WO2018210759A1 - Preparation of biologically active complexes - Google Patents

Preparation of biologically active complexes Download PDF

Info

Publication number
WO2018210759A1
WO2018210759A1 PCT/EP2018/062396 EP2018062396W WO2018210759A1 WO 2018210759 A1 WO2018210759 A1 WO 2018210759A1 EP 2018062396 W EP2018062396 W EP 2018062396W WO 2018210759 A1 WO2018210759 A1 WO 2018210759A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
biologically active
peptide
salt
alpha
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2018/062396
Other languages
English (en)
French (fr)
Inventor
Aftab NADIM
Catharina Svanborg
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Hamlet Pharma AB
Original Assignee
Hamlet Pharma AB
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to KR1020267002686A priority Critical patent/KR20260021814A/ko
Priority to DK18729327.9T priority patent/DK3618848T3/da
Priority to AU2018269304A priority patent/AU2018269304B2/en
Priority to ES18729327T priority patent/ES2861252T3/es
Priority to EP18729327.9A priority patent/EP3618848B1/en
Priority to JP2019563219A priority patent/JP7672122B2/ja
Priority to PL18729327T priority patent/PL3618848T3/pl
Priority to CA3063285A priority patent/CA3063285A1/en
Priority to EP20208669.0A priority patent/EP3811967B1/en
Priority to CN201880032057.6A priority patent/CN110650746B/zh
Priority to KR1020197037015A priority patent/KR20200015557A/ko
Priority to US16/612,272 priority patent/US20200140481A1/en
Application filed by Hamlet Pharma AB filed Critical Hamlet Pharma AB
Priority to CN202411849059.8A priority patent/CN119700935A/zh
Publication of WO2018210759A1 publication Critical patent/WO2018210759A1/en
Anticipated expiration legal-status Critical
Priority to US17/146,588 priority patent/US12331073B2/en
Priority to JP2023040807A priority patent/JP7705160B2/ja
Priority to US19/205,790 priority patent/US20260085088A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K1/00General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
    • C07K1/107General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length by chemical modification of precursor peptides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/185Acids; Anhydrides, halides or salts thereof, e.g. sulfur acids, imidic, hydrazonic or hydroximic acids
    • A61K31/19Carboxylic acids, e.g. valproic acid
    • A61K31/20Carboxylic acids, e.g. valproic acid having a carboxyl group bound to a chain of seven or more carbon atoms, e.g. stearic, palmitic, arachidic acids
    • A61K31/201Carboxylic acids, e.g. valproic acid having a carboxyl group bound to a chain of seven or more carbon atoms, e.g. stearic, palmitic, arachidic acids having one or two double bonds, e.g. oleic, linoleic acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/38Albumins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/43Enzymes; Proenzymes; Derivatives thereof
    • A61K38/46Hydrolases (3)
    • A61K38/47Hydrolases (3) acting on glycosyl compounds (3.2), e.g. cellulases, lactases
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/54Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
    • A61K47/542Carboxylic acids, e.g. a fatty acid or an amino acid
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/54Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
    • A61K47/55Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound the modifying agent being also a pharmacologically or therapeutically active agent, i.e. the entire conjugate being a codrug
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K1/00General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
    • C07K1/14Extraction; Separation; Purification
    • C07K1/34Extraction; Separation; Purification by filtration, ultrafiltration or reverse osmosis
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/76Albumins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2300/00Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides

