WO2018160704A1 - Anti-tigit antibodies - Google Patents
Anti-tigit antibodies Download PDFInfo
- Publication number
- WO2018160704A1 WO2018160704A1 PCT/US2018/020239 US2018020239W WO2018160704A1 WO 2018160704 A1 WO2018160704 A1 WO 2018160704A1 US 2018020239 W US2018020239 W US 2018020239W WO 2018160704 A1 WO2018160704 A1 WO 2018160704A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- antibody
- amino acid
- acid sequence
- tigit
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70521—CD28, CD152
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2818—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
- A61K2039/507—Comprising a combination of two or more separate antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/515—Complete light chain, i.e. VL + CL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- TIGIT T-cell immunoreceptor with Ig and ITIM domains
- TIGIT is an immune receptor that is expressed on subsets of T cells, such as activated, memory, and regulatory T cells and natural killer (NK) cells.
- TIGIT is a member of the CD28 family within the Ig superfamily of proteins, and serves as a co-inhibitory molecule that limits T cell proliferation and activation and NK cell function.
- TIGIT mediates its immunosuppressive effect by competing with CD226 (also known as DNAX Accessory Molecule-1, or "DNAM-1") for the same set of ligands: CD155 (also known as poliovirus receptor or "PVR”) and CD112 (also known as poliovirus receptor-related 2 or "PVRL2").
- CD226 also known as DNAX Accessory Molecule-1, or "DNAM-1
- CD155 also known as poliovirus receptor or "PVR”
- CD112 also known as poliovirus receptor-related 2 or "PVRL2”
- TIGIT expression is upregulated on tumor antigen (TA)- specific CD8 + T cells and CD8 + tumor-infiltrating lymphocytes (TILs).
- TIGIT ligand (CD155)-expressing cells increased the proliferation, cytokine production, and degranulation of both TA-specific CD8 + T cells and CD8 + TILs See, Chauvin et al., J Clin Invest., 2015, 125:2046-2058.
- TIGIT represents a potential therapeutic target for stimulating anti-tumor T cell responses in patients, although there remains a need for improved methods of blocking TIGIT and promoting anti-tumor responses.
- isolated antibodies or antigen-binding portions thereof that bind to human TIGIT are provided.
- the antibody or antigen-binding portion thereof has a binding affinity (KD) for human TIGIT of less than 5 nM.
- the antibody or antigen-binding portion thereof has a KD for human TIGIT of less than 1 nM.
- the antibody or antigen-binding portion thereof has a KD for human TIGIT of less than 100 pM.
- the antibody or antigen-binding portion thereof exhibits cross-reactivity with cynomolgus monkey TIGIT and/or mouse TIGIT.
- the antibody or antigen-binding portion thereof exhibits cross-reactivity with both cynomolgus monkey TIGIT and mouse TIGIT.
- the antibody or antigen-binding portion thereof blocks binding of CD 155 to TIGIT. In some embodiments, the antibody or antigen-binding portion thereof blocks binding of CD1 12 to TIGIT. In some embodiments, the antibody or antigen- binding portion thereof blocks binding of both CD155 and CD1 12 to TIGIT.
- the antibody or antigen-binding portion thereof binds to an epitope on human TIGIT that comprises amino acid positions 81 and 82.
- the epitope comprises Phe at position 81 and/or Lys or Ser at position 82.
- the epitope comprises Phe81 and Lys82.
- the epitope is a discontinuous epitope.
- the antibody or antigen-binding portion thereof binds to an epitope on human TIGIT that further comprises one or more of amino acid positions 51, 52, 53, 54, 55, 73, 74, 75, 76, 77, 79, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, or 93.
- the epitope further comprises one or more amino acid residues selected from the group consisting of Thr51, Ala52, Gln53, Val54, Thr55, Leu73, Gly74, Trp75, His76, Ile77, Pro79, Asp83, Arg84, Val85, Ala86, Pro87, Gly88, Pro89, Gly90, Leu91, Gly92, and Leu93.
- the epitope comprises the amino acid residues Thr51, Ala52, Gln53, Val54, Thr55, Gly74, Trp75, His76, Ile77, Phe81, Lys82, Pro87, Gly88, Pro89, Gly90, Leu91, Gly92, and Leu93.
- the epitope comprises the amino acid residues Ala52, Gln53, Leu73, Gly74, Trp75, Pro79, Phe81, Lys82, Asp83, Arg84, Val85, and Ala86.
- the epitope comprises the sequence ICNADLGWHISPSFK (SEQ ID NO:258).
- the antibody or antigen-binding portion thereof comprises one or more sequences listed in Table 3 below. In some embodiments, the antibody or antigen-binding portion thereof comprises one or more of:
- a heavy chain CDR1 comprising the sequence of any of SEQ ID NO:4, SEQ ID NO:22, SEQ ID NO:40, SEQ ID NO:58, SEQ ID NO:76, SEQ ID NO:94, SEQ ID NO: 112, SEQ ID NO: 130, SEQ ID NO: 148, SEQ ID NO: 166, SEQ ID NO: 184, SEQ ID NO:202, SEQ ID NO:221, SEQ ID NO:224, SEQ ID NO:226, SEQ ID NO:231, SEQ ID NO:233, SEQ ID NO:239, or SEQ ID NO:243;
- a heavy chain CDR2 comprising the sequence of any of SEQ ID NO: 6, SEQ ID NO:24, SEQ ID NO:42, SEQ ID NO:60, SEQ ID NO:78, SEQ ID NO:96, SEQ ID NO: 114, SEQ ID NO: 132, SEQ ID NO: 150, SEQ ID NO: 168, SEQ ID NO: 186, SEQ ID NO:204, SEQ ID NO:222, SEQ ID NO:225, SEQ ID NO:227, SEQ ID NO:229, SEQ ID NO:232, SEQ ID NO:234, SEQ ID NO:238, or SEQ ID NO:240;
- a heavy chain CDR3 comprising the sequence of any of SEQ ID NO:8, SEQ ID NO:26, SEQ ID NO:44, SEQ ID NO:62, SEQ ID NO:80, SEQ ID NO:98, SEQ ID NO: 116, SEQ ID NO: 134, SEQ ID NO: 152, SEQ ID NO: 170, SEQ ID NO: 188, SEQ ID NO:206, SEQ ID NO:223, SEQ ID NO:228, SEQ ID NO:230, SEQ ID NO:235, SEQ ID NO:236, SEQ ID NO:237, SEQ ID NO:241, SEQ ID NO:242, or SEQ ID NO:244;
- a light chain CDR1 comprising the sequence of any of SEQ ID NO: 13, SEQ ID NO:31, SEQ ID NO:49, SEQ ID NO:67, SEQ ID NO:85, SEQ ID NO: 103, SEQ ID NO: 121, SEQ ID NO: 139, SEQ ID NO: 157, SEQ ID NO: 175, SEQ ID NO: 193, or SEQ ID NO:211;
- SEQ ID NO:33 SEQ ID NO:51, SEQ ID NO:69, SEQ ID NO:87, SEQ ID NO: 105, SEQ ID NO: 123, SEQ ID NO: 141, SEQ ID NO: 159, SEQ ID NO: 177, SEQ ID NO: 195, or SEQ ID NO:213; or
- the antibody or antigen-binding portion thereof comprises a heavy chain CDR1, CDR2, and CDR3 and a light chain CDR1, CDR2, and CDR3 comprising the sequences of:
- the antibody or antigen-binding portion thereof comprises: (a) a heavy chain variable region comprising an amino acid sequence that has at least 90% sequence identity to SEQ ID NO: 1, SEQ ID NO: 19, SEQ ID NO:37, SEQ ID NO:55, SEQ ID NO:73, SEQ ID NO:91, SEQ ID NO: 109, SEQ ID NO: 127, SEQ ID NO: 145, SEQ ID NO: 163, SEQ ID NO: 181, SEQ ID NO: 199, SEQ ID NO:245, SEQ ID NO:246, SEQ ID NO:247, SEQ ID NO:248, SEQ ID NO:249, SEQ ID NO:250, SEQ ID NO:251, SEQ ID NO:252, SEQ ID NO:253, SEQ ID NO:254, SEQ ID NO:255, SEQ ID NO:256, or SEQ ID NO:257; and/or
- a light chain variable region comprising an amino acid sequence that has at least 90% sequence identity to SEQ ID NO: 10, SEQ ID NO:28, SEQ ID NO:46, SEQ ID NO:64, SEQ ID NO:82, SEQ ID NO: 100, SEQ ID NO: 118, SEQ ID NO: 136, SEQ ID NO: 154, SEQ ID NO: 172, SEQ ID NO: 190, or SEQ ID NO:208.
- the antibody or antigen-binding portion thereof comprises: (a) a heavy chain variable region comprising an amino acid sequence that has at least 90% sequence identity to SEQ ID NO: 1 or SEQ ID NO:245 and a light chain variable region comprising an amino acid sequence that has at least 90% sequence identity to SEQ ID NO: 10; or
- a heavy chain variable region comprising an amino acid sequence that has at least 90% sequence identity to any one of SEQ ID NO:55, SEQ ID NO:246, SEQ ID NO:247, SEQ ID NO:248, or SEQ ID NO:249 and a light chain variable region comprising an amino acid sequence that has at least 90% sequence identity to SEQ ID NO: 64; or
- a heavy chain variable region comprising an amino acid sequence that has at least 90% sequence identity to any one of SEQ ID NO:91, SEQ ID NO:250, SEQ ID NO:251, or SEQ ID NO:252 and a light chain variable region comprising an amino acid sequence that has at least 90% sequence identity to SEQ ID NO: 100; or (g) a heavy chain variable region comprising an amino acid sequence that has at least 90% sequence identity to SEQ ID NO: 109 and a light chain variable region comprising an amino acid sequence that has at least 90% sequence identity to SEQ ID NO: 118; or
- a heavy chain variable region comprising an amino acid sequence that has at least 90% sequence identity to any one of SEQ ID NO: 163, SEQ ID NO:253, SEQ ID NO:254, SEQ ID NO:255, SEQ ID NO:256, or SEQ ID NO:257 and a light chain variable region comprising an amino acid sequence that has at least 90% sequence identity to SEQ ID NO: 172; or
- a heavy chain variable region comprising an amino acid sequence that has at least 90% sequence identity to SEQ ID NO: 199 and a light chain variable region comprising an amino acid sequence that has at least 90% sequence identity to SEQ ID NO:208.
- antibodies or antigen-binding portions thereof that bind to human TIGIT are provided, wherein the antibody or antigen-binding portion thereof binds to an epitope on human TIGIT that comprises amino acid positions 81 and 82.
- the epitope comprises Phe at position 81 and/or Lys or Ser at position 82.
- the epitope comprises Phe81 and Lys82.
- the epitope is a discontinuous epitope.
- the antibody or antigen-binding portion thereof binds to an epitope on human TIGIT that further comprises one or more of amino acid positions 51, 52, 53, 54, 55, 73, 74, 75, 76, 77, 79, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, or 93.
- the epitope further comprises one or more amino acid residues selected from the group consisting of Thr51, Ala52, Gln53, Val54, Thr55, Leu73, Gly74, Trp75, His76, Ile77, Pro79, Asp83, Arg84, Val85, Ala86, Pro87, Gly88, Pro89, Gly90, Leu91, Gly92, and Leu93.
- the epitope comprises the amino acid residues Thr51, Ala52, Gln53, Val54, Thr55, Gly74, Trp75, His76, Ile77, Phe81, Lys82, Pro87, Gly88, Pro89, Gly90, Leu91, Gly92, and Leu93.
- the epitope comprises the amino acid residues Ala52, Gln53, Leu73, Gly74, Trp75, Pro79, Phe81, Lys82, Asp83, Arg84, Val85, and Ala86.
- the epitope comprises the sequence
- ICNADLGWHISPSFK (SEQ ID NO:258).
- antibodies or antigen-binding portions thereof comprising one or more sequences as disclosed herein (e.g., one or more sequences listed in Table 3 below) are provided.
- the antibody or antigen-binding portion thereof comprises one more more CDR, heavy chain variable region, light chain variable region, or framework region sequences as disclosed herein (e.g., as listed in Table 3 below).
- the antibody or antigen-binding portion thereof comprises one or more of:
- a heavy chain CDR1 comprising the sequence of any of SEQ ID NO:4, SEQ ID NO:22, SEQ ID NO:40, SEQ ID NO:58, SEQ ID NO:76, SEQ ID NO:94, SEQ ID NO:
- SEQ ID NO: 112 SEQ ID NO: 130, SEQ ID NO: 148, SEQ ID NO: 166, SEQ ID NO: 184, SEQ ID NO:202, SEQ ID NO:221, SEQ ID NO:224, SEQ ID NO:226, SEQ ID NO:231, SEQ ID NO:233, SEQ ID NO:239, or SEQ ID NO:243;
- a heavy chain CDR2 comprising the sequence of any of SEQ ID NO: 6, SEQ ID NO:24, SEQ ID NO:42, SEQ ID NO:60, SEQ ID NO:78, SEQ ID NO:96, SEQ ID NO:
- SEQ ID NO: 114 SEQ ID NO: 132, SEQ ID NO: 150, SEQ ID NO: 168, SEQ ID NO: 186, SEQ ID NO:204, SEQ ID NO:222, SEQ ID NO:225, SEQ ID NO:227, SEQ ID NO:229, SEQ ID NO:232, SEQ ID NO:234, SEQ ID NO:238, or SEQ ID NO:240;
- a heavy chain CDR3 comprising the sequence of any of SEQ ID NO:8, SEQ ID NO:26, SEQ ID NO:44, SEQ ID NO:62, SEQ ID NO:80, SEQ ID NO:98, SEQ ID NO:
- a light chain CDR1 comprising the sequence of any of SEQ ID NO: 13, SEQIDNO:31, SEQIDNO:49, SEQIDNO:67, SEQIDNO:85, SEQ ID NO: 103, SEQ ID NO: 121, SEQ ID NO: 139, SEQ ID NO: 157, SEQ ID NO: 175, SEQ ID NO: 193, or SEQ ID NO:211;
- a light chain CDR3 comprising the sequence of any of SEQ ID NO: 17, SEQIDNO:35, SEQIDNO:53, SEQIDNO:71, SEQIDNO:89, SEQ ID NO: 107, SEQ ID NO: 125, SEQ ID NO: 143, SEQ ID NO: 161, SEQ ID NO: 179, SEQ ID NO: 197, or SEQ ID NO:215.
- the antibody or antigen-binding portion thereof comprises a heavy chain CDR1, CDR2, and CDR3 and a light chain CDR1, CDR2, and CDR3 comprising the sequences of:
- the antibody or antigen-binding portion thereof comprises:
- the antibody or antigen-binding portion thereof comprises:
- a heavy chain variable region comprising an amino acid sequence that has at least 90% sequence identity to SEQ ID NO:37 and a light chain variable region comprising an amino acid sequence that has at least 90% sequence identity to SEQ ID NO:46; or (d) a heavy chain variable region comprising an amino acid sequence that has at least 90% sequence identity to any one of SEQ ID NO:55, SEQ ID NO:246, SEQ ID NO:247, SEQ ID NO:248, or SEQ ID NO:249 and a light chain variable region comprising an amino acid sequence that has at least 90% sequence identity to SEQ ID NO: 64; or
- SEQ ID NO:251 or SEQ ID NO:252 and a light chain variable region comprising an amino acid sequence that has at least 90% sequence identity to SEQ ID NO: 100; or
- a heavy chain variable region comprising an amino acid sequence that has at least 90% sequence identity to any one of SEQ ID NO: 163, SEQ ID NO:253, SEQ ID NO:254, SEQ ID NO:255, SEQ ID NO:256, or SEQ ID NO:257 and a light chain variable region comprising an amino acid sequence that has at least 90% sequence identity to SEQ ID NO: 172; or
- an antibody or antigen-binding portion thereof as disclosed herein exhibits synergy with an anti-PDl antibody or an anti-PD-Ll antibody.
- an antibody or antigen-binding portion thereof as disclosed herein is a monoclonal antibody.
- the antibody is a humanized antibody.
- the antibody is a fully human antibody.
- the antibody is a chimeric antibody.
- the antigen-binding fragment is a Fab, a F(ab') 2 , a scFv, or a bivalent scFv.
- compositions comprising an isolated antibody or antigen-binding portion thereof as described herein and a pharmaceutically acceptable carrier are provided.
- bispecific antibodies comprising an isolated antibody or antigen-binding portion thereof as described herein are provided.
- antibody-drug conjugates comprising an isolated antibody or antigen-binding portion thereof as described herein are provided.
- isolated polynucleotides are provided.
- the polynucleotide comprises one or more nucleotide sequences encoding an antibody or antigen-binding portion thereof as described herein.
- the polynucleotide comprises one or more nucleotide sequences encoding an antibody or antigen-binding portion thereof as described herein.
- polynucleotide comprises one or more nucleotide sequences encoding a polypeptide disclosed in Table 3 below.
- the polynucleotide comprises one or more nucleotide sequences encoding an antibody, or an antigen-binding portion thereof, that binds to human TIGIT, wherein the isolated polynucleotide comprises:
- vectors and host cells comprising a polynucleotide as described herein are provided.
- methods of producing an antibody comprising culturing a host cell as described herein under conditions suitable for producing the antibody are provided.
- kits e.g., for use in a therapeutic method as described herein are provided.
- the kit comprises an isolated anti-TIGIT antibody or antigen-binding portion thereof as described herein, or a pharmaceutical composition comprising an anti-TIGIT antibody or antigen-binding portion thereof as described herein; and further comprises an immuno-oncology agent.
- the immuno- oncology agent is a PD-1 pathway inhibitor.
- the PD-1 pathway inhibitor is an anti-PDl antibody or an anti-PD-Ll antibody.
- the PD-1 pathway inhibitor is an antagonist or inhibitor of a T cell coinhibitor.
- the immuno-oncology agent is an agonist of a T cell coactivator.
- the immuno-oncology agent is an immune stimulatory cytokine.
- methods of treating a cancer in a subject comprises administering to the subject a therapeutic amount of an isolated antibody or antigen-binding portion thereof as described herein, or a pharmaceutical composition as described herein, a bispecific antibody as described herein, or an antibody- drug conjugate as described herein.
- the cancer is a cancer that is enriched for expression of
- the cancer is a cancer that is enriched for T cells or natural killer (NK) cells that express TIGIT.
- the cancer is bladder cancer, breast cancer, uterine cancer, cervical cancer, ovarian cancer, prostate cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, pancreatic cancer, colorectal cancer, colon cancer, kidney cancer, head and neck cancer, lung cancer, stomach cancer, germ cell cancer, bone cancer, liver cancer, thyroid cancer, skin cancer, neoplasm of the central nervous system, lymphoma, leukemia, myeloma, or sarcoma.
- the cancer is a lymphoma or a leukemia.
- the method further comprises administering to the subject a therapeutic amount of an immuno-oncology agent.
- the immuno- oncology agent is a PD-1 pathway inhibitor.
- the PD-1 pathway inhibitor is an anti-PDl antibody or an anti-PD-Ll antibody.
- the PD-1 pathway inhibitor is an antagonist or inhibitor of a T cell coinhibitor.
- the immuno-oncology agent is an agonist of a T cell coactivator.
- the immuno-oncology agent is an immune stimulatory cytokine.
- the isolated antibody, the pharmaceutical composition, the bispecific antibody, or the antibody- drug conjugate is administered concurrently with the immuno-oncology agent.
- the isolated antibody, the pharmaceutical composition, the bispecific antibody, or the antibody-drug conjugate is administered sequentially to the immuno-oncology agent.
- FIG. 1 Binding of 65 anti-TIGIT antibody clones and an irrelevant isotype control antibody to HEK 293 cells engineered to express human TIGIT (top panel), cynomolgus monkey TIGIT (middle panel), and mouse TIGIT (bottom panel).
