GB2574845A - Therapeutically active complexes - Google Patents
Therapeutically active complexes Download PDFInfo
- Publication number
- GB2574845A GB2574845A GB201810108A GB201810108A GB2574845A GB 2574845 A GB2574845 A GB 2574845A GB 201810108 A GB201810108 A GB 201810108A GB 201810108 A GB201810108 A GB 201810108A GB 2574845 A GB2574845 A GB 2574845A
- Authority
- GB
- United Kingdom
- Prior art keywords
- seq
- peptide
- biologically active
- salt
- active complex
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 62
- ZQPPMHVWECSIRJ-KTKRTIGZSA-N oleic acid Chemical compound CCCCCCCC\C=C/CCCCCCCC(O)=O ZQPPMHVWECSIRJ-KTKRTIGZSA-N 0.000 claims abstract description 21
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 15
- 150000001413 amino acids Chemical class 0.000 claims abstract description 14
- 150000003839 salts Chemical class 0.000 claims abstract description 12
- WRIDQFICGBMAFQ-UHFFFAOYSA-N (E)-8-Octadecenoic acid Natural products CCCCCCCCCC=CCCCCCCC(O)=O WRIDQFICGBMAFQ-UHFFFAOYSA-N 0.000 claims abstract description 9
- LQJBNNIYVWPHFW-UHFFFAOYSA-N 20:1omega9c fatty acid Natural products CCCCCCCCCCC=CCCCCCCCC(O)=O LQJBNNIYVWPHFW-UHFFFAOYSA-N 0.000 claims abstract description 9
- QSBYPNXLFMSGKH-UHFFFAOYSA-N 9-Heptadecensaeure Natural products CCCCCCCC=CCCCCCCCC(O)=O QSBYPNXLFMSGKH-UHFFFAOYSA-N 0.000 claims abstract description 9
- 239000005642 Oleic acid Substances 0.000 claims abstract description 9
- ZQPPMHVWECSIRJ-UHFFFAOYSA-N Oleic acid Natural products CCCCCCCCC=CCCCCCCCC(O)=O ZQPPMHVWECSIRJ-UHFFFAOYSA-N 0.000 claims abstract description 9
- 201000011510 cancer Diseases 0.000 claims abstract description 9
- QXJSBBXBKPUZAA-UHFFFAOYSA-N isooleic acid Natural products CCCCCCCC=CCCCCCCCCC(O)=O QXJSBBXBKPUZAA-UHFFFAOYSA-N 0.000 claims abstract description 9
- 238000011282 treatment Methods 0.000 claims abstract description 7
- -1 alkali metal salt Chemical class 0.000 claims abstract description 5
- 206010058467 Lung neoplasm malignant Diseases 0.000 claims abstract description 4
- BCKXLBQYZLBQEK-KVVVOXFISA-M Sodium oleate Chemical compound [Na+].CCCCCCCC\C=C/CCCCCCCC([O-])=O BCKXLBQYZLBQEK-KVVVOXFISA-M 0.000 claims abstract description 3
- 229910052783 alkali metal Inorganic materials 0.000 claims abstract description 3
- 210000004898 n-terminal fragment Anatomy 0.000 claims abstract description 3
- 238000002560 therapeutic procedure Methods 0.000 claims abstract description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 claims abstract description 3
- 229940096992 potassium oleate Drugs 0.000 claims abstract 2
- MLICVSDCCDDWMD-KVVVOXFISA-M potassium;(z)-octadec-9-enoate Chemical compound [K+].CCCCCCCC\C=C/CCCCCCCC([O-])=O MLICVSDCCDDWMD-KVVVOXFISA-M 0.000 claims abstract 2
- 238000000034 method Methods 0.000 claims description 9
- 239000008194 pharmaceutical composition Substances 0.000 claims description 6
- 206010005003 Bladder cancer Diseases 0.000 claims description 5
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 claims description 5
- 201000005112 urinary bladder cancer Diseases 0.000 claims description 5
- 208000005017 glioblastoma Diseases 0.000 claims description 3
- 201000010153 skin papilloma Diseases 0.000 claims description 3
- 208000008839 Kidney Neoplasms Diseases 0.000 claims description 2
- 206010038389 Renal cancer Diseases 0.000 claims description 2
- 239000003937 drug carrier Substances 0.000 claims description 2
- 201000010982 kidney cancer Diseases 0.000 claims description 2
- 201000005202 lung cancer Diseases 0.000 claims description 2
- 208000020816 lung neoplasm Diseases 0.000 claims description 2
- 239000000546 pharmaceutical excipient Substances 0.000 claims 1
- 210000004027 cell Anatomy 0.000 abstract description 8
- 238000010822 cell death assay Methods 0.000 abstract description 3
- 201000005296 lung carcinoma Diseases 0.000 abstract description 2
- 125000003275 alpha amino acid group Chemical group 0.000 abstract 1
- 102000004196 processed proteins & peptides Human genes 0.000 description 27
- 210000004881 tumor cell Anatomy 0.000 description 13
- 102000004407 Lactalbumin Human genes 0.000 description 11
- 108090000942 Lactalbumin Proteins 0.000 description 11
- 235000021241 α-lactalbumin Nutrition 0.000 description 11
- 239000000243 solution Substances 0.000 description 10
- 230000030833 cell death Effects 0.000 description 7
- 239000012528 membrane Substances 0.000 description 7
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 6
- 229940049964 oleate Drugs 0.000 description 6
