함하거나; 또는
    (ii) 서열번호 9의 아미노산 서열을 포함하는 중쇄 가변 영역 및 서열번호 10의 아미노산 서열을 포함하는 경쇄가변 영역을 포함하는, 코티닌의 S-이성질체에 특이적으로 결합하는 항체 또는 그의 항원 결합 단편.
  4. 제 1 항에 있어서, 상기 항체 또는 항원 결합 단편은 중쇄 가변영역 및 경쇄 가변 영역을 포함하는 모노클로날 항체, 폴리클로날 항체, 인간 항체, 인간화 항체, 키메라 항체, scFv, Fab, F(ab), 및 F(ab)2로 이루어진 군으로부터 선택되는 것인, 항체 또는 그의 항원 결합 단편.
  5. 제 1 항 내지 제 4 항 중 어느 한 항에 따른 항체 또는 그의 항원 결합 단편을 인코딩하는 뉴클레오타이드 서열을 포함하는 핵산 분자.
  6. 제 5 항에 있어서, 상기 핵산 분자는,
    (i) 중쇄가변 영역을 인코딩하는 서열번호 12의 뉴클레오타이드 서열 및 경쇄가변 영역을 인코딩하는 서열번호 13의 뉴클레오타이드 서열을 포함하거나; 또는
    (ii) 중쇄가변 영역을 인코딩하는 서열번호 14의 뉴클레오타이드 서열 및 경쇄가변 영역을 인코딩하는 서열번호 15의 뉴클레오타이드 서열을 포함하는, 핵산 분자.
  7. 제5항의 핵산 분자를 포함하는 재조합 벡터.
  8. 제7항의 재조합 벡터를 포함하는 숙주세포.
  9. 제 1 항 내지 제 4 항 중 어느 한 항의 코티닌의 S-이성질체에 더 특이적으로 결합하는 항체 또는 그의 항원 결합 단편을 포함하는 키메라 항원 수용체.
  10. 제 1항 내지 제 4 항 중 어느 한 항의 코티닌의 S-이성질체에 더 특이적으로 결합하는 항체 또는 그의 항원 결합 단편을 포함하는 키메라 항원 수용체를 발현하는, 키메라 항원 수용체 이펙터 세포(effector cell).
  11. 제10항에 있어서, 상기 키메라 항원 수용체 이펙터 세포는 다음을 포함하는 스위치 분자(switch molecule)에 의해 활성화 조절이 되는 것인, 키메라 항원 수용체 이펙터 세포(effector cell):
    (a) 코티닌의 S-이성질체, 및
    (b) 표적세포 상에서 세포 표면 분자에 결합하는 표적화 모이어티(targeting moiety).
  12. 제 11 항에 있어서, 상기 활성화 조절을 위한 스위치 분자(switch molecule)를 구성하는 표적화 모이어티는 항체, 항체의 항원 결합 단편, 또는 타겟 결합 폴리펩타이드(target binding polypeptide)인 것인, 키메라 항원 수용체 이펙터 세포(effector cell).
  13. 제 12 항에 있어서, 상기 활성화 조절을 위한 스위치 분자는 S-이성질체의 코티닌이 접합된 코티닌-접합 어피바디(cotinine-conjugated affibody)인 것인, 키메라 항원 수용체 이펙터 세포(effector cell).
  14. 제 10 항의 키메라 항원 수용체 이펙터 세포(effector cell)를 유효성분으로 포함하는 면역 치료용 약제학적 조성물.
  15. 제 10 항의 키메라 항원 수용체 이펙터 세포(effector cell)를 유효성분으로 포함하는 면역 치료용 약제학적 키트.
PCT/KR2023/002676 2022-03-11 2023-02-24 코티닌을 표적하는 항체 또는 그의 항원 결합 단편, 이를 포함하는 키메라 항원 수용체 및 이들의 용도 WO2023171958A1 (ko)

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
KR10-2022-0031019 2022-03-11
KR20220031019 2022-03-11
KR1020220113082A KR102530111B1 (ko) 2022-03-11 2022-09-06 코티닌을 표적하는 항체 또는 그의 항원 결합 단편, 이를 포함하는 키메라 항원 수용체 및 이들의 용도
KR10-2022-0113082 2022-09-06

Publications (1)

Publication Number Publication Date
WO2023171958A1 true WO2023171958A1 (ko) 2023-09-14

Family

ID=86386078

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2023/002676 WO2023171958A1 (ko) 2022-03-11 2023-02-24 코티닌을 표적하는 항체 또는 그의 항원 결합 단편, 이를 포함하는 키메라 항원 수용체 및 이들의 용도

Country Status (2)

Country Link
KR (1) KR102530111B1 (ko)
WO (1) WO2023171958A1 (ko)