- FIG. 2 Binding of 65 anti-TIGIT antibody clones and an irrelevant isotype control antibody to primary human T cells (top panel), cynomolgus monkey T cells (middle panel), and mouse T cells (bottom panel). For the bottom panel, 35 of 65 clones were evaluated. Of the 35 clones evaluated, 5 of the 35 did not bind mTIGIT-Fc protein (clones 20, 27, 55, 56, and 60), as indicated by the light green bars.
- FIG. 3A-3D Binding titration values of eight anti-TIGIT antibody clones (clones 2, 5, 13, 16, 17, 20, 25, and 54) to human (A), mouse (B), and cynomolgus monkey (C) TIGIT expressed on HEK 293 cells. Results are shown for singlicate wells.
- D EC50 values of eight anti-TIGIT antibody clones (clones 2, 5, 13, 16, 17, 20, 25, and 54) to human, mouse, and cynomolgus monkey TIGIT expressed on HEK 293 cells.
- FIG. 4 Binding titration of anti-TIGIT antibody clones 13 and 25 to activated mouse splenic T cells. Results are shown for singlicate wells. Clone 13 had an EC50 of 0.24 ⁇ g/mL. Clone 25 had an EC50 of 2.28 ⁇ g/mL.
- FIG. 5A-5B Anti-TIGIT antibodies blocked CD 155 interaction with TIGIT expressed on HEK 293 cells, for both human CD155 binding to HEK 293 cells expressing human TIGIT (A) and mouse CD155 binding to HEK 293 cells expressing mouse TIGIT (B). Results are shown for singlicate wells.
- FIG. 6. Anti-TIGIT antibodies blocked human CD112 interaction with human TIGIT expressed on HEK 293 cells. Results are shown for singlicate wells.
- FIG. 7A-7B (A) Upper panel: Select anti-TIGIT antibodies effectively blocked TIGIT-CD155 engagement, resulting in T cell activation, as measured by a > 1.5-fold induction in luciferase activity.
- FIG. 8 Select anti-TIGIT antibodies synergized with anti-PD-1, resulting in T cell activation. Mean and SD are of triplicate wells. Both clone 13 and clone 25 showed synergy with anti-PD-1 in combination bioassay. [0040] FIG. 9A-9H.
- A-D Binding titration (A-C) and EC50 values (D) for binding to human (A), mouse (B), and cynomolgus monkey (C) TIGIT expressed on HEK 293 cells for fully human anti-TIGIT clone 13 ("cl3 hlgGl") and mouse IgGl (“cl3 mlgGl”) and mouse IgG2a (“cl3 mIgG2a”) chimeras of clone 13. Mean and SD are of duplicate wells.
- E-F Antibodies cl3 hlgGl, cl3 mlgGl, and cl3 mIgG2a blocked CD 155 interaction with TIGIT expressed on HEK 293 cells, for both human CD155 binding to HEK 293 cells expressing human TIGIT (E) and mouse CD155 binding to HEK 293 cells expressing mouse TIGIT (F). Results are for singlicate wells.
- G Antibodies cl3 hlgGl, cl3 mlgGl, and cl3 mIgG2a blocked human CD112 interaction with human TIGIT expressed on HEK 293 cells. Results are for singlicate wells.
- FIG. 10A-10K Anti-TIGIT antibodies that can engage activating Fcgamma receptors mediated anti-tumor efficacy in a CT26 syngeneic tumor model in mice.
- A Group mean tumor volume.
- B-K Individual animal tumor volume for groups 1 through 10.
- PR Partial Response (tumor volume is 50% or less of its day 1 volume for three consecutive measurements and equal to or greater than 13.5 mm 3 for one or more of these three measurements).
- CR Complete Response (tumor volume is less than 13.5 mm for three consecutive measurements).
- TIGIT T-cell immunoreceptor with Ig and ITIM domains
- TIGIT mouse TIGIT and cynomolgus monkey TIGIT
- these antibodies also exhibit synergy with anti-PD-1 antibodies.
- the anti-TIGIT antibodies described herein may be used in a number of therapeutic applications, such as for the treatment of various cancers, either as a single agent or in combination with another therapeutic agent such as anti-PD-1 agents or anti-PD-Ll agents.
- compositions, kits, and methods of treatment comprising an antibody or antigen-binding portion of an antibody, that binds to human TIGIT.
- TIGIT refers to "T-cell immunoreceptor with Ig and ITIM domains.”
- the protein encoded by the TIGIT gene is a member of the CD28 family within the Ig superfamily of proteins. TIGIT is expressed on several classes of T cells and on natural killer (NK) cells and mediates its immunosuppressive effect by competing with CD226 for the ligands CD 155 and CD 112. See, Levin et al., Eur. J. Immunol, 2011, 41 :902- 915.
- TIGIT is also referred to in the art as WUCAM (Washington University Cell Adhesion Molecule) and VSTM3 (HUGO designation). See, Levin et al., Eur J Immunol, 2011, 41 :902- 915. Accordingly, reference to "TIGIT” throughout this application also includes a reference to WUCAM and/or VSTM3 unless otherwise stated or apparent from context.
- Human TIGIT nucleotide and protein sequences are set forth in, e.g., Genbank Accession Nos. M 173799 (SEQ ID NO:217) and P776160 (SEQ ID NO:218), respectively.
- cancer refers to a disease characterized by the uncontrolled growth of aberrant cells.
- the term includes all known cancers and neoplastic conditions, whether characterized as malignant, benign, soft tissue, or solid, and cancers of all stages and grades including pre- and post-metastatic cancers.
- Examples of different types of cancer include, but are not limited to, digestive and gastrointestinal cancers such as gastric cancer ⁇ e.g., stomach cancer), colorectal cancer, gastrointestinal stromal tumors, gastrointestinal carcinoid tumors, colon cancer, rectal cancer, anal cancer, bile duct cancer, small intestine cancer, and esophageal cancer; breast cancer; lung cancer; gallbladder cancer; liver cancer; pancreatic cancer; appendix cancer; prostate cancer, ovarian cancer; renal cancer; cancer of the central nervous system; skin cancer ⁇ e.g., melanoma); lymphomas; gliomas; choriocarcinomas; head and neck cancers; osteogenic sarcomas; and blood cancers.
- a "tumor" comprises one or more cancerous cells.
- antibody refers to a polypeptide encoded by an immunoglobulin gene or functional fragments thereof that specifically binds and recognizes an antigen (e.g., human TIGIT), a particular cell surface marker, or any desired target.
- an antigen e.g., human TIGIT
- the "variable region” contains the antigen-binding region of the antibody (or its functional equivalent) and is most critical in specificity and affinity of binding. See, Fundamental Immunology 7 th Edition, Paul, ed., Wolters Kluwer Health/Lippincott Williams & Wilkins (2013).
- the recognized immunoglobulin genes include the kappa, lambda, alpha, gamma, delta, epsilon, and mu constant region genes, as well as myriad immunoglobulin variable region genes.
- Light chains are classified as either kappa or lambda.
- Heavy chains are classified as gamma, mu, alpha, delta, or epsilon, which in turn define the immunoglobulin classes, IgG, IgM, IgA, IgD and IgE, respectively.
- An exemplary immunoglobulin (antibody) structural unit comprises a tetramer.
- Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one "light” (about 25 kD) and one "heavy” chain (about 50-70 kD).
- the N-terminus of each chain defines a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition.
- the terms variable light chain (VL) and variable heavy chain (VH) refer to these light and heavy chains respectively.
- An "isotype" is a class of antibodies defined by the heavy chain constant region.
- Immunoglobulin genes include the kappa, lambda, alpha, gamma, delta, epsilon, and mu constant region genes.
- Light chains are classified as either kappa or lambda.
- Heavy chains are classified as gamma, mu, alpha, delta, or epsilon, which in turn define the isotype classes, IgG, IgM, IgA, IgD and IgE, respectively.
- CDR complementarity-determining region
- the sequences of the framework regions of different light or heavy chains are relatively conserved within a species.
- the framework region of an antibody that is the combined framework regions of the constituent light and heavy chains, serves to position and align the CDRs in three dimensional space.
- amino acid sequences of the CDRs and framework regions can be determined using various well known definitions in the art, e.g., Kabat, Chothia, international
- ImMunoGeneTics database IMGT
- AbM ImMunoGeneTics database
- CDRs are determined according to Kabat.
- antigen combining sites are also described in the following: Ruiz et al. Nucleic Acids Res., 28, 219-221 (2000); and Lefranc Nucleic Acids Res. Jan l;29(l):207-9 (2001); MacCallum et al, J. Mol. Biol, 262: 732-745 (1996); and Martin et al, Proc. Natl Acad. Sci. USA, 86, 9268-9272 (1989); Martin, et al, Methods Enzymol, 203 : 121-153, (1991); Pedersen et al, Immunomethods, 1, 126, (1992); and Rees et al, In Sternberg M.J.E. (ed.), Protein Structure Prediction. Oxford University Press, Oxford, 141-172 1996).
- antigen-binding portion or “antigen-binding fragment” are used interchangeably herein and refer to one or more fragments of an antibody that retain the ability to specifically bind to an antigen (e.g., TIGIT). It has been shown that the antigen- binding function of an antibody can be performed by fragments of a full-length antibody.
- an antigen e.g., TIGIT
- antigen binding fragments include, but are not limited to, a Fab fragment (a monovalent fragment consisting of the VL, VH, CL and CHI domains), a F(ab') 2 fragment (a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region), single chain Fv (scFv), complementarity determining regions (CDRs), VL (light chain variable region), VH (heavy chain variable region), disulfide-linked Fvs (dsFv), and any combination of those or any other functional portion of an immunoglobulin peptide capable of binding to target antigen (see, e.g., Fundamental Immunology, supra).
- a Fab fragment a monovalent fragment consisting of the VL, VH, CL and CHI domains
- F(ab') 2 fragment a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region
- single chain Fv scFv
- CDRs complementarity determining
- antibody fragments can be obtained by a variety of methods, for example, digestion of an intact antibody with an enzyme, such as pepsin; or de novo synthesis.
- Antibody fragments are often synthesized de novo either chemically or by using recombinant DNA methodology.
- the term antibody includes antibody fragments either produced by the modification of whole antibodies, or those synthesized de novo using recombinant DNA methodologies (e.g., single chain Fv) or those identified using phage display libraries and yeast-based antibody library presentation systems (see, e.g., McCafferty et al, (1990) Nature 348:552; Y.
- antibody also includes bivalent or bispecific molecules, diabodies, triabodies, and tetrabodies. Bivalent and bispecific molecules are described in, e.g., Kostelny et al. (1992) J. Immunol. 148: 1547, Pack and Pluckthun (1992) Biochemistry 31 : 1579, Hollinger et al. (1993), PNAS. USA 90:6444, Gruber et al. (1994) J Immunol. 152:5368, Zhu et al. (1997) Protein Sci.
- a "monoclonal antibody” refers to a clonal preparation of antibodies with a single binding specificity and affinity for a given epitope on an antigen.
- a “polyclonal antibody” refers to a preparation of antibodies that are raised against a single antigen, but with different binding specificities and affinities.
- a "humanized” antibody is an antibody that retains the reactivity of a non-human antibody while being less immunogenic in humans. This can be achieved, for instance, by retaining the non-human CDR regions and replacing the remaining parts of the antibody with their human counterparts. See, e.g., Morrison et al, PNAS USA, 81 :6851-6855 (1984);
- chimeric antibody refers to an antibody molecule in which (a) the constant region, or a portion thereof, is altered, replaced or exchanged so that the antigen binding site (variable region, CDR, or portion thereof) is linked to a constant region of a different or altered class, effector function and/or species, or an entirely different molecule which confers new properties to the chimeric antibody ⁇ e.g., an enzyme, toxin, hormone, growth factor, drug, etc.); or (b) the variable region, or a portion thereof, is altered, replaced or exchanged with a variable region having a different or altered antigen specificity ⁇ e.g., CDR and framework regions from different species).
- epitope refers to the area or region of an antigen to which an antibody specifically binds, i.e., an area or region in physical contact with the antibody, and can include a few amino acids or portions of a few amino acids, e.g., 5 or 6, or more, e.g., 20 or more amino acids, or portions of those amino acids.
- the epitope includes nonprotein components, e.g., from a carbohydrate, nucleic acid, or lipid. In some cases, the epitope is a three-dimensional moiety.
- the epitope can be comprised of consecutive amino acids, or amino acids from different parts of the protein that are brought into proximity by protein folding ⁇ e.g., a discontinuous epitope).
- protein folding e.g., a discontinuous epitope
- an antibody or antigen-binding portion thereof that specifically binds a target is an antibody or antigen-binding portion that binds to the target with at least 2-fold greater affinity than non-target compounds, e.g., at least 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 20-fold, 25-fold, 50-fold, or 100-fold greater affinity.
- an antibody that specifically binds TIGIT will typically bind to TIGIT with at least a 2-fold greater affinity than to a non-TIGIT target. It will be understood by a person of ordinary skill in the art reading this definition, for example, that an antibody (or moiety or epitope) that specifically or preferentially binds to a first target may or may not specifically or preferentially bind to a second target.
- binding affinity is herein used as a measure of the strength of a non- covalent interaction between two molecules, e.g., an antibody, or fragment thereof, and an antigen.
- binding affinity is used to describe monovalent interactions (intrinsic activity).
- Binding affinity between two molecules, e.g. an antibody, or fragment thereof, and an antigen, through a monovalent interaction may be quantified by determination of the dissociation constant (KD).
- KD can be determined by measurement of the kinetics of complex formation and dissociation using, e.g., the surface plasmon resonance (SPR) method (BiacoreTM).
- SPR surface plasmon resonance
- the rate constants corresponding to the association and the dissociation of a monovalent complex are referred to as the association rate constants k a (or k on ) and dissociation rate constant kd (or k 0 ff), respectively.
- the value of the dissociation constant can be determined directly by well-known methods, and can be computed even for complex mixtures by methods such as those, for example, set forth in Caceci et al. (1984, Byte 9: 340-362).
- the KD may be established using a double-filter nitrocellulose filter binding assay such as that disclosed by Wong & Lohman (1993, Proc. Natl. Acad. Sci. USA 90: 5428-5432).
- Other standard assays to evaluate the binding ability of ligands such as antibodies towards target antigens are known in the art, including for example, ELISAs, Western blots, RIAs, and flow cytometry analysis, and other assays exemplified elsewhere herein.
- binding kinetics and binding affinity of the antibody also can be assessed by standard assays known in the art or as described in the Examples section below, such as Surface Plasmon Resonance (SPR), e.g. by using a BiacoreTM system; kinetic exclusion assays such as KinExA®; and BioLayer interferometry (e.g., using the ForteBio® Octet platform).
- SPR Surface Plasmon Resonance
- BiacoreTM system kinetic exclusion assays
- KinExA® kinetic exclusion assays
- BioLayer interferometry e.g., using the ForteBio® Octet platform.
- binding affinity is determined using a BioLayer interferometry assay. See, e.g., Wilson et al., Biochemistry and Molecular Biology Education, 38:400-407 (2010); Dysinger et al, J.
- cross-reacts refers to the ability of an antibody to bind to an antigen other than the antigen against which the antibody was raised.
- cross-reactivity refers to the ability of an antibody to bind to an antigen from another species than the antigen against which the antibody was raised.
- an anti-TIGIT antibody as described herein that is raised against a human TIGIT antigen can exhibit cross-reactivity with TIGIT from a different species (e.g., mouse or monkey).
- polypeptide polypeptide
- peptide and “protein” are used interchangeably herein to refer to a polymer of amino acid residues.
- amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymers.
- amino acid chains of any length, including full length proteins, wherein the amino acid residues are linked by covalent peptide bonds.
- amino acid refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids.
- Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, ⁇ - carboxyglutamate, and O-phosphoserine.
- Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, i.e., an a carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs have modified R groups ⁇ e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid.
- Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions in a manner similar to a naturally occurring amino acid.
- Amino acids may be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical
- nucleic acid and “polynucleotide” interchangeably refer to chains of nucleotides of any length, and include DNA and RNA.
- the nucleotides can be deoxyribonucleotides, ribonucleotides, modified nucleotides or bases, and/or their analogs, or any substrate that can be incorporated into a chain by DNA or RNA polymerase.
- a polynucleotide may comprise modified nucleotides, such as methylated nucleotides and their analogs. Examples of polynucleotides contemplated herein include single and double stranded DNA, single and double stranded RNA, and hybrid molecules having mixtures of single and double stranded DNA and RNA.
- nucleic acid or protein denotes that the nucleic acid or protein is essentially free of other cellular components with which it is associated in the natural state. It is preferably in a homogeneous state. It can be in either a dry or aqueous solution. Purity and homogeneity are typically determined using analytical chemistry techniques such as polyacrylamide gel electrophoresis or high performance liquid chromatography. A protein that is the predominant species present in a preparation is substantially purified. In particular, an isolated gene is separated from open reading frames that flank the gene and encode proteins other than the protein encoded by the gene of interest.
- nucleic acid or protein gives rise to essentially one band in an electrophoretic gel. Particularly, it means that the nucleic acid or protein is at least 85% pure, more preferably at least 95% pure, and most preferably at least 99% pure.
- an immuno-oncology agent refers to an agent that enhances, stimulates, or upregulates an immune response against a cancer in a subject (e.g., in stimulating an immune response for inhibiting tumor growth).
- an immuno-oncology agent is a small molecule, antibody, peptide, protein, circular peptide, peptidomimetic, polynucleotide, inhibitory RNA, aptamer, drug compound, or other compound.
- an immuno-oncology agent is an antagonist or inhibitor of PD-1 or the PD-1 pathway.
- Subject refers to, except where indicated, mammals such as humans and non-human primates, as well as rabbits, rats, mice, goats, pigs, and other mammalian species.
- mammals such as humans and non-human primates, as well as rabbits, rats, mice, goats, pigs, and other mammalian species.
- the term does not necessarily indicate that the subject has been diagnosed with a particular disease, but typically refers to an individual under medical supervision.
- a patient can be an individual that is seeking treatment, monitoring, adjustment or modification of an existing therapeutic regimen, etc.
- the terms “therapy,” “treatment,” and “amelioration” refer to any reduction in the severity of symptoms.
- treatment can refer to reducing, e.g., tumor size, number of cancer cells, growth rate, metastatic activity, cell death of non-cancer cells, etc.
- the terms “treat” and “prevent” are not intended to be absolute terms.
- Treatment and prevention can refer to any delay in onset, amelioration of symptoms, improvement in patient survival, increase in survival time or rate, etc.
- Treatment and prevention can be complete (no detectable symptoms remaining) or partial, such that symptoms are less frequent or severe than in a patient without the treatment described herein.
- the effect of treatment can be compared to an individual or pool of individuals not receiving the treatment, or to the same patient prior to treatment or at a different time during treatment.
- the severity of disease is reduced by at least 10%, as compared, e.g., to the individual before administration or to a control individual not undergoing treatment. In some aspects, the severity of disease is reduced by at least 25%, 50%, 75%, 80%, or 90%, or in some cases, no longer detectable using standard diagnostic techniques.
- a "therapeutic amount” or “therapeutically effective amount” of an agent is an amount of the agent that prevents, alleviates, abates, or reduces the severity of symptoms of a disease (e.g., a cancer) in a subject.
- a therapeutically effective amount will show an increase or decrease of therapeutic effect of at least 5%, 10%, 15%, 20%, 25%, 40%, 50%, 60%, 75%, 80%, 90%, or at least 100%.
- Therapeutic efficacy can also be expressed as "- fold" increase or decrease.
- a therapeutically effective amount can have at least a 1.2-fold, 1.5-fold, 2-fold, 5-fold, or more effect over a control.