- 229960005541 HAMLET Drugs 0.000 description 5
- 230000000694 effects Effects 0.000 description 5
- 230000002476 tumorcidal effect Effects 0.000 description 5
- 102100034668 Alpha-lactalbumin Human genes 0.000 description 4
- 101000946384 Homo sapiens Alpha-lactalbumin Proteins 0.000 description 4
- 230000007246 mechanism Effects 0.000 description 4
- 235000018102 proteins Nutrition 0.000 description 4
- 102000004169 proteins and genes Human genes 0.000 description 4
- 108090000623 proteins and genes Proteins 0.000 description 4
- 230000001225 therapeutic effect Effects 0.000 description 4
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 3
- 239000006071 cream Substances 0.000 description 3
- 239000012894 fetal calf serum Substances 0.000 description 3
- 238000002156 mixing Methods 0.000 description 3
- 239000000203 mixture Substances 0.000 description 3
- 230000003094 perturbing effect Effects 0.000 description 3
- 238000002360 preparation method Methods 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- SLXKOJJOQWFEFD-UHFFFAOYSA-N 6-aminohexanoic acid Chemical compound NCCCCCC(O)=O SLXKOJJOQWFEFD-UHFFFAOYSA-N 0.000 description 2
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 2
- 206010009944 Colon cancer Diseases 0.000 description 2
- 239000012980 RPMI-1640 medium Substances 0.000 description 2
- 229910052784 alkaline earth metal Inorganic materials 0.000 description 2
- 238000003556 assay Methods 0.000 description 2
- 229960002685 biotin Drugs 0.000 description 2
- 239000011616 biotin Substances 0.000 description 2
- 208000029742 colonic neoplasm Diseases 0.000 description 2
- 239000012634 fragment Substances 0.000 description 2
- 235000020256 human milk Nutrition 0.000 description 2
- 210000004251 human milk Anatomy 0.000 description 2
- 238000004020 luminiscence type Methods 0.000 description 2
- DAEPDZWVDSPTHF-UHFFFAOYSA-M sodium pyruvate Chemical compound [Na+].CC(=O)C([O-])=O DAEPDZWVDSPTHF-UHFFFAOYSA-M 0.000 description 2
- 210000001519 tissue Anatomy 0.000 description 2
- 230000000699 topical effect Effects 0.000 description 2
- 125000003088 (fluoren-9-ylmethoxy)carbonyl group Chemical group 0.000 description 1
- 229920000936 Agarose Polymers 0.000 description 1
- 102100023006 Basic leucine zipper transcriptional factor ATF-like 2 Human genes 0.000 description 1
- CEAZRRDELHUEMR-URQXQFDESA-N Gentamicin Chemical compound O1[C@H](C(C)NC)CC[C@@H](N)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](NC)[C@@](C)(O)CO2)O)[C@H](N)C[C@@H]1N CEAZRRDELHUEMR-URQXQFDESA-N 0.000 description 1
- 229930182566 Gentamicin Natural products 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 101000903615 Homo sapiens Basic leucine zipper transcriptional factor ATF-like 2 Proteins 0.000 description 1
- 108010070158 Lactose synthase Proteins 0.000 description 1
- 239000000232 Lipid Bilayer Substances 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 239000012901 Milli-Q water Substances 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 102000007079 Peptide Fragments Human genes 0.000 description 1
- 108010033276 Peptide Fragments Proteins 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 239000003513 alkali Substances 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 230000001093 anti-cancer Effects 0.000 description 1
- 230000000259 anti-tumor effect Effects 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 239000002585 base Substances 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 238000002306 biochemical method Methods 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 125000004057 biotinyl group Chemical group [H]N1C(=O)N([H])[C@]2([H])[C@@]([H])(SC([H])([H])[C@]12[H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C(*)=O 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 238000000423 cell based assay Methods 0.000 description 1
- 230000003915 cell function Effects 0.000 description 1
- 230000005859 cell recognition Effects 0.000 description 1
- 230000003833 cell viability Effects 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 238000001311 chemical methods and process Methods 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 230000008045 co-localization Effects 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 239000006185 dispersion Substances 0.000 description 1
- 229940000406 drug candidate Drugs 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 239000003797 essential amino acid Substances 0.000 description 1