Definitions

  • the present invention relates to methods for preparing biologically active complexes that have therapeutic activity in particular in the treatment of tumours or as antibacterial or antiviral agents.
  • the present invention further relates to methods of treating tumors and cancers, in particular to methods for selectively targeting tumor cells in preference to healthy cells, as well as to novel complexes and compositions for use in these methods.
  • HAMLET human alpha-lactalbumin made lethal to tumor cells
  • HAMLET was discovered by serendipity when studying the ability of human milk to prevent bacteria from binding to cells.
  • HAMLET displays broad anti-tumor activity with a high degree of tumor selectivity and subsequent therapeutic studies have confirmed HAMLET ' s tumoricidal activity and relative selectivity for tumor tissue in vivo.
  • topical HAMLET administration removed or reduced the size of skin papillomas and in patients with bladder cancer, local instillations of HAMLET caused rapid death of tumor cells but not of healthy tissue surrounding the tumor.
  • HAMLET therapeutic efficacy of HAMLET in bladder cancer was recently demonstrated in a murine bladder cancer model and HAMLET treatment delayed tumor progression and led to increased survival in a rat glioblastoma xenograft model without evidence of cell death in healthy brain tissue. HAMLET thus appears to identify death pathways that are conserved in tumor cells, thereby distinguishing them from healthy, differentiated cells.
  • Procedures of this type have been used to produce other biologically active complexes including BAMLET, from bovine alpha-lactalbumin, and complexes formed from recombinant forms of alpha-lactalbumin, in particular those without cysteine residues as described in WO
  • BAMLET is prepared in a one-phase system, in which a-lactalbumin is reconstituted in phosphate buffered saline (PBS) and sodium oleate added. The mixture is then heated to temperatures at or above 60°C and active complex obtained.
  • PBS phosphate buffered saline
  • This method has the advantage of being simple to carry out, and may even be carried out in-situ in a clinical situation with the assistance of kits.
  • biologically active complex is prepared by dissolution of previously lyophilized complex in PBS (see for example WO2010/079362) for use.
  • Phosphate buffered saline as used previously, comprises a mixture of at least three and sometimes four salts. These are sodium chloride, disodium phosphate and mono- potassium phosphate, as well as in some cases also, potassium chloride.
  • a biologically active complex comprising dissolving a mixture of a polypeptide element in powder form and oleic acid or a pharmaceutically acceptable salt thereof also in solid form, in an aqueous solvent comprising at least two salts, the first of which is sodium or potassium chloride and the second of which is disodium phosphate or mono-potassium phosphate, wherein, in particular, the method is carried out at moderate temperature.
  • the expression 'moderate temperature' refers to temperatures of up to 50°C, for example from 0-50°C, for example from 10-40°C, and more particularly from 15- 25°C, such as at ambient temperature. Such temperatures are generally below the 'melt temperature' at which the polypeptides become unfolded or denatured. However, the applicants have found that they are still able to form biologically active complexes under these salt conditions.
  • active complex can be prepared which shows a clear dose- dependent response, by the simple dissolution method of the invention.
  • the mixture may be warmed for example to temperatures of up to 50°C, such as up to 40°C to achieve rapid dissolution, there is no need to heat the solution extensively such as described in by boiling, provided only that a suitable salt balance is present in the aqueous solvent.
  • the method is carried out at ambient temperature
  • Dissolution may be facilitated by agitation, for example by vortexing. If required, the solution may be filtered through a sterile filter at this stage. Suitable filters include polyethersulfone membranes (PES) or Minisart® NML Cellulose acetate membranes.
  • any such agitation processes will be carried out for a period of time sufficient to ensure the dissolution of the elements in the salt solution.
  • the precise timings may vary depending upon factors such as the particular nature of the polypeptide being used and the temperature at which the mixture is held, the timings will typically be quite short, for example no more than 10 minutes, for example from 1-5 minutes such as about 2 minutes.