- administer refers to methods of delivering agents, compounds, or compositions to the desired site of biological action. These methods include, but are not limited to, topical delivery, parenteral delivery, intravenous delivery, intradermal delivery, intramuscular delivery, colonical delivery, rectal delivery, or intraperitoneal delivery. Administration techniques that are optionally employed with the agents and methods described herein, include e.g., as discussed in Goodman and Gilman, The Pharmacological Basis of Therapeutics, current ed.; Pergamon; and Remington's,
- antibodies and antigen-binding portions of antibodies that bind to human TIGIT are provided.
- the anti-TIGIT antibody inhibits interaction between TIGIT and one or both of the ligands CD155 and CD112.
- the anti-TIGIT antibody inhibits the interaction between TIGIT and CD 155 in a functional bioassay, allowing CD155-CD226 signaling to occur.
- the anti-TIGIT antibody exhibits synergy with an anti-PD-1 agent (e.g., an anti-PD-1 antibody) or an anti-PD-Ll agent (e.g., an anti-PD-Ll antibody). Characteristics of Anti-TIGIT Antibodies
- an anti-TIGIT antibody binds to human TIGIT protein (SEQ ID NO:218) or a portion thereof with high affinity.
- the antibody has a binding affinity (KD) for human TIGIT of less than 5 nM, less than 1 nM, less than 500 pM, less than 250 pM, less than 150 pM, less than 100 pM, less than 50 pM, less than 40 pM, less than 30 pM, less than 20 pM, or less than about 10 pM.
- the antibody has a binding affinity (KD) for human TIGIT of less than 50 pM.
- the antibody has a KD for human TIGIT in the range of about 1 pM to about 5 nM, e.g., about 1 pM to about 1 nM, about 1 pM to about 500 pM, about 5 pM to about 250 pM, or about 10 pM to about 100 pM.
- the anti-TIGIT antibody in addition to binding to human TIGIT with high affinity, exhibits cross-reactivity with cynomolgus monkey ("cyno") TIGIT (e.g., a cyno TIGIT protein having the sequence of SEQ ID NO:219) and/or mouse TIGIT (e.g., a mouse TIGIT protein having the sequence of SEQ ID NO:220).
- cyno cynomolgus monkey
- mouse TIGIT e.g., a mouse TIGIT protein having the sequence of SEQ ID NO:220
- the anti-TIGIT antibody binds to mouse TIGIT (e.g., a mouse TIGIT having the sequence of SEQ ID NO:220) with a binding affinity (KD) of 100 nM or less.
- KD binding affinity
- the anti-TIGIT antibody binds to human TIGIT with a KD of 5 nM or less, and cross-reacts with mouse TIGIT with a KD of 100 nM or less.
- an anti-TIGIT antibody that binds to a human TIGIT also exhibits cross-reactivity with both cynomolgus monkey TIGIT and mouse TIGIT.
- antibody cross-reactivity is determined by detecting specific binding of the anti-TIGIT antibody to TIGIT that is expressed on a cell (e.g., a cell line that expresses human TIGIT, cyno TIGIT, or mouse TIGIT, or a primary cell that endogenously expresses TIGIT, e.g., primary T cells that endogenously express human TIGIT, cyno TIGIT, or mouse TIGIT).
- a cell e.g., a cell line that expresses human TIGIT, cyno TIGIT, or mouse TIGIT
- a primary cell that endogenously expresses TIGIT e.g., primary T cells that endogenously express human TIGIT, cyno TIGIT, or mouse TIGIT.
- antibody binding and antibody cross-reactivity is determined by detecting specific binding of the anti-TIGIT antibody to purified or recombinant TIGIT (e.g., purified or recombinant human TIGIT, purified or recombinant cyno TIGIT, or purified or recombinant mouse TIGIT) or a chimeric protein comprising
- TIGIT e.g., an Fc-fusion protein comprising human TIGIT, cyno TIGIT, or mouse TIGIT, or a His-tagged protein comprising human TIGIT, cyno TIGIT, or mouse TIGIT.
- kinetic exclusion assays are used to determine affinity. This technique is described, e.g., in Darling et al., Assay and Drug Development Technologies Vol. 2, number 6 647-657 (2004).
- BioLayer interferometry assays are used to determine affinity. This technique is described, e.g., in Wilson et al., Biochemistry and Molecular Biology Education, 38:400-407 (2010); Dysinger et al., J. Immunol. Methods, 379:30-41 (2012).
- the anti-TIGIT antibodies and antigen-binding portions thereof of the instant disclosure inhibit interaction between TIGIT and the ligand CD155. In some embodiments, the anti-TIGIT antibodies and antigen-binding portions thereof inhibit interaction between TIGIT and the ligand CD112. In some embodiments, the anti-TIGIT antibodies and antigen-binding portions thereof inhibit interaction between TIGIT and both of the ligands CD155 and CD112. [0080] In some embodiments, the ability of an anti-TIGIT antibody to inhibit interactions between TIGIT and CD155 and/or CD112 is evaluated by measuring whether physical interactions between TIGIT and CD155 or CD112 decrease in a binding assay.
- the binding assay is a competitive binding assay.
- the assay may be performed in various formats, such as but not limited to an ELISA assay, flow cytometry, a surface plasmon resonance (SPR) assay (e.g., BiacoreTM), or BioLayer interferometry (e.g., ForteBio OctetTM). See, e.g., Duff et al., Biochem J, 2009, 419:577-584; Dysinger et al., J. Immunol. Methods, 379:30-41 (2012); and Estep et a ⁇ , Mabs, 2013, 5:270-278.
- SPR surface plasmon resonance
- the anti-TIGIT antibody inhibits the interaction between TIGIT and CD 155 in a functional bioassay, such as a functional cellular assay in which inhibition of TIGIT/CD155 interaction is evaluated by measuring activation of CD155- CD226 signaling in the cell (e.g., via activation of a downstream reporter).
- a functional bioassay such as a functional cellular assay in which inhibition of TIGIT/CD155 interaction is evaluated by measuring activation of CD155- CD226 signaling in the cell (e.g., via activation of a downstream reporter).
- a functional bioassay such as a functional cellular assay in which inhibition of TIGIT/CD155 interaction is evaluated by measuring activation of CD155- CD226 signaling in the cell (e.g., via activation of a downstream reporter).
- luciferase expression requires TCR engagement and a co- stimulatory signal from CD155-CD226.
- a first cell also referred to as a "T effector cell” expresses a TCR complex, TIGIT, and CD226 on the cell surface and contains a luciferase gene.
- a second cell also referred to as an “artificial antigen presenting cell” expresses a TCR activator and CD155. Co-culture of the cells in the absence of anti-TIGIT antibody results in a TIGIT-CD155 interaction that inhibits co-stimulation of the effector cell by CD155-CD226, preventing expression of luciferase by the effector cell.
- CD155 and CD226 are able to interact and produce a co-stimulatory signal that drives luciferase expression in the first cell.
- Such functional cellular assays are described in the art, e.g., Cong et al., Genetic Engineering and Biotechnology News, 2015, 35(10): 16-17, and are also commercially available (e.g., TIGIT/CD155 Blockade Bioassay Kit, Promega Corp.,
- an anti-TIGIT antibody that inhibits the interaction between TIGIT and CD155 increases the level or amount of activation of CD155-CD226 signaling (e.g., as measured in a cellular assay such as the TIGIT/CD155 Blockade Bioassay Kit) by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or more as compared to the level or amount of CD155- CD226 signaling in the absence of the anti-TIGIT antibody.
- a cellular assay such as the TIGIT/CD155 Blockade Bioassay Kit
- an anti- TIGIT antibody that inhibits the interaction between TIGIT and CD 155 increases the level or amount of activation of CD155-CD226 signaling (e.g., as measured in a cellular assay such as the TIGIT/CD155 Blockade Bioassay Kit) by at least about 1.2-fold, at least about 1.5- fold, at least about 2-fold, at least about 3-fold, at least about 4-fold, at least about 5-fold, at least about 6-fold, at least about 7-fold, at least about 8-fold, at least about 9-fold, at least about 10-fold or more as compared to the level or amount of CD155-CD226 signaling in the absence of the anti-TIGIT antibody.
- an anti-TIGIT antibody that binds to human TIGIT (and optionally exhibits cross-reactivity with cynomolgus monkey and/or mouse TIGIT and/or optionally inhibits interaction between TIGIT and CD155 and/or CD112) exhibits synergy with an anti-PD-1 agent (e.g., an anti-PD-1 antibody).
- an anti-PD-1 agent e.g., an anti-PD-1 antibody
- the anti-TIGIT antibody enhances the effect of the anti-PD-1 agent (e.g., anti-PD-1 antibody) by at least about 1.2-fold, at least about 1.5-fold, at least about 2-fold, at least about 3-fold, at least about 4-fold, at least about 5-fold, at least about 6-fold, at least about 7-fold, at least about 8-fold, at least about 9-fold, at least about 10-fold or more.
- the anti-PD-1 agent e.g., anti-PD-1 antibody
- the anti-TIGIT antibody exhibits synergy with an anti-PD-1 agent (e.g., an anti-PD-1 antibody) in a functional bioassay, such as a functional cellular assay in which inhibition of TIGIT signaling and inhibition of PD-1 signaling is evaluated by measuring the activation of signaling in an effector cell.
- a functional bioassay such as a functional cellular assay in which inhibition of TIGIT signaling and inhibition of PD-1 signaling is evaluated by measuring the activation of signaling in an effector cell.
- a functional bioassay such as a functional cellular assay in which inhibition of TIGIT signaling and inhibition of PD-1 signaling is evaluated by measuring the activation of signaling in an effector cell.
- a functional bioassay such as a functional cellular assay in which inhibition of TIGIT signaling and inhibition of PD-1 signaling is evaluated by measuring the activation of signaling in an effector cell.
- T effector cell expresses a TCR complex, TIG
- Expression of the luciferase gene by the effector cell is activated by either or both of (1) blockade of TIGIT-CD155 interaction, thereby allowing CD155-CD226 interaction and subsequent co-stimulation of luciferase expression by the effector cell, or (2) blockade of PD- 1/PD-Ll interaction, thereby relieving the inhibition of luciferase expression by the effector cell.
- the level of luciferase expression in the absence or presence of anti-TIGIT antibodies and anti-PD-1 agents or anti-PD-Ll agents can be measured and quantified for determining whether an anti-TIGIT antibody exhibits synergy with the anti-PD-1 agent or the anti-PD-Ll agent.
- the efficacy of an anti-TIGIT antibody can be measured using an in vivo model, e.g., an in vivo tumor model.
- the efficacy of an anti-TIGIT antibody as described herein, or the efficacy of an anti-TIGIT antibody as described herein when administered in combination with an anti-PD-1 agent or an anti-PD-Ll agent can be evaluated using a syngeneic mouse tumor model.
- Suitable syngeneic tumor models are described in the art. See, e.g., Rios-Doria et al., Neoplasia, 2015, 17:661-670; and Moynihan et al., Nature Medicine, 2016, doi: 10.1038/nm.4200.
- an anti-TIGIT antibody reduces the size of a tumor or the overall number of tumors in an in vivo model by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90% or more as compared to a control or reference value (e.g., as compared to tumor size or overall number of tumors in an untreated control).
- an anti-TIGIT antibody recognizes an epitope of human TIGIT that comprises one or both of amino acid positions 81 and 82, as numbered with reference to SEQ ID NO:218. In some embodiments, an anti-TIGIT antibody recognizes an epitope that comprises Phe at position 81. In some embodiments, an anti-TIGIT antibody recognizes an epitope that comprises Lys or Ser at position 82. In some embodiments, an anti-TIGIT antibody recognizes an epitope that comprises Phe at position 81 and Lys at position 82. In some embodiments, an anti-TIGIT antibody recognizes an epitope that comprises Phe at position 81 and Ser at position 82.
- an anti-TIGIT antibody recognizes a linear epitope that comprises one or both of amino acid positions 81 and 82 (e.g., a discontinuous epitope that comprises Phe at position 81 and Lys or Ser at position 82). In some embodiments, an anti- TIGIT antibody recognizes a discontinuous epitope that comprises one or both of amino acid positions 81 and 82 (e.g., a discontinuous epitope that comprises Phe at position 81 and Lys or Ser at position 82).
- an anti-TIGIT antibody binds to an epitope on human TIGIT that further comprises one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 13, 14, 15 or more) of amino acid positions 51, 52, 53, 54, 55, 73, 74, 75, 76, 77, 79, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, or 93.
- one or more e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 13, 14, 15 or more
- an anti-TIGIT antibody binds to an epitope on human TIGIT that further comprises one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 13, 14, 15 or more) of the following: Thr at position 51, Ala at position 52, Glu or Gin at position 53, Val at position 54, Thr at position 55, Leu at position 73, Gly at position 74, Trp at position 75, His at position 76, Val or He at position 77, Ser or Pro at position 79, Asp at position 83, Arg at position 84, Val at position 85, Val or Ala at position 86, Pro at position 87, Gly at position 88, Pro at position 89, Ser or Gly at position 90, Leu at position 91, Gly at position 92, or Leu at position 93.
- one or more e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 13, 14, 15 or more
- an anti-TIGIT antibody binds to an epitope on human TIGIT that further comprises one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 13, 14, 15 or more) of the amino acid residues Thr51, Ala52, Gln53, Val54, Thr55, Leu73, Gly 74, Trp75, His76, Ile77, Pro79, Asp83, Arg84, Val85, Ala86, Pro87, Gly88, Pro89, Gly90, Leu91, Gly92, and Leu93.
- one or more e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 13, 14, 15 or more
- an anti-TIGIT antibody recognizes an epitope that comprises Phe at position 81 and Lys or Ser at position 82, and further comprises Thr at position 51, Ala at position 52, Glu or Gin at position 53, Val at position 54, and/or Thr at position 55.
- an anti-TIGIT antibody recognizes an epitope that comprises Phe at position 81 and Lys or Ser at position 82, and further comprises Gly at position 74, Trp at position 75, His at position 76, and/or Val or He at position 77.
- an anti-TIGIT antibody recognizes an epitope that comprises Phe at position 81 and Lys or Ser at position 82, and further comprises Pro at position 87, Gly at position 88, Pro at position 89, Ser or Gly at position 90, Leu at position 91, Gly at position 92, and/or Leu at position 93.
- an anti-TIGIT antibody recognizes an epitope comprising the amino acid residues Thr51, Ala52, Gln53, Val54, Thr55, Gly 74, Trp75, His76, Ile77, Phe81, Lys82, Pro87, Gly88, Pro89, Gly90, Leu91, Gly92, and Leu93.
- an anti-TIGIT antibody recognizes an epitope that comprises Phe at position 81 and Lys or Ser at position 82, and further comprises Ala at position 52 and/or Glu or Gin at position 53. In some embodiments, an anti-TIGIT antibody recognizes an epitope that comprises Phe at position 81 and Lys or Ser at position 82, and further comprises Leu at position 73, Gly at position 74, and/or Trp at position 75. In some embodiments, an anti-TIGIT antibody recognizes an epitope that comprises Phe at position 81 and Lys or Ser at position 82, and further comprises Asp at position 83, Arg at position 84, Val at position 85, and/or Val or Ala at position 86.
- an anti-TIGIT antibody recognizes an epitope comprising the amino acid residues Ala52, Gln53, Leu73, Gly 74, Trp75, Pro79, Phe81, Lys82, Asp83, Arg84, Val85, and Ala86.
- an anti-TIGIT antibody recognizes an epitope of human TIGIT comprising the sequence ICNADLGWHI SP SFK (SEQ ID NO:258), which corresponds to residues 68-82 of human TIGIT (SEQ ID NO:218).
- an anti-TIGIT antibody recognizes an epitope of human TIGIT consisting of the sequence ICNADLGWHISPSFK (SEQ ID NO:258).
- an anti-TIGIT antibody that binds to human TIGIT and that optionally exhibits cross-reactivity with cynomolgus monkey TIGIT and/or mouse TIGIT comprises a light chain sequence, or a portion thereof, and/or a heavy chain sequence, or a portion thereof, derived from any of the following antibodies described herein: Clone 2,
- Clone 2C Clone 3, Clone 5, Clone 13, Clone 13A, Clone 13B, Clone 13C, Clone 13D, Clone 14, Clone 16, Clone 16C, Clone 16D, Clone 16E, Clone 18, Clone 21, Clone 22, Clone 25, Clone 25A, Clone 25B, Clone 25C, Clone 25D, Clone 25E, Clone 27, or Clone 54.
- the amino acid sequences of the CDR, light chain variable domain (VL), and heavy chain variable domain (VH) of the anti-TIGIT antibodies Clone 2, Clone 2C, Clone 3, Clone 5, Clone 13, Clone 13A, Clone 13B, Clone 13C, Clone 13D, Clone 14, Clone 16, Clone 16C, Clone 16D, Clone 16E, Clone 18, Clone 21, Clone 22, Clone 25, Clone 25 A, Clone 25B, Clone 25C, Clone 25D, Clone 25E, Clone 27, and Clone 54 are set forth in Table 3 below.
- an anti-TIGIT antibody comprises a heavy chain variable region (VH) comprising an amino acid sequence that has at least 90% sequence identity (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity) to SEQ ID NO: 1, SEQ ID NO: 19, SEQ ID NO:37, SEQ ID NO:55, SEQ ID NO:73, SEQ ID NO:91, SEQ ID NO: 109, SEQ ID NO: 127, SEQ ID NO: 145, SEQ ID NO: 163, SEQ ID NO: 181, SEQ ID NO: 199, SEQ ID NO:245, SEQ ID NO:246, SEQ ID NO:247, SEQ ID NO:248, SEQ ID NO:249, SEQ ID NO:250, SEQ ID NO:251, SEQ ID NO:252, SEQ ID NO:253, SEQ ID NO:254, SEQ
- an anti-TIGIT antibody comprises a VH comprising the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 19, SEQ ID NO:37, SEQ ID NO:55, SEQ ID NO:73, SEQ ID NO:91, SEQ ID NO: 109, SEQ ID NO: 127, SEQ ID NO: 145, SEQ ID NO: 163, SEQ ID NO: 181, SEQ ID NO: 199, SEQ ID NO:245, SEQ ID NO:246, SEQ ID NO:247, SEQ ID NO:248, SEQ ID NO:249, SEQ ID NO:250, SEQ ID NO:251, SEQ ID NO:252, SEQ ID NO:253, SEQ ID NO:254, SEQ ID NO:255, SEQ ID NO:256, or SEQ ID NO:257.
- a VH sequence having at least 90% sequence identity to a reference sequence contains one, two, three, four, five, six, seven, eight, nine, ten or more substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence but
- an anti-TIGIT antibody comprises a light chain variable region (VL) comprising an amino acid sequence that has at least 90% sequence identity (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity) to SEQ ID NO: 10, SEQ ID NO:28, SEQ ID NO:46, SEQ ID NO:64, SEQ ID NO:82, SEQ ID NO: 100, SEQ ID NO: 118, SEQ ID
- an anti-TIGIT antibody comprises a VL comprising the amino acid sequence of SEQ ID NO: 10, SEQ ID NO:28, SEQ ID NO:46, SEQ ID NO:64, SEQ ID NO:82, SEQ ID NO: 100, SEQ ID NO: 118, SEQ ID NO: 136, SEQ ID NO: 154, SEQ ID NO: 172, SEQ ID NO: 190, or SEQ ID NO:208.
- a VL sequence having at least 90% sequence identity to a reference sequence e.g., SEQ ID NO: 10, SEQ ID NO:28, SEQ ID NO:46, SEQ ID NO:64, SEQ ID NO:82, SEQ ID NO: 100, SEQ ID NO: 118, SEQ ID NO:
- SEQ ID NO: 136, SEQ ID NO: 154, SEQ ID NO: 172, SEQ ID NO: 190, or SEQ ID NO:208) contains one, two, three, four, five, six, seven, eight, nine, ten or more substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence but retains the ability to bind to human TIGIT and optionally, retains the ability to block binding of CD155 and/or CD112 to TIGIT.