- 235000020776 essential amino acid Nutrition 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 230000006870 function Effects 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 229960002518 gentamicin Drugs 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 229910052739 hydrogen Inorganic materials 0.000 description 1
- 239000001257 hydrogen Substances 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 230000002452 interceptive effect Effects 0.000 description 1
- 238000011835 investigation Methods 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 210000003712 lysosome Anatomy 0.000 description 1
- 230000001868 lysosomic effect Effects 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 238000013507 mapping Methods 0.000 description 1
- 239000002674 ointment Substances 0.000 description 1
- 150000002889 oleic acids Chemical class 0.000 description 1
- 238000010647 peptide synthesis reaction Methods 0.000 description 1
- WTJKGGKOPKCXLL-RRHRGVEJSA-N phosphatidylcholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCC=CCCCCCCCC WTJKGGKOPKCXLL-RRHRGVEJSA-N 0.000 description 1
- XAEFZNCEHLXOMS-UHFFFAOYSA-M potassium benzoate Chemical compound [K+].[O-]C(=O)C1=CC=CC=C1 XAEFZNCEHLXOMS-UHFFFAOYSA-M 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 230000009257 reactivity Effects 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- PYWVYCXTNDRMGF-UHFFFAOYSA-N rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 229940054269 sodium pyruvate Drugs 0.000 description 1
- 159000000000 sodium salts Chemical class 0.000 description 1
- 125000006850 spacer group Chemical group 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 238000002626 targeted therapy Methods 0.000 description 1
- 239000010409 thin film Substances 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 239000002691 unilamellar liposome Substances 0.000 description 1
- 210000002700 urine Anatomy 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/185—Acids; Anhydrides, halides or salts thereof, e.g. sulfur acids, imidic, hydrazonic or hydroximic acids
- A61K31/19—Carboxylic acids, e.g. valproic acid
- A61K31/20—Carboxylic acids, e.g. valproic acid having a carboxyl group bound to a chain of seven or more carbon atoms, e.g. stearic, palmitic, arachidic acids
- A61K31/201—Carboxylic acids, e.g. valproic acid having a carboxyl group bound to a chain of seven or more carbon atoms, e.g. stearic, palmitic, arachidic acids having one or two double bonds, e.g. oleic, linoleic acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/76—Albumins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y306/00—Hydrolases acting on acid anhydrides (3.6)
- C12Y306/05—Hydrolases acting on acid anhydrides (3.6) acting on GTP; involved in cellular and subcellular movement (3.6.5)
- C12Y306/05002—Small monomeric GTPase (3.6.5.2)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Zoology (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Gastroenterology & Hepatology (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- General Engineering & Computer Science (AREA)
- General Chemical & Material Sciences (AREA)
- Toxicology (AREA)
- Epidemiology (AREA)
- Biophysics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Immunology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Cell Biology (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- Microbiology (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
A peptide which comprises a N-terminal fragment of SEQ ID NO 1 of up to 19 amino acids in length. This peptide could for example have the amino acid sequence of SEQ ID NO 2 (Sar1a1) or SEQ ID NO 6 (Sar1a2). Both SEQ ID NO 2 and SEQ ID NO 6 are demonstrated to kill human lung carcinoma cells (A549, ATCC) in cell death assays. Also disclosed is a biologically active complex comprising a peptide which comprises a truncated form of SEQ ID NO 1 of up to 19 amino acids in length in combination with oleic acid or a salt thereof. The complexes may be uses in therapy or the treatment of cancer. The oleate salt may be water soluble and may be an alkali metal salt such as sodium oleate or potassium oleate. MAGWDIFGWFRDVLASLGLWNKH (SEQ ID NO 1) MAGWDIFGWFRDVLA (SEQ ID NO 2) WFRDVLASLGLWNKH (SEQ ID NO 6)
Description
THERAPEUTICALLY ACTIVE COMPLEXES
TECHNICAL FIELD
The present invention relates to a class of peptides which have therapeutic activity, in particular as anti-cancer or anti-tumour agents. Methods for preparing these peptides, as well as pharmaceutical compositions containing them form a further aspect of the invention.