  • the solvent further comprises a third salt which is mono-sodium or mono-potassium phosphate, and in particular is mono-potassium phosphate.
  • a third salt which is mono-sodium or mono-potassium phosphate, and in particular is mono-potassium phosphate.
  • This method is therefore easy to prepare in a variety of manufacturing and non- manufacturing environments.
  • polypeptide used herein includes proteins and peptides including long peptides.
  • suitable "polypeptide elements" for use in the method of the invention include naturally- occurring proteins, in particular alpha-lactalbumin, lysozyme or other proteins having a membrane perturbing activity, recombinant proteins and in particular variants of said naturally-occurring proteins which lack intra-molecular bonds for example as a result of mutation of cysteine residues, or in particular, fragments of any of these proteins, in particular peptides of up to 50 amino acids.
  • variant refers to proteins or polypeptides having a similar biological function but in which the amino acid sequence differs from the base sequence from which it is derived in that one or more amino acids within the sequence are substituted for other amino acids.
  • Amino acid substitutions may be regarded as "conservative" where an amino acid is replaced with a different amino acid with broadly similar properties. Non- conservative substitutions are where amino acids are replaced with amino acids of a different type.
  • conservative substitution is meant the substitution of an amino acid by another amino acid of the same class, in which the classes are defined as follows:
  • Nonpolar A, V, L, I, P, M, F, W
  • altering the primary structure of a peptide by a conservative substitution may not significantly alter the activity of that peptide because the side-chain of the amino acid which is inserted into the sequence may be able to form similar bonds and contacts as the side chain of the amino acid which has been substituted out. This is so even when the substitution is in a region which is critical in determining the peptide's conformation.
  • Non-conservative substitutions are possible provided that these do not interrupt the function of the DNA binding domain polypeptides.
  • Determination of the effect of any substitution is wholly within the routine capabilities of the skilled person, who can readily determine whether a variant polypeptide retains the fundamental properties and activity of the basic protein.
  • the skilled person will determine whether complexes comprising the variant retain biological activity (e.g tumour cell death) of complexes formed with unfolded forms of the native protein and the polypeptide has at least 60%, preferably at least 70%, more preferably at least 80%, yet more preferably 90%, 95%, 96%, 97%, 98%, 99% or 100% of the native protein.
  • Variants of the polypeptide may comprise or consist essentially of an amino acid sequence with at least 70% identity, for example at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 96%, 97%, 98% or 99% identity to a native protein sequence such as an
  • alphalactalbumin or lysozyme sequence alphalactalbumin or lysozyme sequence.
  • the level of sequence identity is suitably determined using the BLASTP computer program with the native protein sequences as the base sequence. This means that native protein sequences form the sequence against which the percentage identity is determined.
  • the BLAST software is publicly available at http://blast.ncbi.nlm.nih.gov/Blast.cgi (accessible on 10 May 2017).
  • the polypeptide element is a peptide that has no more than 50 amino acids, and in particular may have from 10-45 amino acids.
  • Such complexes are easier to prepare and the starting materials are less costly.
  • peptides may be prepared using conventional methods for the production of peptides.
  • the complexes formed may be easier to handle and formulate for administration, due to the smaller molecular weight. It is suitably derived from a naturally occurring protein or a variant thereof. Suitable proteins are those identified as being active in such complexes, such as alpha-lactalbumin, beta-lactoglobulin or lysozyme, but may be derived from any membrane perturbing proteins.
  • Membrane perturbing proteins are proteins which have the capability of interacting with the interface of cell membranes, in particular causing disruption such as tubulation of the cell membrane. Typically, the protein will become embedded in the cell membrane.
  • proteins examples include coat complexes such as COPI, COPII (such as SAR 1), HOPS/CORVET, SEA (Sehl-associated), and clathrin complexes BAR domain proteins such as endophilins, and the ESCRT complex, including Snf7 domain subunits.