- substitutions e.g., conservative substitutions
- an anti-TIGIT antibody comprises a heavy chain variable region comprising an amino acid sequence that has at least 90% sequence identity (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity) to SEQ ID NO: 1, SEQ ID NO: 19, SEQ ID NO:37, SEQ ID NO:55, SEQ ID NO:73, SEQ ID NO:91, SEQ ID NO: 109, SEQ ID NO: 127, SEQ ID NO: 145, SEQ ID NO: 163, SEQ ID NO: 181, SEQ ID NO: 199, SEQ ID NO:245, SEQ ID NO:246, SEQ ID NO:247, SEQ ID NO:248, SEQ ID NO:249, SEQ ID NO:250, SEQ ID NO:251, SEQ ID NO:252, SEQ ID NO:253, SEQ ID NO:254, SEQ ID NO:255
- an anti-TIGIT antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 19, SEQ ID NO:37, SEQ ID NO:55, SEQ ID NO:73, SEQ ID NO:91, SEQ ID NO: 109, SEQ ID NO: 127, SEQ ID NO: 145, SEQ ID NO: 163, SEQ ID NO: 181, SEQ ID NO: 199, SEQ ID NO:245, SEQ ID NO:246, SEQ ID NO:247, SEQ ID NO:248, SEQ ID NO:249, SEQ ID NO:250, SEQ ID NO:251, SEQ ID NO:252, SEQ ID NO:253, SEQ ID NO:254, SEQ ID NO:255, SEQ ID NO:256, or SEQ ID NO:257 and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 10, SEQ ID NO:28, SEQ ID NO:46, SEQ ID NO:64, SEQ ID NO:82
- SEQ ID NO: 100 SEQ ID NO: 118, SEQ ID NO: 136, SEQ ID NO: 154, SEQ ID NO: 172, SEQ ID NO: 190, or SEQ ID NO:208.
- an anti-TIGIT antibody comprises: (a) a VH comprising an amino acid sequence that has at least 90% sequence identity (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity) to SEQ ID NO: 1 or SEQ ID NO:245 and a VL comprising an amino acid sequence that has at least 90% sequence identity (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity) to SEQ ID NO: 10;
- VH comprising an amino acid sequence that has at least 90% sequence identity (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity) to SEQ ID NO: 19 and a VL comprising an amino acid sequence that has at least 90% sequence identity (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity) to SEQ ID NO:28;
- VH comprising an amino acid sequence that has at least 90% sequence identity (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity) to SEQ ID NO:37 and a VL comprising an amino acid sequence that has at least 90% sequence identity (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity) to SEQ ID NO:46;
- a VH comprising an amino acid sequence that has at least 90% sequence identity (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%), at least 97%, at least 98%, or at least 99% sequence identity) to any one of SEQ ID NO:55, SEQ ID NO:246, SEQ ID NO:247, SEQ ID NO:248, or SEQ ID NO:249 and a VL comprising an amino acid sequence that has at least 90% sequence identity (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity) to SEQ ID NO: 64;
- VH comprising an amino acid sequence that has at least 90% sequence identity (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity) to SEQ ID NO: 73 and a VL comprising an amino acid sequence that has at least 90% sequence identity (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity) to SEQ ID NO: 82;
- a VH comprising an amino acid sequence that has at least 90% sequence identity (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity) to any one of SEQ ID NO:91, SEQ ID NO:250, SEQ ID NO:251, or SEQ ID NO:252 and a VL comprising an amino acid sequence that has at least 90% sequence identity (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity) to SEQ ID NO: 100;
- VH comprising an amino acid sequence that has at least 90% sequence identity (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity) to SEQ ID NO: 109 and a VL comprising an amino acid sequence that has at least 90% sequence identity (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity) to SEQ ID NO: 118;
- VH comprising an amino acid sequence that has at least 90% sequence identity (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity) to SEQ ID NO: 127 and a VL comprising an amino acid sequence that has at least 90% sequence identity (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity) to SEQ ID NO: 136;
- VH comprising an amino acid sequence that has at least 90% sequence identity (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity) to SEQ ID NO: 145 and a VL comprising an amino acid sequence that has at least 90% sequence identity (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity) to SEQ ID NO: 154;
- a VH comprising an amino acid sequence that has at least 90% sequence identity (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%), at least 97%, at least 98%, or at least 99% sequence identity) to any one of SEQ ID NO: 163, SEQ ID NO:253, SEQ ID NO:254, SEQ ID NO:255, SEQ ID NO:256, or SEQ ID NO:257 and a VL comprising an amino acid sequence that has at least 90% sequence identity (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity) to SEQ ID NO: 172;
- VH comprising an amino acid sequence that has at least 90% sequence identity (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity) to SEQ ID NO: 181 and a VL comprising an amino acid sequence that has at least 90% sequence identity (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity) to SEQ ID NO: 190; or
- VH comprising an amino acid sequence that has at least 90% sequence identity (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity) to SEQ ID NO: 199 and a VL comprising an amino acid sequence that has at least 90% sequence identity (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity) to SEQ ID NO:208.
- an anti-TIGIT antibody comprises:
- VL comprising the amino acid sequence of SEQ ID NO: 172;
- VH comprising the amino acid sequence of SEQ ID NO: 199 and a VL comprising the amino acid sequence of SEQ ID NO:208;
- a VH comprising the amino acid sequence of SEQ ID NO:246 and a VL comprising the amino acid sequence of SEQ ID NO:64; or (o) a VH comprising the amino acid sequence of SEQ ID NO:247 and a
- VL comprising the amino acid sequence of SEQ ID NO: 64; or
- VL comprising the amino acid sequence of SEQ ID NO: 172; or
- an anti-TIGIT antibody comprises one or more (e.g., one, two, three, four, five, or more) of: a heavy chain CDR1 sequence comprising the amino acid sequence of any of SEQ ID NO:4, SEQ ID NO:22, SEQ ID NO:40, SEQ ID NO:58, SEQ ID NO:76, SEQ ID NO:94, SEQ ID NO: 112, SEQ ID NO: 130, SEQ ID NO: 148, SEQ ID NO: 166, SEQ ID NO: 184, SEQ ID NO:202, SEQ ID NO:221, SEQ ID NO:224, SEQ ID NO:226, SEQ ID NO:231, SEQ ID NO:233, SEQ ID NO:239, or SEQ ID NO:243;
- a heavy chain CDR2 sequence comprising the amino acid sequence of any of SEQ ID NO:6, SEQ ID NO:24, SEQ ID NO:42, SEQ ID NO:60, SEQ ID NO:78, SEQ ID NO:96, SEQ ID NO: 114, SEQ ID NO: 132, SEQ ID NO: 150, SEQ ID NO: 168, SEQ ID NO: 186, SEQ ID NO:204, SEQ ID NO:222, SEQ ID NO:225, SEQ ID NO:227, SEQ ID NO:229, SEQ ID NO:232, SEQ ID NO:234, SEQ ID NO:238, or SEQ ID NO:240;
- a heavy chain CDR3 sequence comprising the amino acid sequence of any of SEQ ID NO:8, SEQ ID NO:26, SEQ ID NO:44, SEQ ID NO:62, SEQ ID NO:80, SEQ ID NO:98, SEQ ID NO: 116, SEQ ID NO: 134, SEQ ID NO: 152, SEQ ID NO: 170, SEQ ID NO: 188, SEQ ID NO:206, SEQ ID NO:223, SEQ ID NO:228, SEQ ID NO:230, SEQ ID NO:235, SEQ ID NO:236, SEQ ID NO:237, SEQ ID NO:241, SEQ ID NO:242, or SEQ ID NO:244;
- a light chain CDR1 sequence comprising the amino acid sequence of any of SEQ ID NO: 13, SEQIDNO:31, SEQIDNO:49, SEQIDNO:67, SEQIDNO:85, SEQ ID NO: 103, SEQ ID NO: 121, SEQ ID NO: 139, SEQ ID NO: 157, SEQ ID NO: 175, SEQ ID NO: 193, or SEQIDNO:211;
- a light chain CDR2 sequence comprising the amino acid sequence of any of SEQIDNO:15, SEQIDNO:33, SEQIDNO:51, SEQIDNO:69, SEQIDNO:87, SEQ ID NO: 105, SEQ ID NO: 123, SEQ ID NO: 141, SEQ ID NO: 159, SEQ ID NO: 177, SEQ ID NO: 195, or SEQ ID NO:213; and/or
- a light chain CDR3 sequence comprising the amino acid sequence of any of SEQ ID NO: 17, SEQIDNO:35, SEQIDNO:53, SEQIDNO:71, SEQIDNO:89, SEQ ID NO: 107, SEQ ID NO: 125, SEQ ID NO: 143, SEQ ID NO: 161, SEQ ID NO: 179, SEQ ID NO: 197, or SEQIDNO:215.
- an anti-TIGIT antibody comprises a heavy chain CDR1 sequence comprising the amino acid sequence of any of SEQ ID NO:4, SEQ ID NO:22, SEQ IDNO:40, SEQIDNO:58, SEQIDNO:76, SEQIDNO:94, SEQ ID NO: 112, SEQ ID NO: 130, SEQ ID NO: 148, SEQ ID NO: 166, SEQ ID NO: 184, SEQ ID NO: 202, SEQ ID NO:221, SEQ ID NO:224, SEQ ID NO:226, SEQ ID NO:231, SEQ ID NO:233, SEQ ID NO:239, or SEQ ID NO:243; a heavy chain CDR2 sequence comprising the amino acid sequence of any of SEQ ID NO:6, SEQ ID NO:24, SEQ ID NO:42, SEQ ID NO:60, SEQ ID NO:78, SEQIDNO:96, SEQ ID NO: 114, SEQ ID NO: 132, SEQ ID NO: 150, SEQ ID NO: 114, SEQ
- an anti-TIGIT antibody comprises a light chain CDR1 sequence comprising the amino acid sequence of any of SEQ ID NO: 13, SEQ ID NO:31, SEQIDNO:49, SEQIDNO:67, SEQIDNO:85, SEQ ID NO: 103, SEQ ID NO: 121, SEQ ID NO: 139, SEQ ID NO: 157, SEQ ID NO: 175, SEQ ID NO: 193, or SEQ ID NO :211; a light chain CDR2 sequence comprising the amino acid sequence of any of SEQ ID NO: 15, SEQ IDNO:33, SEQIDNO:51, SEQIDNO:69, SEQIDNO:87, SEQ ID NO: 105, SEQ ID NO: 123, SEQ ID NO: 141, SEQ ID NO: 159, SEQ ID NO: 177, SEQ ID NO: 195, or SEQ ID NO:213; and a light chain CDR3 sequence comprising the amino acid sequence of any of SEQ ID NO: 17,
- an anti-TIGIT antibody comprises: (i) a heavy chain CDR1 sequence comprising the amino acid sequence of any of SEQ ID NO:4, SEQ ID NO:22, SEQ ID NO:40, SEQ ID NO:58, SEQ ID NO:76, SEQ IDNO:94, SEQ ID NO: 112, SEQ ID NO: 130, SEQ ID NO: 148, SEQ ID NO: 166, SEQ ID NO: 184, SEQ ID NO:202, SEQ ID NO:221, SEQ ID NO:224, SEQ ID NO:226, SEQ ID NO:231, SEQ ID NO:233, SEQ ID NO:239, or SEQ ID NO:243; and
- a heavy chain CDR2 sequence comprising the amino acid sequence of any of SEQ ID NO:6, SEQ ID NO:24, SEQ ID NO:42, SEQ ID NO:60, SEQ ID NO:78, SEQIDNO:96, SEQ ID NO: 114, SEQ ID NO: 132, SEQ ID NO: 150, SEQ ID NO: 168, SEQ ID NO: 186, SEQ ID NO:204, SEQ ID NO:222, SEQ ID NO:225, SEQ ID NO:227, SEQ ID NO:229, SEQ ID NO:232, SEQ ID NO:234, SEQ ID NO:238, or SEQ ID NO:240; and
- a heavy chain CDR3 sequence comprising the amino acid sequence of any of SEQ ID NO:8, SEQ ID NO:26, SEQ ID NO:44, SEQ ID NO:62, SEQ ID NO:80, SEQ IDNO:98, SEQIDNO:116, SEQIDNO:134, SEQIDNO:152, SEQIDNO:170, SEQ ID NO: 188, SEQ ID NO:206, SEQ ID NO:223, SEQ ID NO:228, SEQ ID NO:230, SEQ ID NO:235, SEQ ID NO:236, SEQ ID NO:237, SEQ ID NO:241, SEQ ID NO:242, or SEQ ID NO:244; and
- a light chain CDR1 sequence comprising the amino acid sequence of any of SEQ ID NO: 13, SEQIDNO:31, SEQIDNO:49, SEQIDNO:67, SEQIDNO:85, SEQ ID NO: 103, SEQ ID NO: 121, SEQ ID NO: 139, SEQ ID NO: 157, SEQ ID NO: 175, SEQ ID NO: 193, or SEQ ID NO:211; and
- a light chain CDR2 sequence comprising the amino acid sequence of any of SEQ ID NO: 15, SEQIDNO:33, SEQIDNO:51, SEQIDNO:69, SEQIDNO:87, SEQ ID NO: 105, SEQ ID NO: 123, SEQ ID NO: 141, SEQ ID NO: 159, SEQ ID NO: 177, SEQ ID NO: 195, or SEQ ID NO:213; and (vi) a light chain CDR3 sequence comprising the amino acid sequence of any of SEQ ID NO: 17, SEQ ID NO:35, SEQ ID NO:53, SEQ ID NO:71, SEQ ID NO:89, SEQ ID NO: 107, SEQ ID NO: 125, SEQ ID NO: 143, SEQ ID NO: 161, SEQ ID NO: 179, SEQ ID NO : 197, or SEQ ID NO : 215.
- an anti-TIGIT antibody comprises: (i) a heavy chain CDRl sequence comprising the amino acid sequence of SEQ ID NO:4 or SEQ ID NO:221; (ii) a heavy chain CDR2 sequence comprising the amino acid sequence of SEQ ID NO:6 or SEQ ID NO:222; (iii) a heavy chain CDR3 sequence comprising the amino acid sequence of SEQ ID NO:8 or SEQ ID NO:223; (iv) a light chain CDRl sequence comprising the amino acid sequence of SEQ ID NO: 13; (v) a light chain CDR2 sequence comprising the amino acid sequence of SEQ ID NO: 15; and (vi) a light chain CDR3 sequence comprising the amino acid sequence of SEQ ID NO: 17.
- an anti-TIGIT antibody comprises: (i) a heavy chain CDRl sequence comprising the amino acid sequence of any of SEQ ID NO:58, SEQ ID NO:224, or SEQ ID NO:226; (ii) a heavy chain CDR2 sequence comprising the amino acid sequence of any of SEQ ID NO:60, SEQ ID NO:225, SEQ ID NO:227, or SEQ ID NO:229; (iii) a heavy chain CDR3 sequence comprising the amino acid sequence of any of SEQ ID NO:62, SEQ ID NO:228, or SEQ ID NO:230; (iv) a light chain CDRl sequence comprising the amino acid sequence of SEQ ID NO:67; (v) a light chain CDR2 sequence comprising the amino acid sequence of SEQ ID NO:69; and (vi) a light chain CDR3 sequence comprising the amino acid sequence of SEQ ID NO:71.
- an anti-TIGIT antibody comprises: (i) a heavy chain CDRl sequence comprising the amino acid sequence of any of SEQ ID NO:94, SEQ ID NO:231, or SEQ ID NO:233; (ii) a heavy chain CDR2 sequence comprising the amino acid sequence of any of SEQ ID NO:96, SEQ ID NO:232, or SEQ ID NO:234; (iii) a heavy chain CDR3 sequence comprising the amino acid sequence of any of SEQ ID NO:98, SEQ ID NO:235, SEQ ID NO:236, or SEQ ID NO:237; (iv) a light chain CDRl sequence comprising the amino acid sequence of SEQ ID NO: 103; (v) a light chain CDR2 sequence comprising the amino acid sequence of SEQ ID NO: 105; and (vi) a light chain CDR3 sequence comprising the amino acid sequence of SEQ ID NO: 107.
- an anti-TIGIT antibody comprises: (i) a heavy chain CDRl sequence comprising the amino acid sequence of any of SEQ ID NO: 166, SEQ ID NO:239, or SEQ ID NO:243; (ii) a heavy chain CDR2 sequence comprising the amino acid sequence of any of SEQ ID NO: 168, SEQ ID NO:238, or SEQ ID NO:240; (iii) a heavy chain CDR3 sequence comprising the amino acid sequence of any of SEQ ID NO: 170, SEQ ID NO:241, SEQ ID NO:242, or SEQ ID NO:244; (iv) a light chain CDR1 sequence comprising the amino acid sequence of SEQ ID NO: 175; (v) a light chain CDR2 sequence comprising the amino acid sequence of SEQ ID NO: 177; and (vi) a light chain CDR3 sequence comprising the amino acid sequence of SEQ ID NO: 179.
- an anti-TIGIT antibody comprises a heavy chain CDRl-3 and a light chain CDRl-3 comprising the amino acid sequences of:
- the antibody further includes a framework, such as a human immunoglobulin framework.
- a framework such as a human immunoglobulin framework.
- an antibody comprises a CDR as described herein and further comprises an acceptor human framework, e.g., a human immunoglobulin framework or a human consensus framework.
- Human immunoglobulin frameworks may be part of the human antibody, or a non-human antibody may be humanized by replacing one or more endogenous frameworks with human framework region(s).
- Human framework regions that may be used for humanization include but are not limited to:
- framework regions selected using the "best-fit" method (see, e.g., Sims et al, J. Immunol. 151 :2296 (1993)); framework regions derived from the consensus sequence of human antibodies of a particular subgroup of light or heavy chain variable regions (see, e.g., Carter et al, Proc. Natl Acad. Sci. USA, 89:4285 (1992); and Presta et al, J. Immunol, 151 :2623 (1993)); human mature (somatically mutated) framework regions or human germline framework regions (see, e.g., Almagro and Fransson, Front. Biosci.
- Framework sequences can be obtained from public DNA databases or published references that include germline antibody gene sequences. For example, germline DNA sequences for human heavy and light chain variable region genes can be found in the "VB ASE2" germline variable gene sequence database for human and mouse sequences.