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20180031727A (ko) * 2015-08-17 2018-03-28 서울대학교산학협력단 항-코티닌 항체가 연결된 키메라 항체 수용체 및 이의 용도
KR20180081010A (ko) * 2017-01-05 2018-07-13 한국생명공학연구원 항-코티닌 키메릭 항원 수용체를 발현하는 자연살해 세포
WO2019036419A1 (en) * 2017-08-15 2019-02-21 Kalnik Matthew W NEW NICOTINE BINDING ANTIBODIES
KR20210129318A (ko) * 2020-04-17 2021-10-28 앱클론(주) 항-her2 어피바디 및 이를 스위치 분자로 이용하는 스위처블 키메라 항원 수용체

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20180031727A (ko) * 2015-08-17 2018-03-28 서울대학교산학협력단 항-코티닌 항체가 연결된 키메라 항체 수용체 및 이의 용도
KR20180081010A (ko) * 2017-01-05 2018-07-13 한국생명공학연구원 항-코티닌 키메릭 항원 수용체를 발현하는 자연살해 세포
WO2019036419A1 (en) * 2017-08-15 2019-02-21 Kalnik Matthew W NEW NICOTINE BINDING ANTIBODIES
KR20210129318A (ko) * 2020-04-17 2021-10-28 앱클론(주) 항-her2 어피바디 및 이를 스위치 분자로 이용하는 스위처블 키메라 항원 수용체

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
BJERCKE R. J., ET AL.: "STEREOSPECIFIC MONOCLONAL ANTIBODIES TO NICOTINE AND COTININE AND THEIR USE IN ENZYME-LINKED IMMUNOSORBENT ASSAYS.", JOURNAL OF IMMUNOLOGICAL METHODS, ELSEVIER SCIENCE PUBLISHERS B.V.,AMSTERDAM., NL, vol. 90, 1 January 1986 (1986-01-01), NL , pages 203 - 213, XP000916472, ISSN: 0022-1759, DOI: 10.1016/0022-1759(86)90077-3 *

Also Published As

Publication number Publication date
KR102530111B1 (ko) 2023-05-10

Similar Documents

Publication Publication Date Title
WO2020111913A1 (en) Anti-4-1bb antibody and use thereof
WO2019098682A1 (ko) 항-her2 항체 또는 그의 항원 결합 단편, 및 이를 포함하는 키메라 항원 수용체
WO2017052241A1 (en) Novel anti-mesothelin antibody and composition comprising the same
WO2019225787A1 (ko) 항-b7-h3 항체 및 그 용도
WO2019112347A2 (ko) 악성 b 세포를 특이적으로 인지하는 항체 또는 그의 항원 결합 단편, 이를 포함하는 키메라 항원 수용체 및 이의 용도
WO2014084607A1 (ko) 항체 중쇄불변부위의 이종이중체 고효율 형성을 유도하는 ch3 도메인 변이체 쌍, 이의 제조방법, 및 용도
WO2015058573A1 (zh) 拮抗抑制程序性死亡受体pd-1与其配体结合的单克隆抗体及其编码序列与用途
WO2015133817A1 (ko) B 세포 림프종 세포를 특이적으로 인지하는 단일클론항체 및 이의 용도
WO2019203600A1 (ko) 스위치 분자 및 스위처블 키메라 항원 수용체
WO2016137108A1 (en) Novel antibody binding to tfpi and composition comprising the same
WO2020005003A1 (ko) Lag-3에 특이적으로 결합하는 단클론항체 및 이의 용도
WO2014025198A2 (ko) Lfa3 변이체 및 상기 변이체 또는 lfa3 cd2 결합영역과 이에 표적 특이적 폴리펩타이드가 연결된 융합단백질 및 그 용도
WO2021235696A1 (ko) Cd22에 특이적인 항체 및 이의 용도
WO2023277361A1 (ko) 메소텔린 특이적 항체 및 이의 용도
WO2019078699A2 (ko) 항-vista 항체 및 이의 용도
WO2021210939A1 (ko) 항-her2 어피바디 및 이를 스위치 분자로 이용하는 스위처블 키메라 항원 수용체
WO2019125070A1 (ko) 악성 b 세포를 특이적으로 인지하는 항체 또는 그의 항원 결합 단편, 이를 포함하는 키메라 항원 수용체 및 이의 용도
WO2024049161A1 (ko) 신규한 항-pd-l1 키메릭 항원 수용체 및 이를 발현하는 면역세포
WO2021071319A1 (ko) 다중 특이적 융합 단백질 및 이의 용도
WO2020251316A1 (ko) α-SYN/IGF1R에 대한 이중 특이 항체 및 그 용도
WO2023171958A1 (ko) 코티닌을 표적하는 항체 또는 그의 항원 결합 단편, 이를 포함하는 키메라 항원 수용체 및 이들의 용도
WO2021235697A1 (ko) Cd22에 특이적인 항체 및 이의 용도
WO2022124866A1 (ko) 항-pd-1 항체 및 이의 용도
WO2021101349A1 (ko) Ror1 및 b7-h3에 결합하는 항체, 이를 포함하는 항체-약물 접합체 및 그 용도
WO2022145739A1 (en) Humanized antibody specific for cd22 and chimeric antigen receptor using the same

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 23767060

Country of ref document: EP

Kind code of ref document: A1