  • coat complexes such as COPI, COPII (such as SAR 1), HOPS/CORVET, SEA (Sehl-associated), and clathrin complexes BAR domain proteins such as endophilins, and the ESCRT complex, including Snf7 domain subunits.
  • the peptide is derived from the alpha-helical domain of a naturally occurring protein as described above.
  • the alpha-helical domain of said proteins would be well understood in the art or may be determined using conventional methods.
  • alpha-helical domain contains a cysteine residue
  • the peptide is a fragment of alpha-lactalbumin and specifically a fragment of the alpha domain of alpha-lactalbumin.
  • the peptide comprises amino acids of the Alpha 1 (residues 1-40) or Alpha 2 (residues 81-123) of human alpha-lactalbumin, or analogous regions of other alphalactalbumins such as bovine alpha-lactalbumin.
  • the peptide suitably contains no elements that give rise to folding and therefore suitably lacks amino acids that give rise to intramolecular bonding such as cysteine residues.
  • any cysteine residues are replaced by other amino acids such as alanine.
  • the complex comprises amino acids of the Alpha 1 (residues 1-40) or Alpha 2 (residues 81-123) of human alpha-lactalbumin wherein the cysteines are replaced with other amino acids such as alanine, to prevent any intramolecular bonding.
  • the peptide may be of SEQ ID NO 1 or SEQ ID NO 2 KQFTKXELSQLLKDIDGYGGIALPELIXTMFHTSGYDTQA (SEQ ID NO 1)
  • LDDDITDDIMXAKKILDIKGIDYWLAHKALXTEKLEQWLXEKL (SEQ ID NO 2) where X is an amino acid residue other than cysteine.
  • sequences are those of SEQ ID NO 3 or SEQ ID NO 4.
  • the peptides of SEQ ID NO 1 may be truncated, for example by omitting the terminal alanine residue, resulting in a peptide of SEQ ID NO 6, of which SEQ ID NO 7 is a specific example.
  • KQFTKXELSQLLKDIDGYGGIALPELIXTMFHTSGYDTQ SEQ ID NO 6
  • KQFTKAELSQLLKDIDGYGGIALPELIATMFHTSGYDTQ SEQ ID NO 7
  • Such peptides are novel and form a further aspect of the invention, together with biologically active complexes comprising them.
  • peptides may also be used in the complex and the suitability may be tested by determining whether complexes with a fatty acid salt are active, for instance in killing cells using methods as described hereinafter.
  • the peptide is derived from a COPII family protein such as SARI .
  • a particular example of such a peptide is a peptide of SEQ ID NO 5
  • MAGWDIFGWF RDVLASLGLW NKH (SEQ ID NO 5).
  • the polypeptide element is a naturally-occurring protein or a synthetic form thereof, in particular an alpha-lactalbumin, such as human, bovine, sheep, camel or goat alpha-lactalbumin.
  • the protein is bovine lactalbumin.
  • biologically active means that the complex has a biological activity, which is different from - or stronger than the individual components.
  • the complex is able to induce cell death in particular selectively in tumour cells and/or has a bactericidal or antiviral effect not seen with the native protein including for example monomeric ⁇ -lactalbumin forms, although other therapeutic effects may be available.
  • a pharmaceutically acceptable salt of oleic acid is used in the process.
  • Suitable pharmaceutically acceptable salts would be understood in the art.
  • a salt, and in particular a water-soluble salt of the oleic acid, fatty acid or lipid means that the preparation method is facilitated since aqueous solutions may be formed for instance for application to ion exchange columns and the like.
  • Suitable water-soluble salts are alkali or alkaline-earth metal salts such as sodium or potassium salts.
  • salts and in particular oleate salts such as sodium oleate appear to have some inherent tumoricidal effect. Therefore the inclusion of this in the complex may give rise to activity increases.
  • the first salt used in the method of the invention is sodium chloride.
  • the second salt used in the method of the invention is disodium phosphate.
  • the third salt used in the method of the invention is mono-potassium phosphate.
  • the ratio of first salt : second salt used in the method of the invention is suitably from 8 : 1 to 1 : 1, for example from 5: 1 to 2: 1 and in particular from 4: 1 to 3.5 : 1.
  • the ratio of first salt: third salt is from 20: 1 to 5: 1, for example from 15: 1 to 10 : 1 such as from 12.5 : 1 to 11.5 : 1.
  • the ratio of first to second to third salt is 13-12:4-3 : 1.
  • the ratio of oleic acid or oleate: peptide mixed in the method of the invention is suitably in the range of from 20 : 1 to 1 to 1, but preferably an excess of oleate is present, for instance in a ratio of oleate: peptide of about 5: 1.