- an anti-TIGIT antibody comprises one or more heavy chain framework regions (FRl, FR2, FR3, and/or FR4) comprising an amino acid sequence of SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:21, SEQ ID NO:23, SEQ ID NO:25, SEQ ID NO:27, SEQ ID NO:39, SEQ ID NO:41, SEQ ID NO:43, SEQ ID NO:45, SEQ ID NO:57, SEQ ID NO:59, SEQ ID NO:61, SEQ ID NO:63, SEQ ID NO:75, SEQ ID NO:77, SEQ ID NO:79, SEQ ID NO:81, SEQ ID NO:93, SEQ ID NO:95, SEQ ID NO:97, SEQ ID NO:99, SEQ ID NO: 111, SEQ ID NO: 113, SEQ ID NO: 115, SEQ ID NO: 117, SEQ ID NO: 129, SEQ ID NO: 111, SEQ
- an anti-TIGIT antibody comprises one or more light chain framework regions (FR1, FR2, FR3, and/or FR4) comprising an amino acid sequence of SEQ ID NO: 12, SEQ ID NO: 14, SEQ ID NO: 16, SEQ ID NO: 18, SEQ ID NO:30, SEQ ID NO:32, SEQ ID NO:34, SEQ ID NO:36, SEQ ID NO:48, SEQ ID NO:50, SEQ ID NO:52, SEQ ID NO: 54, SEQ ID NO: 66, SEQ ID NO: 68, SEQ ID NO: 70, SEQ ID NO: 72, SEQ ID NO: 84, SEQ ID NO:86, SEQ ID NO:88, SEQ ID NO:90, SEQ ID NO: 102, SEQ ID NO: 104, SEQ ID NO: 106, SEQ ID NO: 108, SEQ ID NO: 120, SEQ ID NO: 122, SEQ ID NO: 124, SEQ ID NO: 126, SEQ ID NO: 138
- the anti-TIGIT antibodies of the instant disclosure do not compete for binding with the antibodies described in US 2009/0258013, US 2016/0176963, US 2016/0376365, or WO 2016/028656. In some embodiments, the anti-TIGIT antibodies of the instant disclosure do not bind to the same epitope as antibodies described in US 2009/0258013, US 2016/0176963, US 2016/0376365, or WO 2016/028656. In some embodiments, the anti-TIGIT antibodies of the instant disclosure do not bind to the same epitope as antibodies described in US
- the genes encoding the heavy and light chains of an antibody of interest can be cloned from a cell, e.g., the genes encoding a monoclonal antibody can be cloned from a hybridoma and used to produce a recombinant monoclonal antibody.
- Gene libraries encoding heavy and light chains of monoclonal antibodies can also be made from hybridoma or plasma cells.
- phage or yeast display technology can be used to identify antibodies and heteromeric Fab fragments that specifically bind to selected antigens (see, e.g., McCafferty et al, Nature 348:552-554 (1990); Marks et al, Biotechnology 10:779-783 (1992); Lou et al. (2010) PEDS 23 :311; and Chao et al, Nature Protocols, 1 :755-768 (2006)).
- antibodies and antibody sequences may be isolated and/or identified using a yeast-based antibody presentation system, such as that disclosed in, e.g., Xu et al., Protein Eng Des Sel, 2013, 26:663-670; WO 2009/036379; WO 2010/105256; and WO 2012/009568. Random combinations of the heavy and light chain gene products generate a large pool of antibodies with different antigenic specificity (see, e.g., Kuby, Immunology (3 rd ed. 1997)). Techniques for the production of single chain antibodies or recombinant antibodies (U.S. Patent
- Antibodies can also be adapted to produce antibodies.
- Antibodies can also be made bispecific, i.e., able to recognize two different antigens (see, e.g., WO 93/08829, Traunecker et al, EMBO J. 10:3655-3659 (1991); and Suresh et al, Methods in Enzymology 121 :210 (1986)).
- Antibodies can also be heteroconjugates, e.g., two covalently joined antibodies, or antibodies covalently bound to immunotoxins (see, e.g., U.S. Patent No. 4,676,980, WO 91/00360; and WO 92/200373).
- Antibodies can be produced using any number of expression systems, including prokaryotic and eukaryotic expression systems.
- the expression system is a mammalian cell, such as a hybridoma, or a CHO cell. Many such systems are widely available from commercial suppliers.
- the VH and VL regions may be expressed using a single vector, e.g., in a di-cistronic expression unit, or be under the control of different promoters.
- the VH and VL region may be expressed using separate vectors.
- a VH or VL region as described herein may optionally comprise a methionine at the N-terminus.
- a humanized antibody has one or more amino acid residues introduced into it from a source which is non-human. These non-human amino acid residues are often referred to as import residues, which are typically taken from an import variable domain.
- Humanization can be essentially performed following the method of Winter and co-workers (see, e.g., Jones et al, Nature 321 :522-525 (1986); Riechmann et al, Nature 332:323-327 (1988); Verhoeyen et al, Science 239: 1534-1536 (1988) and Presta, Curr. Op. Struct. Biol. 2:593-596 (1992)), by substituting rodent CDRs or CDR sequences for the corresponding sequences of a human antibody.
- Such humanized antibodies are chimeric antibodies (U.S. Patent No. 4,816,567), wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species.
- humanized antibodies are typically human antibodies in which some CDR residues and possibly some FR residues are substituted by residues from analogous sites in rodent antibodies.
- Transgenic mice, or other organisms such as other mammals, can be used to express humanized or human antibodies (see, e.g., U.S. Patent Nos.
- human antibodies can be generated.
- transgenic animals ⁇ e.g., mice
- transgenic animals ⁇ e.g., mice
- JH antibody heavy-chain joining region
- Jakobovits et al Proc. Natl. Acad. Sci. USA, 90:2551 (1993); Jakobovits et al, Nature,
- antibody fragments (such as a Fab, a Fab', a F(ab') 2 , a scFv, or a diabody) are generated.
- Various techniques have been developed for the production of antibody fragments. Traditionally, these fragments were derived via proteolytic digestion of intact antibodies ⁇ see, e.g., Morimoto et al, J. Biochem. Biophys. Meth., 24: 107-117 (1992); and Brennan et al, Science, 229:81 (1985)). However, these fragments can now be produced directly using recombinant host cells.
- antibody fragments can be isolated from antibody phage libraries.
- Fab'-SH fragments can be directly recovered from E. coli cells and chemically coupled to form F(ab') 2 fragments ⁇ see, e.g., Carter et al,
- F(ab') 2 fragments can be isolated directly from recombinant host cell culture.
- Other techniques for the production of antibody fragments will be apparent to those skilled in the art.
- the antibody of choice is a single chain Fv fragment (scFv). See, e.g., PCT Publication No. WO 93/16185; and U.S. Patent Nos. 5,571,894 and 5,587,458.
- the antibody fragment may also be a linear antibody as described, e.g., in U.S. Patent No. 5,641,870.
- the antibody or antibody fragment can be conjugated to another molecule, e.g., polyethylene glycol (PEGylation) or serum albumin, to provide an extended half-life in vivo.
- PEGylation polyethylene glycol
- serum albumin serum albumin
- multispecific antibodies comprising an anti-TIGIT antibody or antigen-binding fragment as described herein are provided, e.g., a bispecific antibody.
- Multispecific antibodies are antibodies that have binding specificities for at least two different sites.
- the multispecific antibody has a binding specificity for TIGIT (e.g., human TIGIT) and has a binding specificity for at least one other antigen.
- Methods for making multispecific antibodies include, but are not limited to, recombinant co- expression of two pairs of heavy chain and light chain in a host cell (see, e.g., Zuo et al., Protein Eng Des Sel, 2000, 13 :361-367); "knobs-into-holes” engineering (see, e.g., Ridgway et al., Protein Eng Des Sel, 1996, 9:617-721); "diabody” technology (see, e.g., Hollinger et al., PNAS (USA), 1993, 90:6444-6448); and intramolecular trimerization (see, e.g., Alvarez- Cienfuegos et al., Scientific Reports, 2016, doi:/10.1038/srep28643); See also, Spiess et al., Molecular Immunology, 2015, 67(2), Part A:95-106.
- antibody-drug conjugates comprising an anti-TIGIT antibody or antigen-binding fragment as described herein are provided.
- a monoclonal antibody having a binding specificity for an antigen e.g., TIGIT
- Methods for making antibody-drug conjugates are described, e.g., in Chudasama et al., Nature Chemistry, 2016, 8: 114-119; WO 2013/068874; and US 8,535,678.
- the anti-TIGIT antibodies as described herein are prepared using recombinant methods. Accordingly, in some aspects, the invention provides isolated nucleic acids comprising a nucleic acid sequence encoding any of the anti-TIGIT antibodies as described herein (e.g., any one or more of the CDRs described herein); vectors comprising such nucleic acids; and host cells into which the nucleic acids are introduced that are used to replicate the antibody-encoding nucleic acids and/or to express the antibodies.
- the host cell is eukaryotic, e.g., a Chinese Hamster Ovary (CHO) cell; or a human cell.
- a polynucleotide (e.g., an isolated polynucleotide) comprises a nucleotide sequence encoding an antibody or antigen-binding portion thereof as described herein (e.g., as described in the Section above entitled "Anti-TIGIT Antibody Sequences").
- the polynucleotide comprises a nucleotide sequence encoding one or more amino acid sequences (e.g., CDR, heavy chain, light chain, and/or framework regions) disclosed in Table 3 below.
- the polynucleotide comprises a nucleotide sequence encoding an amino acid sequence having at least 85% sequence identity (e.g., at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%), at least 97%, at least 98%, or at least 99% sequence identity) to a sequence (e.g., a CDR, heavy chain, light chain, or framework region sequence) disclosed in Table 3 below.
- sequence identity e.g., at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%), at least 97%, at least 98%, or at least 99% sequence identity
- a polynucleotide (e.g., an isolated polynucleotide) comprises a nucleotide sequence encoding a heavy chain variable region as described herein.
- a polynucleotide comprises a nucleotide sequence encoding a heavy chain variable region comprising an amino acid sequence that has at least 90% sequence identity to SEQ ID NO: l, SEQ ID NO: 19, SEQ ID NO:37, SEQ ID NO:55, SEQ ID NO:73, SEQ ID NO:91, SEQ ID NO: 109, SEQ ID NO: 127, SEQ ID NO: 145, SEQ ID NO: 163, SEQ ID NO: 181, SEQ ID NO: 199, SEQ ID NO:245, SEQ ID NO:246, SEQ ID NO:247, SEQ ID NO:248, SEQ ID NO:249, SEQ ID NO:250, SEQ ID NO:251, SEQ ID NO:252, SEQ ID NO:25
- the polynucleotide comprises the nucleotide sequence of SEQ ID NO:2, SEQ ID NO:20, SEQ ID NO:38, SEQ ID NO:56, SEQ ID NO:74, SEQ ID NO:92, SEQ ID NO: 110, SEQ ID NO: 128, SEQ ID NO: 146, SEQ ID NO: 164, SEQ ID NO: 182, or SEQ ID NO:200.
- a polynucleotide (e.g., an isolated polynucleotide) comprises a nucleotide sequence encoding a light chain variable region as described herein.
- a polynucleotide comprises a nucleotide sequence encoding a light chain variable region comprising an amino acid sequence that has at least 90% sequence identity to SEQ ID NO: 10, SEQ ID NO:28, SEQ ID NO:46, SEQ ID NO:64, SEQ ID NO:82, SEQ ID NO: 100, SEQ ID NO: 118, SEQ ID NO: 136, SEQ ID NO: 154, SEQ ID NO: 172, SEQ ID NO: 190, or SEQ ID NO:208.
- a polynucleotide comprises the nucleotide sequence of SEQ ID NO: 11, SEQ ID NO:29, SEQ ID NO:47, SEQ ID NO:65, SEQ ID NO:83, SEQ ID NO: 101, SEQ ID NO: 119, SEQ ID NO: 137, SEQ ID NO: 155, SEQ ID NO: 173, SEQ ID NO: 191, or SEQ ID NO:209.
- the polynucleotide comprises a nucleotide sequence encoding comprises a nucleotide sequence encoding a heavy chain variable region and a light chain variable region as described herein.
- a polynucleotide comprises a nucleotide sequence encoding a heavy chain variable region comprising an amino acid sequence that has at least 90% sequence identity to SEQ ID NO: 1, SEQ ID NO: 19, SEQ ID NO:37, SEQ ID NO:55, SEQ ID NO:73, SEQ ID NO:91, SEQ ID NO: 109, SEQ ID NO: 127, SEQ ID NO: 145, SEQ ID NO: 163, SEQ ID NO: 181, SEQ ID NO: 199, SEQ ID NO:245, SEQ ID NO:246, SEQ ID NO:247, SEQ ID NO:248, SEQ ID NO:249, SEQ ID NO:250, SEQ ID NO:251, SEQ ID NO:252, SEQ ID NO:25
- the polynucleotide comprises the nucleotide sequence of SEQ ID NO:2, SEQ ID NO:20, SEQ ID NO:38, SEQ ID NO:56, SEQ ID NO:74, SEQ ID NO:92, SEQ ID NO: 110, SEQ ID NO: 128, SEQ ID NO: 146, SEQ ID NO: 164, SEQ ID NO: 182, or SEQ ID NO:200, and further comprises the nucleotide sequence of SEQ ID NO: 11, SEQ ID NO:29, SEQ ID NO:47, SEQ ID NO:65, SEQ ID NO:83, SEQ ID NO: 101, SEQ ID NO: 119, SEQ ID NO: 137, SEQ ID NO: 155, SEQ ID NO: 173, SEQ ID NO: 191, or SEQ ID NO:209.
- the antibody is subsequently recovered from the host cell (or host cell culture medium).
- Suitable vectors containing polynucleotides encoding antibodies of the present disclosure, or fragments thereof include cloning vectors and expression vectors. While the cloning vector selected may vary according to the host cell intended to be used, useful cloning vectors generally have the ability to self-replicate, may possess a single target for a particular restriction endonuclease, and/or may carry genes for a marker that can be used in selecting clones containing the vector.
- Expression vectors generally are replicable polynucleotide constructs that contain a nucleic acid of the present disclosure. The expression vector may replicate in the host cells either as episomes or as an integral part of the chromosomal DNA. Suitable expression vectors include but are not limited to plasmids, viral vectors, including adenoviruses, adeno- associated viruses, retroviruses, and any other vector. IV. Therapeutic Methods Using Anti-TIGIT Antibodies
- methods for treating or preventing a cancer in a subject comprises administering to the subject a therapeutic amount of an anti-TIGIT antibody or antigen binding fragment as described herein or a pharmaceutical composition comprising an anti-TIGIT antibody or antigen binding fragment as described herein.
- the subject is a human, e.g., a human adult or a human child.
- the cancer is a cancer or cancer cell that is enriched for expression of CDl 12 and/or CD155.
- CDl 12- and/or CD155-enriched cancers are identified by immunohistochemistry assessment of tumor samples using antibodies specific for CDl 12 or CD 155.
- CDl 12 or CD 155 expression is enriched or increased in tumor cells or in tumor infiltrating leukocytes.
- the cancer is identified based on the assessment of CDl 12 and/or CD155 mRNA levels in tumor samples (e.g., by methods known in the art such as quantitative RT- PCR).
- measurements of soluble CDl 12 or CD 155 in blood samples obtained from cancer patients may be used to identify a cancer that is enriched for expression of CDl 12 and/or CD155.
- the method comprises obtaining a sample from a subject (e.g., a tumor sample or a blood sample), measuring the level of CDl 12 and/or CD155 in the sample from the subject, and comparing the level of CDl 12 and/or CD155 in the sample from the subject to a control value (e.g., a sample from a healthy control subject or a level of CDl 12 and/or CD155 expression determined for a population of healthy controls).
- the method comprises determining that the level of CDl 12 and/or CD155 in the sample from the subject is higher than a control value, and subsequently administering to the subject an anti-TIGIT antibody as described herein.
- the cancer is a cancer or cancer cell that is enriched for T cells or natural killer (NfC) cells that express TIGIT.
- TIGIT-enriched cancers are identified by immunohistochemistry assessment of tumor samples using antibodies specific for TIGIT.
- an antibody that is specific for T cells or NK cells e.g., anti-CD3, anti-CD4, anti-CD8, anti-CD25, or anti-CD56
- the cancer is identified based on the assessment of TIGIT mRNA levels in tumor samples.
- measurements of soluble TIGIT in blood samples obtained from cancer patients may be used (optionally in combination with an antibody that is specific for T cells or NK cells) to identify a cancer that is enriched for T cells or NK cells that express TIGIT.
- the method comprises obtaining a sample from a subject (e.g., a tumor sample or a blood sample), measuring the level of TIGIT in the sample from the subject, optionally detecting the presence of T cells or NK cells (e.g., using an antibody that is specific for T cells or NK cells such as anti-CD3, anti-CD4, anti-CD8, anti- CD25, or anti-CD56) and comparing the level of TIGIT in the sample from the subject to a control value (e.g., a sample from a healthy control subject or a level of TIGIT expression determined for a population of healthy controls).
- the method comprises determining that the level of TIGIT in the sample from the subject is higher than a control value, and subsequently administer
- the cancer is bladder cancer, breast cancer, uterine cancer, cervical cancer, ovarian cancer, prostate cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, pancreatic cancer, colorectal cancer, colon cancer, kidney cancer, head and neck cancer, lung cancer, stomach cancer, germ cell cancer, bone cancer, liver cancer, thyroid cancer, skin cancer (e.g., melanoma), neoplasm of the central nervous system, lymphoma, leukemia, myeloma, or sarcoma.
- the cancer is stomach cancer.
- the cancer is lung cancer.
- the cancer is skin cancer (e.g., melanoma).
- the cancer is a metastatic cancer.
- the cancer is a lymphoma or a leukemia, including but not limited to acute myeloid, chronic myeloid, acute lymphocytic or chronic lymphocytic leukemia, diffuse large B-cell lymphoma, follicular lymphoma, mantle cell lymphoma, small lymphocytic lymphoma, primary mediastinal large B-cell lymphoma, splenic marginal zone B-cell lymphoma, or extranodal marginal zone B-cell lymphoma.
- the method further comprises administering to the subject a therapeutic amount of an immuno-oncology agent.
- the immuno- oncology agent is an agent (e.g., an antibody, small molecule, or peptide) that antagonizes or inhibits a component of an immune checkpoint pathway, such as the PD-1 pathway, the CTLA-4 pathway, the Lag3 pathway, or the TIM-3 pathway.
- the immuno-oncology agent is an agonist of a T cell coactivator (i.e., an agonist of a protein that stimulates T cell activation) by targeting the OX-40 pathway, the 4-lBB (CD137) pathway, the CD27 pathway, the ICOS pathway, or the GITR pathway.
- the immuno-oncology agent is a PD-1 pathway inhibitor.
- the PD-1 pathway inhibitor is an anti-PD-1 antibody or anti-PD-Ll antibody, such as but not limited to pembrolizumab, nivolumab, durvalumab, pidilizumab, or atezolizumab.
- PD-1 pathway inhibitors are described in the art. See, e.g., Dolan et al., Cancer Control, 2014, 21 :231-237; Luke et al., Oncotarget, 2014, 6:3479-3492; US 2016/0222113; US 2016/0272708; US 2016/0272712; and US 2016/0319019.
- the immuno-oncology agent is an agonist of a T cell coactivator.
- the immuno-oncology agent is an agonist of CD28, CD28H, CD3, 4-lBB (CD137), ICOS, OX40, GITR, CD27, or CD40.
- the immuno-oncology agent is an immune stimulatory cytokine.
- the immune stimulatory cytokine is granulocyte-macrophage colony stimulating factor (GM- CSF), macrophage colony stimulating factor (M-CSF), granulocyte colony stimulating factor (G-CSF), interleukin 1 (IL-1), interleukin 2 (IL-2), interleukin 3 (IL-3), interleukin 12 (IL- 12), interleukin 15 (IL-15), or interferon gamma (IFN- ⁇ ).
- GM- CSF granulocyte-macrophage colony stimulating factor
- M-CSF macrophage colony stimulating factor
- G-CSF granulocyte colony stimulating factor
- interleukin 1 IL-1
- IL-2 interleukin 2
- IL-3 interleukin 3
- IL- 12 interleukin 15
- IFN- ⁇ interferon gamma
- the chemotherapeutic agent is an alkylating agent ⁇ e.g., cyclophosphamide, ifosfamide, chlorambucil, busulfan, melphalan, mechlorethamine, uramustine, thiotepa, nitrosoureas, or temozolomide), an anthracycline ⁇ e.g., doxorubicin, adriamycin, daunorubicin, epirubicin, or mitoxantrone), a cytoskeletal disruptor ⁇ e.g., paclitaxel or docetaxel), a histone deacetylase inhibitor ⁇ e.g., vorinostat or romidepsin), an inhibitor of topoisomerase ⁇ e.g., irinotecan, topotecan, amsacrine, etoposide, or teniposide), a kinase inhibitor (e.g.,
- the anti-TIGIT antibody (and optionally an immuno- oncology agent or other therapeutic treatment) is administered at a therapeutically effective amount or dose.