BACKGROUND
Novel cancer treatments should ideally combine efficacy with selectivity for the targeted tumor and new, targeted therapies act with greater precision. Tissue toxicity and side effects are still the norm, however, and the notion of new, tumor specific mechanisms of cell death is justly regarded with skepticism. Yet, recent investigations into the tumoricidal effects of certain protein-lipid complexes suggest that tumor cells may share conserved mechanisms of cell death that distinguish them from normal, differentiated cells. These protein-lipid complexes insert into lipid bilayers and trigger cell death by perturbing the membrane structure of tumor cells. The subsequent internalization and inhibition of critical cellular functions distinguishes tumor cells from healthy differentiated cells and as a result, the tumor cells are killed while normal, differentiated cells survive.
These properties identify protein-lipid complexes as interesting drug candidates, with broad tumoricidal activity and documented tumor specificity. The feasibility of this approach is illustrated by HAMLET (Human Alpha-lactalbumin Made LEthal to Tumor cells), which was discovered serendipitously, in a fraction of human milk. HAMLET kills many different tumor cells with rapid kinetics and shows therapeutic efficacy in animal models of colon cancer, glioblastoma and bladder cancer. Investigator-driven clinical trials have demonstrated that HAMLET is active topically, against skin papillomas and induces shedding of dead tumor cells into the urine of patients with bladder cancer.
Alpha-lactalbumin is the most abundant protein in human milk, essential for the survival of lactating mammals, due to its role as a substrate specifier in the lactose synthase complex. HAMLET is formed by partial unfolding of globular alpha-lactalbumin and binding of deprotonated oleic acid, with a stoichiometry of 1/4-8.
A number of peptides derived from alpha-lactalbumin have also been found to have therapeutic effects in their own right (see for example WO2012/069836).
The applicants have previously identified specific alpha-lactalbumin peptide domains as the functional ligands for tumor cell recognition and death. Shared peptide reactivity among tumor cells from different tissues suggests that the alpha-helical peptide is recognized by tumor cell membranes in the context of oleic acid and that this interaction triggers a conserved death response in cancer cells and established cancers, in vivo. Thus, complexes comprising these peptides show broad tumoricidal activity, as exemplified by work done with the known complexes based upon alpha-helical domains of alphalactalbumin. However, the applicants have surprising found that these effects can be generalized to other alpha-domain peptides with membrane perturbing activity.
As described in co-pending International Patent Application No. PCT/IB2017/058140 a new, general mechanism by which alpha-helical peptides can target and kill tumor cells has been determined. The applicants found that membrane interactive peptide-domains form oleate complexes with broad tumoricidal activity. This concept is exemplified by the N-terminal alpha helices of alpha-lactalbumin, which invades tumor cells and accumulates in nuclear speckles, where it suppresses transcription through a direct effect on the speckle constituents SC-35, PKC and Pol II. This gain of function was reproduced for Sari in the COPII family, where the alpha-helical, membrane-integrating peptide gained tumoricidal activity, when mixed with oleate. The beta sheet domains of these proteins, in contrast, were sorted to the lysosomes for degradation. Synthetic alpha 1 peptide formed therapeutic oleate complexes that reduced tumor load in a murine bladder cancer model. These findings suggested that tumor cells recognize alpha-helical peptide motifs in the context of oleate and respond by activating a conserved mechanism of tumor cell death.