  • the mixing can be carried out at a temperature of from 0-50°C, conveniently at ambient temperature and pressure.
  • the product of the process of the invention may solidified for example by lyophilisation, for storage or for formulation purposes. Thereafter, it may be reconstituted using in particular, sterile water, for use. Such procedures may be particularly suitable where the polypeptide is a peptide rather than a protein. The applicants have found that proteins may revert to the natural folding state when subjected to procedures such as lyophilisation.
  • the problem may be alleviated by stabilising the polypeptide in the unfolded state, for example by lowering the pH of the solution, for instance to a value of 4 or less, or adding calcium chelators such as EDTA to the solvent during the preparation method.
  • the invention provides a complex obtainable by the method of the first aspect.
  • complexes of the second aspect of the invention may be formulated into useful pharmaceutical compositions by combining them with pharmaceutically acceptable carriers in the conventional manner.
  • Such compositions form a third aspect of the invention.
  • compositions in accordance with the third aspect of invention are suitably prepared
  • compositions in a form suitable for topical use for example as creams, ointments, gels, or aqueous or oily solutions or suspensions.
  • These may include the commonly known carriers, fillers and/or expedients, which are pharmaceutically acceptable.
  • Topical solutions or creams suitably contain an emulsifying agent for the protein complex together with a diluent or cream base.
  • the daily dose of the complex varies and is dependant on the patient, the nature of the condition being treated etc. in accordance with normal clinical practice. As a general rule from 2 to 200 mg/dose of the biologically active complex is used for each administration.
  • a method for treating cancer which comprises administering to a patient in need thereof, a biologically active complex as described above.
  • the complex may be used to treat cancers such as human skin papillomas, human bladder cancer and glioblastomas.
  • administration may be by infusion as is known in the art.
  • the invention further provides the biologically active complex as defined above for use in therapy, in particular in the treatment of cancer.
  • the complex may also be of use in the prevention of cancer, in particular gastrointestinal cancer as described for example in WO2014/023976.
  • the complex may be combined with a foodstuff, such as a dairy product such as yoghurt for use as a
  • compositions of this type form a further aspect of the invention.
  • Figure 1 shows the results of ATP Lite, PrestoBlue and Trypan Blue studies obtained using a range of biologically active complexes on tumour cells as described below;
  • Figure 2 shows a comparison of similar results obtained with and without filtration of the solutions;
  • Figure 3 shows (A) a schematic and photograph of the preparation of a complex comprising bovine alpha-lactalbumin, and (B) results of ATP Lite, PrestoBlue and Trypan Blue studies of tumour cells to which the resultant solution was administered .
  • a range of biologically active complexes were prepared using a peptide of SEQ ID NO 7
  • the complexes obtained were then lyophilised.
  • the lyophilization conditions were a pressure below 1.2 mbar and a temperature below -55 °C.
  • Each tube was stored at -20 °C or below and reconstituted by the addition of 30 ml. sterile water shortly before use.
  • Human lung carcinoma cells (A549, ATCC) were cultured in RPMI-1640 with non-essential amino acids (1 : 100), 1 mM sodium pyruvate, 50 ⁇ g/ml Gentamicin and 5-10% fetal calf serum (FCS) at 37 °C, 5 % C0 2 .
  • FCS fetal calf serum
  • cells were grown on 96-well plate (2xl0 4 /well, Tecan Group Ltd) overnight. Cells were incubated with biologically active complexes obtained in Example 1 at dosages equivalent to either 7, 21 or 35 ⁇ peptide in serum-free RPMI-1640 at 37 °C. FCS was added after 1 hour.
  • Cell death was quantified 3 hours after peptide-oleate treatment by three biochemical methods including 1) estimation of cellular ATP levels using luminescence based ATPIiteTM kit (Perkin Elmer) 2) Presto Blue fluorescence staining (Invitrogen, A13262) and 3) trypan blue exclusion assay. Fluorescence and luminescence was measured using a microplate reader (Infinite F200, Tecan).
  • Bovine alpha-lactalbumin (700 ⁇ ), in lyophilised form, was added to a tube together with sodium oleate flakes (3.5mM). Phosphate Buffered Saline (1ml) was then added to the tube which was vortexed at room temperature for 1-2 minutes. A clear solution formed (Figure 3A).