- the dosages may be varied according to several factors, including the chosen route of administration, the formulation of the composition, patient response, the severity of the condition, the subject' s weight, and the judgment of the prescribing physician.
- the dosage can be increased or decreased over time, as required by an individual patient. In certain instances, a patient initially is given a low dose, which is then increased to an efficacious dosage tolerable to the patient. Determination of an effective amount is well within the capability of those skilled in the art.
- an anti-TIGIT antibody or pharmaceutical composition comprising an anti-TIGIT antibody (and optionally an immuno-oncology agent or other therapeutic treatment) can be oral, intraperitoneal, transdermal, subcutaneous, intravenous, intramuscular, inhalational, topical, intralesional, rectal, intrabronchial, nasal, transmucosal, intestinal, ocular or otic delivery, or any other methods known in the art.
- the anti-TIGIT antibody (and optionally an immuno-oncology agent) is administered orally, intravenously, or intraperitoneally.
- Co-administered therapeutic agents e.g., the anti-TIGIT antibody and an immuno- oncology agent or other therapeutic treatment
- the administered therapeutic agents independently can be administered once, twice, three, four times daily or more or less often, as needed.
- the administered therapeutic agents are administered once daily.
- the administered therapeutic agents are administered at the same time or times, for instance as an admixture.
- one or more of the therapeutic agents is administered in a sustained-release formulation.
- the anti-TIGIT antibody and another therapeutic treatment e.g., an immuno-oncology agent
- the anti-TIGIT antibody and another therapeutic treatment are administered sequentially.
- an anti-TIGIT antibody is administered first, for example for about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 40, 50, 60, 70, 80, 90, 100 days or more prior to administering an immuno-oncology agent.
- an immuno-oncology agent is administered first, for example for about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 40, 50, 60, 70, 80, 90, 100 days or more prior to administering an immuno-oncology agent.
- the anti-TIGIT antibody (and optionally the immuno- oncology agent) is administered to the subject over an extended period of time, e.g., for at least 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 350 days or longer.
- compositions and kits comprising an anti-TIGIT antibody for use in treating or preventing a cancer in a subject are provided.
- compositions comprising an anti-TIGIT antibody for use in administering to a subject having a cancer are provided.
- the anti-TIGIT antibody is as described in Section III above, e.g., an anti- TIGIT antibody having a binding affinity, activity, cross-reactivity, epitope recognition, and/or one or more CDR, VH, and/or VL sequences as disclosed in Section III above.
- an anti-TIGIT antibody and an immuno-oncology agent are formulated into pharmaceutical compositions, together or separately, as described herein.
- the immuno-oncology agent is a PD-1 pathway inhibitor or a CTLA-4 pathway inhibitor.
- the immuno-oncology agent is an agonist of a T cell coactivator.
- the PD-1 pathway inhibitor is an anti-PD-1 antibody or anti-PD-Ll antibody, such as but not limited to pembrolizumab, nivolumab, durvalumab, pidilizumab, or atezolizumab.
- compositions described herein can be manufactured in a manner that is known to those of skill in the art, i.e., by means of conventional mixing, dissolving, granulating, dragee-making, emulsifying, encapsulating, entrapping or lyophilizing processes.
- the following methods and excipients are merely exemplary and are in no way limiting.
- an anti-TIGIT antibody (and optionally an immuno- oncology agent) is prepared for delivery in a sustained-release, controlled release, extended- release, timed-release or delayed-release formulation, for example, in semi-permeable matrices of solid hydrophobic polymers containing the therapeutic agent.
- sustained-release materials have been established and are well known by those skilled in the art.
- Current extended-release formulations include film-coated tablets, multiparticulate or pellet systems, matrix technologies using hydrophilic or lipophilic materials and wax-based tablets with pore-forming excipients ⁇ see, for example, Huang, et al. Drug Dev. Ind. Pharm. 29:79 (2003); Pearnchob, et al.
- Sustained-release delivery systems can, depending on their design, release the compounds over the course of hours or days, for instance, over 4, 6, 8, 10, 12, 16, 20, 24 hours or more. Usually, sustained release
- formulations can be prepared using naturally-occurring or synthetic polymers, for instance, polymeric vinyl pyrrolidones, such as polyvinyl pyrrolidone (PVP); carboxyvinyl hydrophilic polymers; hydrophobic and/or hydrophilic hydrocolloids, such as methylcellulose, ethylcellulose, hydroxypropylcellulose, and hydroxypropylmethylcellulose; and
- polymeric vinyl pyrrolidones such as polyvinyl pyrrolidone (PVP); carboxyvinyl hydrophilic polymers
- hydrophobic and/or hydrophilic hydrocolloids such as methylcellulose, ethylcellulose, hydroxypropylcellulose, and hydroxypropylmethylcellulose
- an anti-TIGIT antibody (and optionally an immuno- oncology agent) can be formulated readily by combining with pharmaceutically acceptable carriers that are well known in the art.
- Such carriers enable the compounds to be formulated as tablets, pills, dragees, capsules, emulsions, lipophilic and hydrophilic suspensions, liquids, gels, syrups, slurries, suspensions and the like, for oral ingestion by a patient to be treated.
- Pharmaceutical preparations for oral use can be obtained by mixing the compounds with a solid excipient, optionally grinding a resulting mixture, and processing the mixture of granules, after adding suitable auxiliaries, if desired, to obtain tablets or dragee cores.
- Suitable excipients include, for example, fillers such as sugars, including lactose, sucrose, mannitol, or sorbitol; cellulose preparations such as, for example, maize starch, wheat starch, rice starch, potato starch, gelatin, gum tragacanth, methyl cellulose, hydroxypropylmethyl- cellulose, sodium carboxymethylcellulose, and/or polyvinylpyrrolidone (PVP).
- disintegrating agents can be added, such as a cross-linked polyvinyl pyrrolidone, agar, or alginic acid or a salt thereof such as sodium alginate.
- the anti-TIGIT antibody (and optionally the immuno-oncology agent) can be formulated for parenteral administration by injection, e.g., by bolus injection or continuous infusion.
- the compound or compounds can be formulated into preparations by dissolving, suspending or emulsifying them in an aqueous or nonaqueous solvent, such as vegetable or other similar oils, synthetic aliphatic acid glycerides, esters of higher aliphatic acids or propylene glycol; and if desired, with conventional additives such as solubilizers, isotonic agents, suspending agents, emulsifying agents, stabilizers and preservatives.
- compounds can be formulated in aqueous solutions, preferably in
- compositions for injection can be presented in unit dosage form, e.g., in ampules or in multi-dose containers, with an added preservative.
- the compositions can take such forms as suspensions, solutions or emulsions in oily or aqueous vehicles, and can contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
- the anti-TIGIT antibody (and optionally the immuno-oncology agent) can be administered systemically by transmucosal or transdermal means.
- transmucosal or transdermal administration penetrants appropriate to the barrier to be permeated are used in the formulation.
- the agents are formulated into ointments, creams, salves, powders and gels.
- the transdermal delivery agent can be DMSO.
- Transdermal delivery systems can include, e.g., patches.
- penetrants appropriate to the barrier to be permeated are used in the formulation. Such penetrants are generally known in the art.
- Exemplary transdermal delivery formulations include those described in U.S. Patent Nos. 6,589,549; 6,544,548; 6,517,864; 6,512,010;
- a pharmaceutical composition comprises an acceptable carrier and/or excipients.
- a pharmaceutically acceptable carrier includes any solvents, dispersion media, or coatings that are physiologically compatible and that preferably does not interfere with or otherwise inhibit the activity of the therapeutic agent.
- the carrier is suitable for intravenous, intramuscular, oral, intraperitoneal, transdermal, topical, or subcutaneous administration.
- Pharmaceutically acceptable carriers can contain one or more physiologically acceptable compound(s) that act, for example, to stabilize the composition or to increase or decrease the absorption of the active agent(s).
- Physiologically acceptable compounds can include, for example, carbohydrates, such as glucose, sucrose, or dextrans, antioxidants, such as ascorbic acid or glutathione, chelating agents, low molecular weight proteins, compositions that reduce the clearance or hydrolysis of the active agents, or excipients or other stabilizers and/or buffers.
- compositions of the disclosure may vary depending on the particular use envisioned. The determination of the appropriate dosage or route of administration is well within the skill of one in the art. Suitable dosages are also described in Section IV above.
- kits for use in treating a subject having a cancer are provided.
- the kit comprises: an anti-TIGIT antibody; and
- anti-TIGIT antibody is as described in Section III above, e.g., an anti-TIGIT antibody having a binding affinity, activity, cross-reactivity, epitope recognition, and/or one or more CDR, VH, and/or VL sequences as disclosed in Section III above.
- the immuno-oncology agent is a PD-1 pathway inhibitor or a CTLA-4 pathway inhibitor.
- the immuno-oncology agent is an agonist of a T cell coactivator.
- the PD-1 pathway inhibitor is an anti-PD-1 antibody or anti-PD-Ll antibody.
- the immuno-oncology agent is pembrolizumab, nivolumab, durvalumab, pidilizumab, or atezolizumab.
- kits can further comprise instructional materials containing directions (i.e., protocols) for the practice of the methods of this invention (e.g., instructions for using the kit for treating a cancer).
- instructional materials typically comprise written or printed materials they are not limited to such. Any medium capable of storing such instructions and communicating them to an end user is contemplated by this invention. Such media include, but are not limited to electronic storage media (e.g., magnetic discs, tapes, cartridges, chips), optical media (e.g., CD ROM), and the like. Such media may include addresses to internet sites that provide such instructional materials.
- Example 1 Generation of anti-TIGIT Antibodies
- Fully human anti-TIGIT monoclonal antibodies were generated using yeast-based antibody presentation system (see, e.g., Xu et al, "Addressing polyspecificity of antibodies selected from an in vitro yeast presentation system: a FACS-based, high-throughput selection and analytical tool," PEDS, 2013, 26:663-670; WO 2009/036379; WO 2010/105256; and WO 2012/009568).
- Eight naive human synthetic yeast libraries each of ⁇ 10 9 diversity were screened.
- a magnetic bead sorting technique utilizing the Miltenyi MACS system was performed, as previously described (see, e.g., Siegel et al, "High efficiency recovery and epitope-specific sorting of an scFv yeast display library," J Immunol Methods, 2004, 286: 141-153). Briefly, yeast cells ( ⁇ 10 10 cells/library) were incubated with 5 mL of 10 nM biotinylated Fc-fusion antigen for 30 minutes at 30°C in wash buffer
- PBS phosphate-buffered saline
- BSA bovine serum albumin
- the libraries were incubated with a 1 : 10 dilution of biotinylated PSR reagent as previously described (see, e.g., Xu et al, supra). Yeast were then washed twice with wash buffer and stained with LC-FITC (diluted 1 : 100) and either SA-633 (diluted 1 :500) or EA-PE (extravi din-R-PE, diluted 1 :50) secondary reagents for 15 minutes at 4°C. After washing twice with wash buffer, the cell pellets were resuspended in 0.3 mL wash buffer and transferred to strainer-capped sort tubes.
- Sorting was performed using a FACS ARIA sorter (BD Biosciences) and sort gates were determined to select for antibodies with desired characteristics. Selection rounds were repeated until a population with all of the desired characteristics was obtained. After the final round of sorting, yeast were plated and individual colonies were picked for characterization.
- Antigens included recombinant dimeric human TIGIT-Fc (Aero Biosystems TIT- H5254), monomeric human TIGIT (Sino Biological 10917-H08H), dimeric mouse TIGIT-Fc (R&D Systems, 7267-TG), and monomeric mouse TIGIT (Sino Biologies 50939-M08H).
- Naive campaign 744 clones were sequenced yielding 345 unique clones (unique CDRH3). 18 VH germlines were represented in the clones.
- Light chain batch diversification campaign Heavy chain ⁇ ⁇ ) plasmids from an enriched binder pool from round six of the naive discover ⁇ ' selections were extracted from the yeast via smash and grab, propagated in and subsequently purified from E. Coli, and then transformed into a light chain library with a diversity of 10 '.
- Selections were performed under essentially the same conditions as that for the naive discovery. Briefly, one round of magnetic bead enrichment was followed by three rounds of selections by flow cytometry. In the magnetic bead enrichment round, 10 nM biotinylated Fc-fusion antigen was used.
- the first round on the flow cytometer consisted of a positive selection round using 100 nM biotinylated monovalent antigen. This was followed by a second round, which consisted of a negative selection round for PS depletion.
- the final (third) round consisted of a positive selection round, in which the monovalent antigen was titrated at 100 nM, 10 nM. 1 nM.
- the veasts from the 1 nM sorts from this third round were plated, and individual colonies were picked and characterized. In total, 728 clones were sequenced, yielding 350 unique HC/LC combinations (93 unique CDRH3s).
- Yeast clones were grown to saturation and then induced for 48 h at 30°C with shaking. After induction, yeast cells were pelleted and the supernatants were harvested for purification. IgGs were purified using a Protein A column and eluted with acetic acid, pH 2.0. Fab fragments were generated by papain digestion and purified over KappaSelect (GE Healthcare LifeSciences).
- ForteBio affinity measurements were performed on an Octet RED384 generally as previously described (see, e.g., Estep et al., "High throughput solution-based measurement of antibody-antigen affinity and epitope binning," Mobs, 2013, 5:270-278). Briefly, ForteBio affinity measurements were performed by loading IgGs on-line onto AHQ sensors. Sensors were equilibrated off-line in assay buffer for 30 minutes and then monitored on-line for 60 seconds for baseline establishment.
- Epitope binning/ligand blocking was performed using a standard sandwich format cross-blocking assay on the ForteBio Octet RED384 system. Control anti -target IgG was loaded onto AHQ sensors and unoccupied Fc-binding sites on the sensor were blocked with an irrelevant human IgGl antibody. The sensors were then exposed to 100 nM target antigen followed by a second anti-target antibody or ligand (human CD155-Fc (Sino Biological, 10109-H02H)). Additional binding by the second antibody or ligand after antigen association indicates an unoccupied epitope (non-competitor), while no binding indicates epitope blocking (competitor or ligand blocking).
- Bin code and CD 155 competition data was generated on ForteBio Octet RED384 system using a standard sandwich format cross-blocking assay as described in Example 2.
- KD affinity data was generated on ForteBio Octet RED384 system as described in Example 2.
- HEK 293 cells were engineered to stably express high levels of human, mouse or cynomolgus monkey TIGIT by lentiviral transduction. Approximately 100,000 parental HEK 293 (TIGIT -negative) cells or HEK 293 cells overexpressing human, mouse or cynomolgus monkey were stained with 100 nM of each anti-TIGIT antibody for 5 minutes at room temperature. Cells were then washed twice with wash buffer and incubated with anti-human IgG conjugated to PE for 15 minutes on ice. Cells were then washed twice with wash buffer and analyzed by flow cytometry on a FACS Canto II instrument (BD Biosciences). Fold over background (FOB) was calculated as the median fluorescence intensity (MFI) of the anti- TIGIT clone bound to target-positive cells divided by the MFI of the anti-TIGIT clone bound to target-negative cells.
- MFI median fluorescence intensity
- Hydrophobic interaction chromatography was performed as described previously (Estep et al., supra). Briefly, 5 ⁇ g IgG samples were spiked in with a mobile phase A solution (1.8 M ammonium sulfate and 0.1 M sodium phosphate at pH 6.6) to achieve a final ammonium sulfate concentration of about 1 M before analysis.
- a Sepax Proteomix HIC butyl- P5 column was used with a linear gradient of mobile phase A and mobile phase B solution (0.1 M sodium phosphate, pH 6.5) over 20 minutes at a flow rate of 1 mL/minute with UV absorbance monitoring at 280 nM.
- Example 3 Binding of anti-TIGIT antibodies to human, mouse, and cynomolgus monkey TIGIT endogenously expressed on primary T cells
- 65 antibodies shown to be specific for human TIGIT recombinant protein and human TIGIT expressed on HEK 293 cells were evaluated for their ability to bind endogenous TIGIT on primary human peripheral blood T cells.
- Antibodies were also evaluated for cross reactivity to cynomolgus TIGIT on peripheral blood T cells and 35 of the 65 clones were evaluated for cross reactivity to mouse TIGIT on activated splenic T cells.
- Human pan T cells were negatively isolated from leukapheresis product to 99% purity.
- Cynomolgus white blood cells were isolated from whole blood by red blood cell lysis (eBioscience 00-4300). 200,000 cells were stained at 4°C for 30 minutes with 20 ⁇ g/mL of each anti-TIGIT antibody.
- the anti-TIGIT antibodies were detected with polyclonal goat anti-human IgG adsorbed against monkey immunoglobulins conjugated to AlexaFluor647 (SouthernBiotech 2049-31) and T cells were identified by counterstaining with FITC-conjugated anti-CD3 clone SP34 (BD Pharmingen 556611). Samples were analyzed on a CytoFLEX flow cytometer. Percent TIGIT+ of the CD3+ population was determined for each antibody using anti-human IgG-PE only staining to determine the threshold for positivity.
- BALB/c mouse T cells were isolated from spleens by negative selection (Stem Cell Technologies 19851 A) to >99% purity. The cells were activated for 24 hours with plate bound anti-CD3 clone 145-2C11 (BioLegend 100302) to upregulate TIGIT. 200,000 activated cells were stained at 4°C for 30 minutes with 20 ⁇ g/mL of each anti-TIGIT antibody (35 of 65 clones tested). The anti-TIGIT antibodies were detected with polyclonal goat anti -human IgG conjugated to PE (Jackson ImmunoRe search 109-116-098). Samples were analyzed on a FACSCalibur flow cytometer. Median fluorescence intensity of the FSC/SSC gated lymphocyte population was determined for each antibody.
- Figure 2 shows binding of 65 anti-TIGIT antibody clones and an irrelevant isotype control antibody to primary human, cynomolgus monkey and mouse T cells. Clones 13 and 25 both showed strong binding to all three species of T cells.
- HEK 293 cells were engineered to stably express high levels of human, mouse or cynomolgus monkey TIGIT by lentiviral transduction. 200,000 293-TIGIT cells were stained at 4°C for 30 minutes with a 10-point, 3-fold titration (30 to 0.002 ⁇ g/mL) of each anti- TIGIT antibody. The anti-TIGIT antibodies were detected with polyclonal goat anti-human IgG conjugated to PE (Jackson ImmunoResearch 109-116-098). Samples were analyzed on a CytoFLEX flow cytometer. Median fluorescence intensity of the FSC/SSC gated population was determined for each antibody concentration.
- NonLinear regression of Log(X) transformed data was used to generate EC50 values in GraphPad Prism 6. None of the anti- TIGIT antibodies showed binding to parental HEK 293 cells (TIGIT-) (data not shown).
- Figure 3A-C shows the binding titration and Figure 3D shows the EC50 of binding of eight anti-TIGIT antibody clones (clone 2, clone 5, clone 13, clone 16, clone 17, clone 20, clone 25, and clone 54) to human, cynomolgus monkey, and mouse TIGIT expressed on HEK 293 cells.
- C57BL/6 mouse T cells were isolated from spleens by negative selection (Stem Cell Technologies 19851 A) to >99% purity. The cells were activated for 24 hours with plate bound anti-CD3 clone 145-2C11 (BioLegend 100302) to upregulate TIGIT. 200,000 cells were stained at 4°C for 30 minutes with an 8-point, 3-fold titration (30 to 0.014 ⁇ g/mL) of each anti-TIGIT antibody. The anti-TIGIT antibodies were detected with polyclonal goat anti-human IgG conjugated to PE (Jackson ImmunoResearch 109-116-098). Samples were analyzed on a FACSCalibur flow cytometer.