The peptides were derived from proteins with a membrane perturbing activity. In particular, the peptides were from 20-40 amino acids in length. They include an alpha peptide domain derived from the SARI protein of SEQ ID NO 1.
MAGWDIFGWF RDVLASLGLW NKH (SEQ ID NO 1)
As used herein the expression 'alpha-helical domain' refers to a motif in the secondary structure of the peptide in which a right-hand coiled or spiral conformation (helix) is formed, in which every backbone N-H group donates a hydrogen bond to the backbone C=O group of the amino acid located three or four residues earlier along the peptide sequence.
The applicants have now found that highly active complexes may be derived from smaller peptide fragments.
SUMMARY OF THE INVENTION
According to the present invention, there is provided a biologically active complex comprising a peptide which comprises a truncated form of SEQ ID NO 1 of up to 19 amino acids in length, and oleic acid or a salt thereof.
The truncated sequence of SEQ ID No 1 is up to 19 amino acids in length, for example up to 18 amino acids, or up to 15 amino acids in length. Typically, the peptide will be from 10-19 amino acids in length. Suitably, the peptide is an N-terminal fragment of SEQ ID NO 1.
A particular example of such a peptide is a peptide of SEQ ID NO 2.
MAGWDIFGWF RDVLA (SEQ ID NO 2)
The applicants have found that complexes may be formed with peptides comprising truncated forms of SEQ ID NO 1, whereas complexes made using truncated forms of other peptides known to produce active complexes, such as truncated forms of alpha peptides derived from alphalactalbumin, as described for example in EP-B-2643010, have reduced activity. The fact that peptides such as SEQ ID NO 2 produce complexes having such activity is therefore unexpected.
The use of shorter peptides may be desirable, both from the point of view of cost and complexity of production, and also from the point of view of reliability and consistency of product.
If desired however, the peptide may comprise small numbers of additional amino acid residues not obtained from SEQ ID NO 1, for example up to 6 amino acids, such as up to 3 amino acids, for example 1 or 2 additional amino acids, may be attached at N and/or C terminal of the peptide, if convenient, for example for expression or purification purposes, as would be understood in the art.
The complexes of the invention further comprise oleic acid or a salt thereof. In particular, the complex further comprises a water soluble oleate salt. Particular examples of suitable salts may include alkali or alkaline earth metal salts. In a particular embodiment, the salt is an alkali metal salt such as a sodium- or potassium salt.
According to a further aspect of the present invention there is provided a method for preparing a biologically active complex as described above. Said method may comprise combining together peptide as defined above; with oleic acid or a salt thereof, under conditions in which they form a biologically active complex.
Typically, the preparation may be carried out simply by mixing together a suitable peptide and oleic acid or a salt thereof, for example in a solution such as an aqueous solution. The ratio of oleate: peptide added to the mixture is suitably in the range of from 20:1 to 1 to 1, but preferably an excess of oleate is present, for instance in a ratio of oleate:peptide of about 5:1. The mixing can be carried out at a temperature of from 0-50°C, conveniently at ambient temperature and pressure. This simple preparation method provides a particular advantage for the use of such peptides in the complexes. The methods can be carried out in situ, when required for treatment. Thus kits may be provided comprising peptides and salts for mixing immediately prior to administration.
Such kits, and reagents for use in the kits form a further aspect of the invention. Peptides are suitably synthetic peptides although they may be prepared by recombinant DNA technology.
Peptides useful in forming the complexes of the invention are novel and these form yet a further aspect of the invention.
The complex of the invention can be used in the treatment of cancer. For this purpose, the complex is suitably formulated as a pharmaceutical composition.
Thus, complexes as described above and/or oleate salts also as described above, may be formulated into useful pharmaceutical compositions by combining them with pharmaceutically acceptable carriers in the conventional manner. Such compositions form a further aspect of the invention.
The compositions in accordance with this aspect of invention are suitably pharmaceutical compositions in a form suitable for topical use, for example as creams, ointments, gels, or aqueous or oily solutions or suspensions. These may include the commonly known carriers, fillers and/or expedients, which are pharmaceutically acceptable.
Topical solutions or creams suitably contain an emulsifying agent for the protein complex together with a diluent or cream base.
The daily dose of the complex varies and is dependent on the patient, the nature of the condition being treated etc. in accordance with normal clinical practice. As a general rule from 2 to 200 mg/dose of the biologically active complex is used for each administration.