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Engineering & Computer Science (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Epidemiology (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Zoology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Immunology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Toxicology (AREA)
  • Analytical Chemistry (AREA)
  • Water Supply & Treatment (AREA)
  • Virology (AREA)
  • Communicable Diseases (AREA)
  • Oncology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)
  • Medicinal Preparation (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Coloring Foods And Improving Nutritive Qualities (AREA)
  • Inorganic Chemistry (AREA)
PCT/EP2018/062396 2017-05-14 2018-05-14 Preparation of biologically active complexes Ceased WO2018210759A1 (en)

Priority Applications (16)

Application Number Priority Date Filing Date Title
DK18729327.9T DK3618848T3 (da) 2017-05-14 2018-05-14 Biologisk aktive komplekser og terapeutiske anvendelser deraf
AU2018269304A AU2018269304B2 (en) 2017-05-14 2018-05-14 Preparation of biologically active complexes
ES18729327T ES2861252T3 (es) 2017-05-14 2018-05-14 Complejos biológicamente activos y usos terapéuticos de estos
EP18729327.9A EP3618848B1 (en) 2017-05-14 2018-05-14 Biologically active complexes and therapeutic uses thereof
JP2019563219A JP7672122B2 (ja) 2017-05-14 2018-05-14 生物活性複合体の調製
PL18729327T PL3618848T3 (pl) 2017-05-14 2018-05-14 Biologicznie aktywne kompleksy i ich zastosowania terapeutyczne
CA3063285A CA3063285A1 (en) 2017-05-14 2018-05-14 Preparation of biologically active complexes
CN201880032057.6A CN110650746B (zh) 2017-05-14 2018-05-14 生物活性复合物的制备
EP20208669.0A EP3811967B1 (en) 2017-05-14 2018-05-14 Preparation of biologically active complexes
KR1020267002686A KR20260021814A (ko) 2017-05-14 2018-05-14 생물학적 활성 복합체의 제조방법
US16/612,272 US20200140481A1 (en) 2017-05-14 2018-05-14 Preparation of biologically active complexes
KR1020197037015A KR20200015557A (ko) 2017-05-14 2018-05-14 생물학적 활성 복합체의 제조방법
CN202411849059.8A CN119700935A (zh) 2017-05-14 2018-05-14 生物活性复合物的制备
US17/146,588 US12331073B2 (en) 2017-05-14 2021-01-12 Preparation of biologically active complexes
JP2023040807A JP7705160B2 (ja) 2017-05-14 2023-03-15 生物活性複合体の調製
US19/205,790 US20260085088A1 (en) 2017-05-14 2025-05-12 Preparation of biologically active complexes

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
GB1707715.7 2017-05-14
GBGB1707715.7A GB201707715D0 (en) 2017-05-14 2017-05-14 Preperation of biologically active complexes

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US16/612,272 A-371-Of-International US20200140481A1 (en) 2017-05-14 2018-05-14 Preparation of biologically active complexes
US17/146,588 Division US12331073B2 (en) 2017-05-14 2021-01-12 Preparation of biologically active complexes

Publications (1)

Publication Number Publication Date
WO2018210759A1 true WO2018210759A1 (en) 2018-11-22

Family

ID=59201543

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2018/062396 Ceased WO2018210759A1 (en) 2017-05-14 2018-05-14 Preparation of biologically active complexes

Country Status (13)

Country Link
US (3) US20200140481A1 (https=)
EP (2) EP3618848B1 (https=)
JP (2) JP7672122B2 (https=)
KR (2) KR20260021814A (https=)
CN (2) CN110650746B (https=)
AU (1) AU2018269304B2 (https=)
CA (1) CA3063285A1 (https=)
DK (2) DK3618848T3 (https=)
ES (2) ES2973290T3 (https=)
FI (1) FI3811967T3 (https=)
GB (1) GB201707715D0 (https=)
PL (2) PL3811967T3 (https=)
WO (1) WO2018210759A1 (https=)