- HEK 293 cells were engineered to stably express high levels of human or mouse TIGIT by lentiviral transduction.
- hCD155-Fc (Sino Biological 10109-H02H)
- hCD112-Fc (Sino Biological 10005-H02H)
- mCD155-Fc (Sino Biological 50259-M03H) were conjugated to AlexaFluor647 (ThermoFisher A30009).
- CD155/mouse TIGIT The CD155/mouse TIGIT. Clone 55 specifically binds human TIGIT but did not compete with hCD155-Fc for binding to hTIGIT-Fc in the ForteBio Octet ligand competition assay.
- clone 55 did not efficiently block hCD155 interaction with the 293-hTIGIT cell line.
- Clone 2, clone 5, clone 13, clone 17, and clone 25 were also able to interrupt binding of human CDl 12 to human TIGIT.
- clone 55 was much less effective at blocking the CDl 12-TIGIT interaction. See, Figure 6.
- Example 5 In vitro activity of anti-TIGIT antibodies in a TIGIT/CD155 blockade bioassay
- the activity of anti-TIGIT antibodies can be functionally characterized using a TIGIT/CD155 blockade bioassay (e.g., TIGIT/CD155 Blockade Bioassay Kit, Promega Corp., Madison, WI), in which expression of a reporter gene is induced or enhanced when an antibody blocks TIGIT/CD155 interaction.
- a TIGIT/CD155 blockade bioassay e.g., TIGIT/CD155 Blockade Bioassay Kit, Promega Corp., Madison, WI
- the TIGIT/CD155 blockade bioassay comprises two cell types: an effector cell expressing TIGIT, CD226, and a TCR complex on the cell surface and containing a luciferase reporter gene; and an artificial antigen presenting cell that expresses CD155 and a TCR activator on the cell surface.
- luciferase expression requires TCR engagement plus a co-stimulatory signal.
- the CD155-TIGIT interaction has higher affinity than the CD155-CD226 interaction, resulting in net inhibitory signaling and no luciferase expression. Blockade of the CD155-TIGIT interaction allows CD155-CD226 co-stimulation driving luciferase expression.
- Jurkat effector cells expressing both TIGIT and CD226 were co-cultured with CHO-K1 artificial antigen presenting cells (aAPCs) expressing a TCR activator and CD 155.
- the Jurkat effector cells contain a luciferase reporter gene driven by the IL-2 promoter.
- CD155-TIGIT engagement leads to T cell co- inhibition and no IL-2 promoter activity.
- CD155- TIGIT interaction is interrupted allowing CD155 to associate with CD226 to send a co- stimulatory signal and drive luciferase expression.
- aAPCs were plated in 96-well plates and allowed to adhere overnight. The following day, 20 ⁇ g/mL of each anti-TIGIT antibody or an isotype control antibody and Jurkat effector cells were added to the plate. After a 6 hour incubation at 37°C, cells were lysed and luciferase substrate was added. Luciferase activity was quantified on a plate reader. Luciferase activity was calculated as a fold over the signal in the no antibody control.
- Example 6 In vitro activity of anti-TIGIT antibodies in a TIGIT/PD-1 combination bioassay
- the synergistic activity of anti-TIGIT antibodies in combination with anti-PD-1 agents can be functionally characterized using a TIGIT/PD-1 combination bioassay, in which expression of a reporter gene is enhanced when antibodies block both the TIGIT/CD155 interaction and the PD-1/PD-L1 interaction.
- the bioassay comprises two cell types: an effector cell expressing TIGIT, CD226, PD-1, and a TCR complex on the cell surface and containing a luciferase reporter gene; and an artificial antigen presenting cell that expresses CD155, PD-Ll, and a TCR activator on the cell surface.
- luciferase expression requires TCR engagement plus a co-stimulatory signal.
- the CD155-TIGIT interaction has higher affinity than the CD155-CD226 interaction, resulting in net inhibitory signaling and no luciferase expression. Additionally, binding of PD-Ll to PD-1 inhibits luciferase expression.
- Blockade of both the CD155-TIGIT interaction and the PD- 1/PD-Ll interaction relieves the inhibition and allows CD155-CD226 co-stimulation driving luciferase expression.
- Jurkat effector cells expressing PD-1, TIGIT and CD226 were co-cultured with CHO-K1 artificial antigen presenting cells (aAPCs) expressing a TCR activator, PD-L1 and CD 155.
- the Jurkat effector cells contain a luciferase reporter gene driven by the IL-2 promoter.
- aAPCs CHO-K1 artificial antigen presenting cells
- aAPCs were plated in 96-well plates and allowed to adhere overnight. The following day, a 10-point 2.5-fold titration (100 to 0.03 ⁇ g/mL) of each anti-TIGIT antibody alone, or anti-PD-1 antibody (clone EH12.2H7, BioLegend, San Diego, CA), or each anti- TIGIT antibody + anti-PD-1 antibody (1 : 1 ratio) and Jurkat effector cells were added to the plate. After a 6 hour incubation at 37°C, cells were lysed and luciferase substrate was added. Luciferase activity was quantified on a plate reader. Luciferase activity was calculated as a fold over the signal in the no antibody control. As shown in Figure 8, neither anti-TIGIT nor anti-PD-1 alone led to dramatic Jurkat activation, however, the combination of either anti- TIGIT clone 13 or clone 25 with anti-PD-1 yielded strong activation.
- Example 7 In vivo activity of anti-TIGIT antibodies in a CT26 syngeneic tumor model in BALB/c mice [0188] Based on affinity for murine TIGIT, anti-TIGIT clone 13 was chosen for evaluation in a murine syngeneic tumor model.
- the chimeric antibodies showed similar activity to the parental hlgGl antibody with regards to (1) binding to human, mouse and cynomolgus monkey TIGIT, (2) blockade of CD155 and CD112 ligand binding to cell-surface expressed TIGIT and (3) activity in the CD155-TIGIT blockade bioassay. See Figure 9A-9H.
- Anti-TIGIT clone 13 mlgGl, anti-TIGIT clone 13 mIgG2a and anti-PD-1 clone RMP1-14 were diluted to the appropriate concentration for dosing in sterile PBS. Sterile PBS was used as the vehicle control.
- TIGIT antibodies were dosed at 5 or 20 mg/kg via intraperitoneal injection twice weekly for 3 weeks (6 doses total).
- Anti-PD-1 antibody was dosed at 5 mg/kg via intraperitoneal injection twice weekly for 2 weeks (4 doses total). Dosing initiated on the day of allocation (study day 1). Tumor volume and body weight measurements were collected twice weekly until mice reached a tumor volume cutoff of 2000 mm 3 . None of the animals exhibited body weight loss relative to pre-dose weights indicating exceptional tolerability of all test agents.
- Figure 10A shows that the addition of anti-PD-1 to the mIgG2a clone 13 chimera (13-2) did not increase efficacy relative to 13-2 alone (day 18 tumor growth inhibition of 53.8% (5 mg/kg anti-TIGIT + 5 mg/kg anti-PDl) vs 86.5% (5 mg/kg anti-TIGIT alone) and 89.6% (20 mg/kg anti-TIGIT + 5 mg/kg anti-PD-1) vs 74.4% (20 mg/kg anti-TIGIT alone). Similar numbers of complete and partial responders were observed in the combination groups. See, e.g., Figures 10B-10K.
- Antibody clones 2, 13, 16, and 25 from the primary discovery output were selected for further affinity maturation. Optimization of antibodies was performed via introducing diversities into the heavy chain variable region. Two cycles of optimization were applied to the above lineages. The first cycle was comprised of a CDRH1 and CDRH2 diversification approach, while in the second cycle a CDRH3 mutagenesis approach was applied. [0192] CDRH1 and CDRH2 approach: The CDRH3 of a single antibody was recombined into a premade library with CDRH1 and CDRH2 variants of a diversity of 1 x 10 8 . Selections were then performed with one round of MACS and four rounds of F ACS as described for the naive discovery.
- the libraries were sorted for I nM monomelic TIGIT binding.
- the second FACS round was a PSR depletion round to reduce poly-specificity.
- the final two rounds were positive selection rounds using the parental Fab or IgG to pressure for high affinity.
- Fab/IgG pressure was performed as follows: antigen was incubated with 10 fold parental Fab or IgG and then incubated with the yeast libraries. Selections enriched for IgGs with better affinities than the parental Fab or IgG. Species cross-reactivity was checked in the last two rounds of FACS.
- CDRH3 mutagenesis Libraries were generated with CDRH3 diversification by randomizing positions in CDRH3. Selections were performed with one round of MACS and three rounds of FACS as described previously. PSR negative selections, species cross- reactivity, affinity pressure, and sorting was performed in order to obtain a population with the desired characteristics.
- Binding of the optimized antibodies to His-tagged human TIGIT, cyno TIGIT-Fc, and mouse TIGIT-Fc was measured using the ForteBio system as described above.
- the optimized antibodies were also tested for ligand blocking in a CD155 ligand competition assay, and for binding to human TIGIT HEK, cyno TIGIT HEK, mouse TIGIT HEK, and parental HEK cell lines, as described above.
- TFA trifluoroacetic acid
- CLIPS Chemically Linked Peptides on Scaffolds
- Pepscan Chemically Linked Peptides on Scaffolds
- CLIPS technology allows to structure peptides into single loops, double-loops, triple loops, sheet-like folds, helix-like folds and combinations thereof.
- CLIPS templates are coupled to cysteine residues.
- the side-chains of multiple cysteines in the peptides are coupled to one or two CLIPS templates.
- a 0.5 mM solution of the P2 CLIPS (2,6-bis(bromomethyl)pyridine) is dissolved in ammonium bicarbonate (20 mM, pH 7.8)/acetonitrile (l :3(v/v)).
- the CLIPS template will bind to side-chains of two cysteines as present in the solid- phase bound peptides of the peptide-arrays (455 wells plate with 3 ⁇ wells).
- the peptide arrays are gently shaken in the solution for 30 to 60 minutes while completely covered in solution.
- the peptide arrays are washed extensively with excess of H2O and sonicated in disrupt-buffer containing 1 % SDS/0.1 % beta-mercaptoethanol in PBS (pH 7.2) at 70°C for 30 minutes, followed by sonication in H2O for another 45 minutes.
- the T3 CLIPS carrying peptides were made in a similar way but with three cysteines.
- Set 1 comprised a set of linear peptides having a length of 15 amino acids derived from the target sequence of human TIGIT with an offset of one residue.
- Set 2 comprised a set of linear peptides of Set 1, but with residues on positions 10 and 11 replaced by Ala. When a native Ala would occur on either position, it was replaced by Gly.
- Set 3 comprised a set of linear peptides of Set 1, which contained Cys residues. In this set, native Cys were replaced by Cys- acetamidomethyl (“Cys-acm").
- Set 4 comprised a set of linear peptides having a length of 17 amino acids derived from the target sequence of human TIGIT with an offset of one residue.
- positions 1 and 17 were Cys residues used to create looped mimics by means of mP2 CLIPS. Native Cys were replaced with Cys-acm.
- Set 6 comprised a set of linear peptides having a length of 22 amino acids derived from the target sequence of human TIGIT with an offset of one residue. Residues on positions 11 and 12 were replaced with "PG" motif, while Cys residues were placed on positions 1 and 22 to create a constrained mimic with mP2. Native Cys residues were replaced by Cys-acm.
- Set 7 contained a set of linear peptides having a length of 27 amino acids. On positions 1-11 and 17-27 were 11-mer peptide sequences derived from the target sequence and joined via "GGSGG" linker. Combinations were made based on the UniProt info on disulfide bridging for human TIGIT.
- Set 8 comprised a set of combinatorial peptides having a length of 33 amino acids. On positions 2- 16 and 18-32 were 15-mer peptides derived from the target sequence of human TIGIT. On positions 1, 17 and 33 were Cys residues used to create discontinuous mimics by means of T3 CLIPS.
- Clone 25 when tested under high stringency conditions Clone 25 detectably bound peptides from all sets. Strongest binding was observed with discontinuous epitope mimics. While binding to peptides containing residues within stretch
- 50TTAQVTQ56 was only observed in combination with 68 ICNADLGWHISPSFK 82 .
- Set 1 comprised a library of single residue epitope mutants based on the sequence CILQ2HLSSTTAQVTQCI2NADLGWHISPSFKC. Residues ADHIQRY were subjected to replacement. Positions 1, 17, 19, 30 and 33 were not replaced. Native Cys residues were replaced by Cys-acm (denoted "2" throughout).
- Set 2 comprised a library of walking double Ala mutants derived from the sequence
- CILQ2HLSSTTAQVTQCI2NADLGWHISPSFKC Positions 1, 17 and 33 were not replaced. Native Cys residues were replaced by Cys-acm.
- Set 3 comprised a library of single residue epitope mutants based on the sequence CKDRVAPGPGLGLTLQCI2NADLGWHISPSFKC. Residues ADHIQRY were used for the replacement. Positions 1, 2, 17, 19, 30 and 33 were not replaced.
- Set 4 comprised a library of walking double Ala mutants derived from sequence CKDRVAPGPGLGLTLQCI2NADLGWHISPSFKC. Positions 1, 17 and 33 were not replaced. [0206] Clone 13 was tested with four series of discontinuous epitope mutants derived from peptides CILQ2HLSSTTAQVTQCI2NADLGWHISPSFKC and
- CKDRVAPGPGLGLTLQCI2NADLGWHISPSFKC were lower than those recorded with CILQ2HLSSTTAQVTQCI2NADLGWHISPSFKC. It was further found that that in addition to 8 iFK 82 double Ala replacements of 74GWHI77 notably reduce binding of Clone 13. In addition, double Ala mutations within the stretch 87 PGPGLGL93 somewhat weakened binding.
- Clone 25 was tested on four series of discontinuous epitope mutants derived from peptides CILQ2HLSSTTAQVTQCI2NADLGWHISPSFKC and
- Mouse TIGIT 220 MHGWLLLVWVQGLIQAAFLATGATAGTIDTKRNISAEEGGSVILQCHFSSD protein TAEVTQVDWKQQDQLLAIYSVDLGWHVASVFSDRWPGPSLGLTFQSLTM
- Clones 13B and 13D 227 SIIPYFGKANYAQKFQG
- Clones 13C and 13D 230 ARGPSEVKGILGYVWFDP
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Cell Biology (AREA)
- Epidemiology (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Toxicology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicinal Preparation (AREA)
- Prostheses (AREA)
Priority Applications (17)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201880027323.6A CN111050788A (zh) | 2017-02-28 | 2018-02-28 | 抗tigit抗体 |
| MX2019010206A MX2019010206A (es) | 2017-02-28 | 2018-02-28 | Anticuerpos anti inmunorreceptor de linfocitos t con dominios de motivo de inactivación basado en tirosina de inmunorreceptor e inmunoglobulina (tigit). |
| AU2018227489A AU2018227489B2 (en) | 2017-02-28 | 2018-02-28 | Anti-TIGIT antibodies |
| SG11201907278VA SG11201907278VA (en) | 2017-02-28 | 2018-02-28 | Anti-tigit antibodies |
| EP18760515.9A EP3589313A4 (en) | 2017-02-28 | 2018-02-28 | ANTI-TIGITE ANTIBODY |
| EA201992039A EA201992039A1 (ru) | 2018-01-12 | 2018-02-28 | Антитела к tigit |
| JP2019546327A JP2020510422A (ja) | 2017-02-28 | 2018-02-28 | 抗tigit抗体 |
| CA3053486A CA3053486A1 (en) | 2017-02-28 | 2018-02-28 | Anti-tigit antibodies |
| KR1020197027438A KR20190123749A (ko) | 2017-02-28 | 2018-02-28 | 항-tigit 항체 |
| BR112019017550-4A BR112019017550A2 (pt) | 2017-02-28 | 2018-02-28 | anticorpo isolado, composição farmacêutica, anticorpo biespecífico, conjugado de anticorpo-droga, polinucleotídeo isolado, vetor, célula hospedeira, métodos de produção de um anticorpo e de tratamento de um câncer em um sujeito, e, kit |
| IL268517A IL268517A (en) | 2017-02-28 | 2019-08-05 | Anti-tigit antibodies |
| US16/541,575 US20200040082A1 (en) | 2017-02-28 | 2019-08-15 | Anti-TIGIT Antibodies |
| US17/082,586 US20210269527A1 (en) | 2017-02-28 | 2020-10-28 | Anti-TIGIT Antibodies |
| US17/853,134 US20230134375A1 (en) | 2017-02-28 | 2022-06-29 | Anti-TIGIT Antibodies |
| JP2022118823A JP2022141910A (ja) | 2017-02-28 | 2022-07-26 | 抗tigit抗体 |
| AU2024200157A AU2024200157A1 (en) | 2017-02-28 | 2024-01-10 | Anti-TIGIT antibodies |
| JP2024026609A JP2024057038A (ja) | 2017-02-28 | 2024-02-26 | 抗tigit抗体 |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201762464529P | 2017-02-28 | 2017-02-28 | |
| US62/464,529 | 2017-02-28 | ||
| US201862616779P | 2018-01-12 | 2018-01-12 | |
| US62/616,779 | 2018-01-12 |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/541,575 Continuation US20200040082A1 (en) | 2017-02-28 | 2019-08-15 | Anti-TIGIT Antibodies |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2018160704A1 true WO2018160704A1 (en) | 2018-09-07 |
| WO2018160704A9 WO2018160704A9 (en) | 2019-10-17 |
Family
ID=63370305
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2018/020239 Ceased WO2018160704A1 (en) | 2017-02-28 | 2018-02-28 | Anti-tigit antibodies |
Country Status (13)
| Country | Link |
|---|---|
| US (3) | US20200040082A1 (cg-RX-API-DMAC7.html) |
| EP (1) | EP3589313A4 (cg-RX-API-DMAC7.html) |
| JP (3) | JP2020510422A (cg-RX-API-DMAC7.html) |