In a further aspect of the invention, there is provided a method for treating cancer which comprises administering to a patient in need thereof, a biologically active complex as described above.
In particular, the complex may be used to treat cancers such as human skin papillomas, human bladder cancer, colon cancer, kidney cancer, lung cancer and glioblastomas. In the latter case, administration may be by infusion as is known in the art.
The invention further provides the biologically active complex as defined above for use in therapy, in particular in the treatment of cancer.
Throughout the description and claims of this specification, the words comprise and contain and variations of the words, for example comprising and comprises, mean including but not limited to, and do not exclude other components, integers or steps. Moreover the singular encompasses the plural unless the context otherwise requires: in particular, where the indefinite article is used, the specification is to be understood as contemplating plurality as well as singularity, unless the context requires otherwise.
Preferred features of each aspect of the invention may be as described in connection with any of the other aspects. Within the scope of this application it is expressly intended that the various aspects, embodiments, examples and alternatives set out in the preceding paragraphs, in the claims and/or in the following description and drawings, and in particular the individual features thereof, may be taken independently or in any combination. That is, all embodiments and/or features of any embodiment can be combined in any way and/or combination, unless such features are incompatible.
BRIEF DESCRIPTION OF THE DRAWINGS
One or more embodiments of the invention will now be described, by way of example only, with reference to the accompanying drawings, in which:
Figure 1 is a schematic diagram mapping the truncated peptides tested with the longer active peptides from which they are derived;
Figure 2 shows the results obtained in a cell death assay using complexes obtained using the peptides of Figure 1, where (A) shows the results of an ATPIite assay and (B) shows the results of a Prestoblue assay:
Figure 3 is a graph showing the average of 3 repeats of the cell death assay carried out on the complexes of the invention and complexes comprising the alpha-1 peptide of alphalactalbumin;
Figure 4 shows the results complexes of the invention on membrane perturbation using a giant unilamellar vesicle model.
DETAILED DESCRIPTION
Example 1
Peptide synthesis
The peptides to individual domain of alpha lactalbumin were commercially synthesized using the mild Fmoc chemistry method (Mimotopes, Melbourne, Australia). For biotinylated peptides, an aminohexanoic acid (Ahx) spacer was added to ensure adequate separation between the biotin and the peptide moiety. The sequences for the peptides are set out in the following table 1
Table 1
llllllllllllllll | Sequence | SEQ liillll |
alphal-pl | KQFTKAELSQLLKDI | 3 |
alphal-p2 | LLKDIDGYGGIALPE | 4 |
al-plp2 | KQFTKAELSQLLKDIDGYGGIALPE | 5 |
sarla-1 | MAGWDIFGWFRDVLA | 2 |
sarla-2 | WFRDVLASLGLWNKH | 6 |
Alpha-1 | KQFTKAELSQLLKDIDGYGGIALPELIATMFHTSGYDTQ | 7 |
Of these, peptides of SEQ ID No 3-5 represent fragments of the known active alpha peptide of alphalactalbumin, which is comprised in SEQ ID NO 7. Similarly, peptides of SEQ ID no 2 and 6 were fragments of the known active peptide of SEQ ID NO 4. This is illustrated schematically in Figure 1.
Complex Preparation
5mg of sodium oleate was dissolved in 1 ml of PBS to give a 16 mM clear solution, which was mixed with peptides in a ratio of oleate:peptide of 5:1.
Cellular assays
Human lung carcinoma cells (A549, ATCC) were cultured in RPMI-1640 with non-essential amino acids (1:100), 1 mM sodium pyruvate, 50 pg/ml Gentamicin and 5-10% fetal calf serum (FCS) at 37 °C, 5 % CO2. For cell death experiment, cells were grown on 96-well plate (2xl04/well, Tecan Group Ltd) overnight. Cells were incubated with peptide-oleate complexes in serum-free RPMI-1640 at 37 °C. FCS was added after 1 hour. After 3, 7 and 12 hours treatment cell death was quantified by two biochemical methods: Cell viability was quantified by Presto Blue fluorescence (Invitrogen, A13262) and cellular ATP levels using luminescence based ATPIite™ kit (Perkin Elmer). Fluorescence and luminescence was measured using a microplate reader (Infinite F200, Tecan).