Cited By (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3558290A2 (en) * 2016-12-20 2019-10-30 HAMLET Pharma AB Therapeutically active complexes
GB2574845A (en) * 2018-06-20 2019-12-25 Hamlet Pharma Ab Therapeutically active complexes
WO2019243547A1 (en) * 2018-06-20 2019-12-26 Hamlet Pharma Ab Therapeutically active complexes
WO2021032807A1 (en) * 2019-08-20 2021-02-25 Hamlet Pharma Ab Combination of a chemotherapeutic agent and alpha-lactoglubulin-oleic acid complex for cancer therapy
WO2022073982A1 (en) 2020-10-06 2022-04-14 Linnane Pharma Ab Method for preparing a composition comprising an unfolded protein
WO2024075003A1 (en) 2022-10-03 2024-04-11 Linnane Pharma Ab A complex comprising a alpha-lactalbumin and a fatty acid or lipid for use in the treatment or prevention of cancer
WO2024184318A1 (en) 2023-03-03 2024-09-12 Linnane Pharma Ab Method of predicting response to treatment
US12331073B2 (en) 2017-05-14 2025-06-17 Hamlet Pharma Ab Preparation of biologically active complexes
WO2025186107A1 (en) 2024-03-04 2025-09-12 Linnane Pharma Ab Therapy

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2010079362A1 (en) 2009-01-09 2010-07-15 Hamlet Pharma Ab Complex and production process
WO2010131010A2 (en) 2009-05-14 2010-11-18 Enovate Systems Limited Et Al Subsea winch
WO2012069836A2 (en) * 2010-11-24 2012-05-31 Hamlet Pharma Ab Biologically active complex and its preparation
WO2014023976A1 (en) 2012-08-09 2014-02-13 Hamlet Pharma Ab Prophylactic and nutraceutical therapy
WO2018116165A2 (en) * 2016-12-20 2018-06-28 Hamlet Pharma Ab Therapeutically active complexes

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA2537273A1 (en) * 2003-09-05 2005-03-17 Gtc Biotherapeutics, Inc. Method for the production of fusion proteins in transgenic mammal milk
WO2010131237A1 (en) 2009-05-13 2010-11-18 Agriculture And Food Development Authority (Teagasc) A process for producing a biologically active globular protein complex
GB201707715D0 (en) 2017-05-14 2017-06-28 Hamlet Pharma Ab Preperation of biologically active complexes

Patent Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2010079362A1 (en) 2009-01-09 2010-07-15 Hamlet Pharma Ab Complex and production process
WO2010131010A2 (en) 2009-05-14 2010-11-18 Enovate Systems Limited Et Al Subsea winch
WO2012069836A2 (en) * 2010-11-24 2012-05-31 Hamlet Pharma Ab Biologically active complex and its preparation
EP2643010B1 (en) 2010-11-24 2016-11-16 HAMLET Pharma AB Biologically active complex and its preparation
WO2014023976A1 (en) 2012-08-09 2014-02-13 Hamlet Pharma Ab Prophylactic and nutraceutical therapy
WO2018116165A2 (en) * 2016-12-20 2018-06-28 Hamlet Pharma Ab Therapeutically active complexes

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
SVENSSON, PROC NATL ACAD SCI U. S. A., vol. 97, 2000, pages 4221 - 4226
VUKOJEVIC ET AL., LANGMUIR, vol. 26, no. 18, 2010, pages 14782 - 14787
VUKOJEVIC ET AL: "Lipoprotein complex of equine lysozyme with oleic acid (ELOA) interactions with the plasma membrane of live cells", vol. 26, no. 18, 1 January 2010 (2010-01-01), pages 14782 - 14787, XP009503914, ISSN: 0743-7463, Retrieved from the Internet <URL:http://pubs.acs.org/doi/abs/10.1021/la1026416> DOI: 10.1021/LA1026416 *