The results are illustrated in Figure 2. It is clear from this result, that the peptide of SEQ ID NO 2 produced efficiacy similar to that obtainable using the favoured alpha-peptide of alpha-lactalbumin, in spite of the fact that it is considerably shorter. This result was confirmed when the average of 3 trials was compared as shown in Figure 3.
The complex of the invention was shown to produce membrane perturbation using a giant unilamellar vesicle model.
Coverslips were cleaned with IM NaOH and plasma etched for 1 min using BD-20 laboratory corona treater (Electro Technic Products Inc., USA) to render the surface clean and hydrophilic. A thin film of 1% solution of molten agarose was made on the coverslip to provide a safe reaction bed for the giant unilamellar vesicles (GUVs) to form. 10 mM solution of Phosphatidyl Choline and O.lmM l,2-dipalmitoyl-sn-glycero-3phosphoethanolamine-N-(cap biotinyl) (DPPE-biotin) in chloroform was labelled using 1 to 25 concentrations of Img/ml of Rhodamine. GUVs from this solution were formed onto the coverslips using a syringe through an air-blow dispersion method. Syke-Moore chambers were sonicated in IM Sodium Hydroxide and rinsed with Milli-Q water. The coverslips were locked in the chambers and the GUVs were mobilized and rehydrated using 200 mM of Sucrose solution for 25 minutes. Further, the GUVs were collected and allowed to settle in 200 mM of glucose solution for 60 minutes. Alexa-633 labelled and unlabeled peptidesoleate complex in the ratio of 1:4 was added to the solution in the observation chambers and monitored chronologically for at most 90 minutes. The GUVs were washed with PBS and monitored again to visualize co-localization.
The results are shown in Figure 4.
Claims (12)
1. A biologically active complex comprising a peptide which comprises a truncated form of SEQ ID NO 1 of up to 19 amino acids in length,
MAGWDIFGWF RDVLASLGLW NKH (SEQ ID NO 1) and oleic acid or a salt thereof.
2. A biologically active complex according to claim 1 wherein the peptide is of SEQ ID NO 2
MAGWDIFGWF RDVLA (SEQ ID NO 2).
3. A biologically active complex according to any one of the preceding claims which comprises a water soluble oleate salt.
4. A biologically active complex according to claim 3 wherein the salt is an alkali metal salt such as a sodium- or potassium oleate.
5. A method for preparing a biologically active complex according to any one of the preceding claims which comprises combining together a peptide as defined in claim 1 or claim 2, with oleic acid or a salt thereof, under conditions in which they form a biologically active complex.
6. A kit comprising a peptide as defined in claim 1 or claim 2 and oleic acid or a salt thereof.
7. A peptide which comprises a N-terminal fragment of SEQ ID NO 1 of up to 19 amino acids in length.
8. A peptide according to claim 7 which is of SEQ ID NO 2.
9. A pharmaceutical composition comprising a biologically acceptable complex according to any one of claims 1 to 4 in combination with a pharmaceutically acceptable carrier or excipient.
10. A method for treating cancer which comprises administering to a patient in need thereof, an effective amount of a biologically active complex according to claim 1 or claim 2, or a pharmaceutical composition according to claim 9.
11. A method according to claim 102 wherein the cancer is a human skin papilloma, human bladder cancer, kidney cancer, lung cancer and glioblastomas.
12. A biologically active complex as defined in any one of claim 1 or claim 2 for use in
15 therapy, in particular in the treatment of cancer.