Cited By (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3558290A2 (en) * 2016-12-20 2019-10-30 HAMLET Pharma AB Therapeutically active complexes
US12331073B2 (en) 2017-05-14 2025-06-17 Hamlet Pharma Ab Preparation of biologically active complexes
GB2574845A (en) * 2018-06-20 2019-12-25 Hamlet Pharma Ab Therapeutically active complexes
WO2019243547A1 (en) * 2018-06-20 2019-12-26 Hamlet Pharma Ab Therapeutically active complexes
WO2021032807A1 (en) * 2019-08-20 2021-02-25 Hamlet Pharma Ab Combination of a chemotherapeutic agent and alpha-lactoglubulin-oleic acid complex for cancer therapy
JP2022545429A (ja) * 2019-08-20 2022-10-27 ハムレット・ファルマ・アーベー がん治療のための化学療法剤とα-ラクトグロブリン-オレイン酸複合体との組合せ
WO2022073982A1 (en) 2020-10-06 2022-04-14 Linnane Pharma Ab Method for preparing a composition comprising an unfolded protein
US20230372450A1 (en) * 2020-10-06 2023-11-23 Linnane Pharma Ab Method for preparing a composition comprising an unfolded protein
WO2024075003A1 (en) 2022-10-03 2024-04-11 Linnane Pharma Ab A complex comprising a alpha-lactalbumin and a fatty acid or lipid for use in the treatment or prevention of cancer
WO2024184318A1 (en) 2023-03-03 2024-09-12 Linnane Pharma Ab Method of predicting response to treatment
WO2025186107A1 (en) 2024-03-04 2025-09-12 Linnane Pharma Ab Therapy

Also Published As

Publication number Publication date
JP2020519673A (ja) 2020-07-02
CN110650746A (zh) 2020-01-03
JP2023075290A (ja) 2023-05-30
AU2018269304B2 (en) 2025-02-27
EP3811967A1 (en) 2021-04-28
CN119700935A (zh) 2025-03-28
DK3618848T3 (da) 2021-03-01
EP3618848A1 (en) 2020-03-11
KR20260021814A (ko) 2026-02-13
US20200140481A1 (en) 2020-05-07
ES2973290T3 (es) 2024-06-19
GB201707715D0 (en) 2017-06-28
EP3618848B1 (en) 2020-11-25
CN110650746B (zh) 2024-12-31
US12331073B2 (en) 2025-06-17
PL3811967T3 (pl) 2024-03-18
US20260085088A1 (en) 2026-03-26
US20210130394A1 (en) 2021-05-06
JP7705160B2 (ja) 2025-07-09
DK3811967T5 (da) 2024-08-19
DK3811967T3 (da) 2024-01-08
PL3618848T3 (pl) 2021-06-14
JP7672122B2 (ja) 2025-05-07
FI3811967T3 (fi) 2023-12-28
ES2861252T3 (es) 2021-10-06
EP3811967B1 (en) 2023-12-20
AU2018269304A1 (en) 2019-11-21
CA3063285A1 (en) 2018-11-22
KR20200015557A (ko) 2020-02-12

Similar Documents

Publication Publication Date Title
US12331073B2 (en) Preparation of biologically active complexes
CN102264755A (zh) 靶向vegfr-1/nrp-1的肽
US20230372450A1 (en) Method for preparing a composition comprising an unfolded protein
JP2016540739A (ja) 神経保護ペプチド
TWI579299B (zh) 去整合蛋白變異體及其醫藥用途
CN106659764B (zh) 环状鞘脂激活蛋白原肽及其用途
HK40050699A (en) Preparation of biologically active complexes
HK40050699B (en) Preparation of biologically active complexes
HK40025666A (en) Biologically active complexes and therapeutic uses thereof
HK40025666B (en) Biologically active complexes and therapeutic uses thereof
TWI825397B (zh) 包含il-2蛋白及cd80蛋白的融合蛋白調配物
KR102532557B1 (ko) Dsg2 유래 펩타이드
KR20010100802A (ko) 세포내 신호전달을 교란시키는 합성 펩티드
CN116157142A (zh) 肽、肽的盐、药物组合物和生物体组织钙化抑制剂

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18729327

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3063285

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2019563219

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2018269304

Country of ref document: AU

Date of ref document: 20180514

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2018729327

Country of ref document: EP

Effective date: 20191203

Ref document number: 20197037015

Country of ref document: KR

Kind code of ref document: A

WWG Wipo information: grant in national office

Ref document number: 201880032057.6

Country of ref document: CN

WWC Wipo information: continuation of processing after refusal or withdrawal

Ref document number: 1020197037015

Country of ref document: KR

WWR Wipo information: refused in national office

Ref document number: 1020197037015

Country of ref document: KR