Priority Applications (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
GB201810108A GB2574845A (en) | 2018-06-20 | 2018-06-20 | Therapeutically active complexes |
PCT/EP2019/066409 WO2019243547A1 (en) | 2018-06-20 | 2019-06-20 | Therapeutically active complexes |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
GB201810108A GB2574845A (en) | 2018-06-20 | 2018-06-20 | Therapeutically active complexes |
Publications (2)
Publication Number | Publication Date |
---|---|
GB201810108D0 GB201810108D0 (en) | 2018-08-08 |
GB2574845A true GB2574845A (en) | 2019-12-25 |
Family
ID=63042562
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
GB201810108A Withdrawn GB2574845A (en) | 2018-06-20 | 2018-06-20 | Therapeutically active complexes |
Country Status (1)
Country | Link |
---|---|
GB (1) | GB2574845A (en) |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2018116165A2 (en) * | 2016-12-20 | 2018-06-28 | Hamlet Pharma Ab | Therapeutically active complexes |
WO2018210759A1 (en) * | 2017-05-14 | 2018-11-22 | Hamlet Pharma Ab | Preparation of biologically active complexes |
-
2018
- 2018-06-20 GB GB201810108A patent/GB2574845A/en not_active Withdrawn
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2018116165A2 (en) * | 2016-12-20 | 2018-06-28 | Hamlet Pharma Ab | Therapeutically active complexes |
WO2018210759A1 (en) * | 2017-05-14 | 2018-11-22 | Hamlet Pharma Ab | Preparation of biologically active complexes |
Non-Patent Citations (2)
Title |
---|
Journal of Biochemistry, Vol. 116 No. 2, 1994, Nakano et al., "Mutational analysis of the Sar1 protein, a small GTPase which is essential for vesicular transport from the endoplasmic reticulum", pages 243-247. * |
The Journal of Cell Biology, Vol. 109 No. 6, 1989, Nakano et al., "A novel GTP-binding protein, Sar1p, is involved in transport from the endoplasmic reticulum to the golgi apparatus", pages 2677-2691. * |
Also Published As
Publication number | Publication date |
---|---|
GB201810108D0 (en) | 2018-08-08 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
Chen et al. | Molecular mechanisms of anticancer action and cell selectivity of short α-helical peptides | |
CN109513010B (en) | Self-assembling drug nanoconjugates for tumor cell specific responses | |
US11078235B2 (en) | Cyclic peptide conjugates and methods of use | |
CN111617250B (en) | Multi-ligand drug couplet and application thereof | |
US20210130394A1 (en) | Preparation of biologically active complexes | |
EP2552470B1 (en) | Peptides for promoting angiogenesis and an use thereof | |
CN113549129B (en) | D-configuration anti-tumor peptide and preparation method and application thereof | |
EP3024844B1 (en) | Short peptides derived from vdac1, compositions and methods of use thereof | |
JP4286535B2 (en) | Liposomes encapsulating anticancer agents and their use in the treatment of malignant tumors | |
US20150202248A1 (en) | E2f as a target of hormone refractory prostate cancer | |
CN106466485B (en) | Targeting ligand-drug conjugate with function of mediating cell endocytosis | |
Barragán-Cárdenas et al. | Changes in length and positive charge of palindromic sequence RWQWRWQWR enhance cytotoxic activity against breast cancer cell lines | |
GB2574845A (en) | Therapeutically active complexes | |
KR102068295B1 (en) | Cancer microenvironment-sensitive combinatorial drug delivery system containing a new lipid-peptide-polymer conjugate as a substrate of cancer-overexpressing enzyme | |
CN108350046B (en) | Analogs of VDAC 1-derived peptides | |
KR102017973B1 (en) | Anti-Hepatitis B Virus X Protein Polypeptide Pharmaceuticals | |
US20180148474A1 (en) | Peptide derivative for regulating thymic stromal lymphoid protein-mediated signaling and pharmaceutical composition for preventing and treating allergy and asthma diseases comprising same | |
JPWO2002028399A1 (en) | Apoptosis inducer, caspase cascade activator and anticancer agent | |
US9556226B2 (en) | Peptides with antifungal activity and methods of using the peptides | |
KR102355987B1 (en) | Anticancer Agent Consisted of Unsaturalted Fatty Acid-Conjugated CP2c-Targeting Peptide | |
KR20070087267A (en) | Biologically active peptide comprising tyrosyl-seryl-valine (ysv) | |
KR102458709B1 (en) | Composition for intraperitoneal administration for the prevention or treatment of ovarian cancer | |
CN111529688B (en) | Application of antibacterial peptide in preparation of lung cancer treatment medicine | |
JP7302887B2 (en) | ANTI-CANCER PEPTIDE AND USES THEREOF | |
Bang et al. | Targeted Delivery of siRNA through Nanocomplex using Specific Fusion Peptides for Breast Cancer Treatment |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
COOA | Change in applicant's name or ownership of the application |
Owner name: HAMLET PHARMA AB Free format text: FORMER OWNERS: CATHARINA SVANBORG;CHIN SHING HO |
|
WAP | Application withdrawn, taken to be withdrawn or refused ** after publication under section 16(1) |