| KR (1) | KR20190123749A (cg-RX-API-DMAC7.html) |
| CN (1) | CN111050788A (cg-RX-API-DMAC7.html) |
| AU (2) | AU2018227489B2 (cg-RX-API-DMAC7.html) |
| BR (1) | BR112019017550A2 (cg-RX-API-DMAC7.html) |
| CA (1) | CA3053486A1 (cg-RX-API-DMAC7.html) |
| IL (1) | IL268517A (cg-RX-API-DMAC7.html) |
| MA (1) | MA47694A (cg-RX-API-DMAC7.html) |
| MX (2) | MX2019010206A (cg-RX-API-DMAC7.html) |
| SG (2) | SG11201907278VA (cg-RX-API-DMAC7.html) |
| WO (1) | WO2018160704A1 (cg-RX-API-DMAC7.html) |
Cited By (35)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20170342152A1 (en) * | 2014-10-31 | 2017-11-30 | Biogen Ma Inc. | ANTI-GLYCOPROTEIN IIb/IIIa ANTIBODIES |
| WO2020053263A1 (en) | 2018-09-11 | 2020-03-19 | Iteos Therapeutics S.A. | Thiocarbamate derivatives as a2a inhibitors, pharmaceutical composition thereof and combinations with anticancer agents |
| WO2020041541A3 (en) * | 2018-08-23 | 2020-03-26 | Seattle Genetics, Inc. | Anti-tigit antibodies |
| WO2020127377A1 (en) | 2018-12-21 | 2020-06-25 | Ose Immunotherapeutics | Bifunctional anti-pd-1/il-7 molecule |
| WO2020165374A1 (en) | 2019-02-14 | 2020-08-20 | Ose Immunotherapeutics | Bifunctional molecule comprising il-15ra |
| WO2020257760A1 (en) * | 2019-06-21 | 2020-12-24 | Single Cell Technology, Inc. | Anti-tigit antibodies |
| US10875924B2 (en) | 2014-10-23 | 2020-12-29 | Biogen Ma Inc. | Anti-GPIIB/IIIA antibodies and uses thereof |
| CN112409450A (zh) * | 2020-03-29 | 2021-02-26 | 郑州大学 | TIGIT-IgV的亲和剂及其应用 |
| WO2021092196A1 (en) * | 2019-11-05 | 2021-05-14 | Merck Patent Gmbh | Anti-tigit antibodies and uses thereof |
| WO2021122866A1 (en) | 2019-12-17 | 2021-06-24 | Ose Immunotherapeutics | Bifunctional molecules comprising an il-7 variant |
| US11136384B2 (en) | 2016-11-30 | 2021-10-05 | Mereo Biopharma 5, Inc. | Methods for treatment of cancer comprising TIGIT-binding agents |
| WO2021224438A1 (en) | 2020-05-07 | 2021-11-11 | Institut Curie | Antxr1 as a biomarker of immunosuppressive fibroblast populations and its use for predicting response to immunotherapy |
| WO2021258337A1 (en) * | 2020-06-24 | 2021-12-30 | Huahui Health Ltd. | Human monoclonal antibodies against tigit for immune related diseases |
| WO2022112198A1 (en) | 2020-11-24 | 2022-06-02 | Worldwide Innovative Network | Method to select the optimal immune checkpoint therapies |
| US11376255B2 (en) | 2018-09-11 | 2022-07-05 | iTeos Belgium SA | Thiocarbamate derivatives as A2A inhibitors, pharmaceutical composition thereof and combinations with anticancer agents |
| WO2022148781A1 (en) | 2021-01-05 | 2022-07-14 | Institut Curie | Combination of mcoln activators and immune checkpoint inhibitors |
| JP2022536026A (ja) * | 2019-06-13 | 2022-08-12 | グリーン クロス コーポレーション | Tigitに対する抗体及びその用途 |
| WO2022178135A1 (en) | 2021-02-17 | 2022-08-25 | Iteos Belguim Sa | Compounds, compositions and methods of treatment thereof |
| WO2022214652A1 (en) | 2021-04-09 | 2022-10-13 | Ose Immunotherapeutics | Scaffold for bifunctioanl molecules comprising pd-1 or cd28 and sirp binding domains |
| WO2022214653A1 (en) | 2021-04-09 | 2022-10-13 | Ose Immunotherapeutics | New scaffold for bifunctional molecules with improved properties |
| US20230190931A1 (en) * | 2017-07-27 | 2023-06-22 | iTeos Belgium SA | Anti-TIGIT Antibodies |
| WO2023215719A1 (en) | 2022-05-02 | 2023-11-09 | Arcus Biosciences, Inc. | Anti-tigit antibodies and uses of the same |
| US11820824B2 (en) | 2020-06-02 | 2023-11-21 | Arcus Biosciences, Inc. | Antibodies to TIGIT |
| WO2024003360A1 (en) | 2022-07-01 | 2024-01-04 | Institut Curie | Biomarkers and uses thereof for the treatment of neuroblastoma |
| WO2024028386A1 (en) | 2022-08-02 | 2024-02-08 | Ose Immunotherapeutics | Multifunctional molecule directed against cd28 |
| EP4148068A4 (en) * | 2020-05-09 | 2024-07-31 | Huabo Biopharm (Shanghai) Co., Ltd. | ANTI-TIGIT ANTIBODIES AND PRODUCTION PROCESSES AND USE THEREOF |
| WO2024200820A1 (en) | 2023-03-30 | 2024-10-03 | Ose Immunotherapeutics | Method of synthesis of targeted lipid nanoparticle and uses thereof |
| WO2024200823A1 (en) | 2023-03-30 | 2024-10-03 | Ose Immunotherapeutics | Lipid-based nanoparticle targeted at activated immune cells for the expression of immune cell enhancing molecule and use thereof |
| WO2025068461A1 (en) | 2023-09-29 | 2025-04-03 | Negio Therapeutics | Guanfacine derivatives and their use in treating cancer |
| WO2025068452A1 (en) | 2023-09-29 | 2025-04-03 | Negio Therapeutics | Guanfacine derivatives and their use in treating cancer |
| WO2025132831A1 (en) | 2023-12-19 | 2025-06-26 | Universite D'aix-Marseille | N-heteroaryl derivatives and uses thereof for treating cancer |
| WO2025242835A1 (en) | 2024-05-22 | 2025-11-27 | Ose Immunotherapeutics | Molecules comprising masking linkers and uses thereof for the treatment of cancer |
| WO2025242836A1 (en) | 2024-05-22 | 2025-11-27 | Ose Immunotherapeutics | Molecules comprising masking linkers and uses thereof for the treatment of auto-immune or inflammatory diseases and disorders |
| WO2025262250A1 (en) | 2024-06-20 | 2025-12-26 | Negio Therapeutics | Guanfacine derivatives and their uses |
| WO2026068705A1 (en) | 2024-09-26 | 2026-04-02 | Ose Immunotherapeutics | Lipid-based nanoparticles comprising non-glycosylated fc domains and uses thereof |
Families Citing this family (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| SG10202112838YA (en) | 2008-04-09 | 2021-12-30 | Genentech Inc | Novel compositions and methods for the treatment of immune related diseases |
| JP7178906B2 (ja) | 2016-05-19 | 2022-11-28 | ザ ジェネラル ホスピタル コーポレイション | ナチュラルキラー細胞および制御性T細胞の活性を強化するためのプラットフォームである、その受容体IL-2Rβに繋ぎ止められたインターロイキン-2 |
| LT3618863T (lt) | 2017-05-01 | 2023-10-10 | Agenus Inc. | Anti-tigit antikūnai ir jų panaudojimo būdai |
| US20200318200A1 (en) | 2019-04-02 | 2020-10-08 | The Brigham And Women's Hospital, Inc. | Methods for Identifying Progression of a Primary Melanoma |
| CN113563470B (zh) * | 2020-04-29 | 2023-02-10 | 广州昂科免疫生物技术有限公司 | 结合tigit抗原的抗体及其制备方法与应用 |
| KR20230024368A (ko) | 2020-06-18 | 2023-02-20 | 제넨테크, 인크. | 항-tigit 항체 및 pd-1 축 결합 길항제를 사용한 치료 |
| CN111718415B (zh) * | 2020-07-03 | 2021-02-23 | 上海洛启生物医药技术有限公司 | 一种抗tigit纳米抗体及其应用 |
| TW202216778A (zh) | 2020-07-15 | 2022-05-01 | 美商安進公司 | Tigit及cd112r阻斷 |
| EP4192883A4 (en) * | 2020-08-05 | 2024-12-04 | Crystal Bioscience Inc. | Anti-tigit antibody and methods of use thereof |
| CN116368154A (zh) | 2020-10-08 | 2023-06-30 | 阿菲姆德股份有限公司 | 三特异性结合剂 |
| AR125753A1 (es) | 2021-05-04 | 2023-08-09 | Agenus Inc | Anticuerpos anti-tigit, anticuerpos anti-cd96 y métodos de uso de estos |
| WO2023010094A2 (en) | 2021-07-28 | 2023-02-02 | Genentech, Inc. | Methods and compositions for treating cancer |
| CA3216098A1 (en) | 2021-07-30 | 2023-02-02 | Uwe Reusch | Duplexbodies |
| WO2023056403A1 (en) | 2021-09-30 | 2023-04-06 | Genentech, Inc. | Methods for treatment of hematologic cancers using anti-tigit antibodies, anti-cd38 antibodies, and pd-1 axis binding antagonists |
| KR20250022049A (ko) | 2022-06-07 | 2025-02-14 | 제넨테크, 인크. | 항-pd-l1 길항제 및 항-tigit 길항제 항체를 포함하는, 폐암 치료의 효율을 결정하는 방법 |
| WO2025255297A1 (en) * | 2024-06-05 | 2025-12-11 | Agilent Technologies, Inc. | Anti-human tigit antibodies for in vitro diagnostics |
Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2015073682A1 (en) * | 2013-11-13 | 2015-05-21 | Oregon Health And Science University | Methods of detecting cells latently infected with hiv |
| US20150216970A1 (en) * | 2013-07-16 | 2015-08-06 | Genentech, Inc. | Methods of treating cancer using pd-1 axis binding antagonists and tigit inhibitors |
| WO2016106302A1 (en) * | 2014-12-23 | 2016-06-30 | Bristol-Myers Squibb Company | Antibodies to tigit |
| US20160376365A1 (en) * | 2015-05-28 | 2016-12-29 | Oncomed Pharmaceuticals, Inc. | Tigit-binding agents and uses thereof |
| WO2017030823A2 (en) * | 2015-08-14 | 2017-02-23 | Merck Sharp & Dohme Corp. | Anti-tigit antibodies |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| PE20181046A1 (es) * | 2015-09-25 | 2018-07-03 | Genentech Inc | Anticuerpos anti-tigit y metodos de uso |
-
2018
- 2018-02-28 EP EP18760515.9A patent/EP3589313A4/en not_active Withdrawn
- 2018-02-28 JP JP2019546327A patent/JP2020510422A/ja not_active Withdrawn
- 2018-02-28 KR KR1020197027438A patent/KR20190123749A/ko active Pending
- 2018-02-28 MX MX2019010206A patent/MX2019010206A/es unknown
- 2018-02-28 SG SG11201907278VA patent/SG11201907278VA/en unknown
- 2018-02-28 AU AU2018227489A patent/AU2018227489B2/en not_active Ceased
- 2018-02-28 WO PCT/US2018/020239 patent/WO2018160704A1/en not_active Ceased
- 2018-02-28 CN CN201880027323.6A patent/CN111050788A/zh active Pending
- 2018-02-28 SG SG10202103227YA patent/SG10202103227YA/en unknown
- 2018-02-28 MA MA047694A patent/MA47694A/fr unknown
- 2018-02-28 BR BR112019017550-4A patent/BR112019017550A2/pt not_active Application Discontinuation
- 2018-02-28 CA CA3053486A patent/CA3053486A1/en active Pending
-
2019
- 2019-08-05 IL IL268517A patent/IL268517A/en unknown
- 2019-08-15 US US16/541,575 patent/US20200040082A1/en not_active Abandoned
- 2019-08-27 MX MX2023006212A patent/MX2023006212A/es unknown
-
2020
- 2020-10-28 US US17/082,586 patent/US20210269527A1/en not_active Abandoned
-
2022
- 2022-06-29 US US17/853,134 patent/US20230134375A1/en not_active Abandoned
- 2022-07-26 JP JP2022118823A patent/JP2022141910A/ja active Pending
-
2024
- 2024-01-10 AU AU2024200157A patent/AU2024200157A1/en not_active Abandoned
- 2024-02-26 JP JP2024026609A patent/JP2024057038A/ja active Pending
Patent Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20150216970A1 (en) * | 2013-07-16 | 2015-08-06 | Genentech, Inc. | Methods of treating cancer using pd-1 axis binding antagonists and tigit inhibitors |
| WO2015073682A1 (en) * | 2013-11-13 | 2015-05-21 | Oregon Health And Science University | Methods of detecting cells latently infected with hiv |
| WO2016106302A1 (en) * | 2014-12-23 | 2016-06-30 | Bristol-Myers Squibb Company | Antibodies to tigit |
| US20160376365A1 (en) * | 2015-05-28 | 2016-12-29 | Oncomed Pharmaceuticals, Inc. | Tigit-binding agents and uses thereof |
| WO2017030823A2 (en) * | 2015-08-14 | 2017-02-23 | Merck Sharp & Dohme Corp. | Anti-tigit antibodies |
Cited By (46)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10875924B2 (en) | 2014-10-23 | 2020-12-29 | Biogen Ma Inc. | Anti-GPIIB/IIIA antibodies and uses thereof |
| US20170342152A1 (en) * | 2014-10-31 | 2017-11-30 | Biogen Ma Inc. | ANTI-GLYCOPROTEIN IIb/IIIa ANTIBODIES |
| US11136384B2 (en) | 2016-11-30 | 2021-10-05 | Mereo Biopharma 5, Inc. | Methods for treatment of cancer comprising TIGIT-binding agents |
| US11230596B2 (en) | 2016-11-30 | 2022-01-25 | Mereo Biopharma 5, Inc. | Methods for treatment of cancer comprising TIGIT-binding agents |
| US20230190931A1 (en) * | 2017-07-27 | 2023-06-22 | iTeos Belgium SA | Anti-TIGIT Antibodies |
| WO2020041541A3 (en) * | 2018-08-23 | 2020-03-26 | Seattle Genetics, Inc. | Anti-tigit antibodies |
| US11401339B2 (en) | 2018-08-23 | 2022-08-02 | Seagen Inc. | Anti-TIGIT antibodies |
| US11376255B2 (en) | 2018-09-11 | 2022-07-05 | iTeos Belgium SA | Thiocarbamate derivatives as A2A inhibitors, pharmaceutical composition thereof and combinations with anticancer agents |
| EP4410375A2 (en) | 2018-09-11 | 2024-08-07 | iTeos Belgium SA | Thiocarbamate derivatives as a2a inhibitors, pharmaceutical composition thereof and combinations with anticancer agents |
| WO2020053263A1 (en) | 2018-09-11 | 2020-03-19 | Iteos Therapeutics S.A. | Thiocarbamate derivatives as a2a inhibitors, pharmaceutical composition thereof and combinations with anticancer agents |
| WO2020127377A1 (en) | 2018-12-21 | 2020-06-25 | Ose Immunotherapeutics | Bifunctional anti-pd-1/il-7 molecule |
| WO2020165374A1 (en) | 2019-02-14 | 2020-08-20 | Ose Immunotherapeutics | Bifunctional molecule comprising il-15ra |
| JP7297095B2 (ja) | 2019-06-13 | 2023-06-23 | グリーン クロス コーポレーション | Tigitに対する抗体及びその用途 |
| JP2022536026A (ja) * | 2019-06-13 | 2022-08-12 | グリーン クロス コーポレーション | Tigitに対する抗体及びその用途 |
| WO2020257760A1 (en) * | 2019-06-21 | 2020-12-24 | Single Cell Technology, Inc. | Anti-tigit antibodies |
| CN114729040A (zh) * | 2019-06-21 | 2022-07-08 | 单细胞技术股份有限公司 | 抗tigit抗体 |
| JP2022537053A (ja) * | 2019-06-21 | 2022-08-23 | シングル セル テクノロジー, インコーポレイテッド | 抗tigit抗体 |
| WO2021092196A1 (en) * | 2019-11-05 | 2021-05-14 | Merck Patent Gmbh | Anti-tigit antibodies and uses thereof |
| WO2021122866A1 (en) | 2019-12-17 | 2021-06-24 | Ose Immunotherapeutics | Bifunctional molecules comprising an il-7 variant |
| CN112409450A (zh) * | 2020-03-29 | 2021-02-26 | 郑州大学 | TIGIT-IgV的亲和剂及其应用 |
| CN112409450B (zh) * | 2020-03-29 | 2023-01-24 | 郑州大学 | TIGIT-IgV的亲和剂及其应用 |
| EP4700045A2 (en) | 2020-05-07 | 2026-02-25 | Institut Curie | Biomarkers of immunosuppressive fibroblast populations and their uses for predicting response to immunotherapy |
| WO2021224438A1 (en) | 2020-05-07 | 2021-11-11 | Institut Curie | Antxr1 as a biomarker of immunosuppressive fibroblast populations and its use for predicting response to immunotherapy |
| EP4148068A4 (en) * | 2020-05-09 | 2024-07-31 | Huabo Biopharm (Shanghai) Co., Ltd. | ANTI-TIGIT ANTIBODIES AND PRODUCTION PROCESSES AND USE THEREOF |
| AU2021273240B2 (en) * | 2020-05-09 | 2025-04-17 | Huabo Biopharm (Shanghai) Co., Ltd. | Anti-tigit antibody and preparation method and application thereof |
| US11820824B2 (en) | 2020-06-02 | 2023-11-21 | Arcus Biosciences, Inc. | Antibodies to TIGIT |
| US12415854B2 (en) | 2020-06-02 | 2025-09-16 | Arcus Biosciences, Inc. | Antibodies to TIGIT |
| WO2021258337A1 (en) * | 2020-06-24 | 2021-12-30 | Huahui Health Ltd. | Human monoclonal antibodies against tigit for immune related diseases |
| WO2022112198A1 (en) | 2020-11-24 | 2022-06-02 | Worldwide Innovative Network | Method to select the optimal immune checkpoint therapies |
| WO2022148781A1 (en) | 2021-01-05 | 2022-07-14 | Institut Curie | Combination of mcoln activators and immune checkpoint inhibitors |
| WO2022178135A1 (en) | 2021-02-17 | 2022-08-25 | Iteos Belguim Sa | Compounds, compositions and methods of treatment thereof |
| WO2022214652A1 (en) | 2021-04-09 | 2022-10-13 | Ose Immunotherapeutics | Scaffold for bifunctioanl molecules comprising pd-1 or cd28 and sirp binding domains |
| WO2022214653A1 (en) | 2021-04-09 | 2022-10-13 | Ose Immunotherapeutics | New scaffold for bifunctional molecules with improved properties |
| WO2023215719A1 (en) | 2022-05-02 | 2023-11-09 | Arcus Biosciences, Inc. | Anti-tigit antibodies and uses of the same |
| WO2024003360A1 (en) | 2022-07-01 | 2024-01-04 | Institut Curie | Biomarkers and uses thereof for the treatment of neuroblastoma |
| WO2024028386A1 (en) | 2022-08-02 | 2024-02-08 | Ose Immunotherapeutics | Multifunctional molecule directed against cd28 |
| WO2024200823A1 (en) | 2023-03-30 | 2024-10-03 | Ose Immunotherapeutics | Lipid-based nanoparticle targeted at activated immune cells for the expression of immune cell enhancing molecule and use thereof |
| WO2024200826A1 (en) | 2023-03-30 | 2024-10-03 | Ose Immunotherapeutics | Lipid-based nanoparticle targeted at activated immune cells for the expression of immune cell inhibiting molecule and use thereof |
| WO2024200820A1 (en) | 2023-03-30 | 2024-10-03 | Ose Immunotherapeutics | Method of synthesis of targeted lipid nanoparticle and uses thereof |
| WO2025068452A1 (en) | 2023-09-29 | 2025-04-03 | Negio Therapeutics | Guanfacine derivatives and their use in treating cancer |
| WO2025068461A1 (en) | 2023-09-29 | 2025-04-03 | Negio Therapeutics | Guanfacine derivatives and their use in treating cancer |
| WO2025132831A1 (en) | 2023-12-19 | 2025-06-26 | Universite D'aix-Marseille | N-heteroaryl derivatives and uses thereof for treating cancer |
| WO2025242835A1 (en) | 2024-05-22 | 2025-11-27 | Ose Immunotherapeutics | Molecules comprising masking linkers and uses thereof for the treatment of cancer |
| WO2025242836A1 (en) | 2024-05-22 | 2025-11-27 | Ose Immunotherapeutics | Molecules comprising masking linkers and uses thereof for the treatment of auto-immune or inflammatory diseases and disorders |
| WO2025262250A1 (en) | 2024-06-20 | 2025-12-26 | Negio Therapeutics | Guanfacine derivatives and their uses |
| WO2026068705A1 (en) | 2024-09-26 | 2026-04-02 | Ose Immunotherapeutics | Lipid-based nanoparticles comprising non-glycosylated fc domains and uses thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2022141910A (ja) | 2022-09-29 |
| SG10202103227YA (en) | 2021-04-29 |
| AU2018227489B2 (en) | 2023-10-19 |
| JP2024057038A (ja) | 2024-04-23 |
| CA3053486A1 (en) | 2018-09-07 |
| EP3589313A4 (en) | 2021-05-19 |
| MX2019010206A (es) | 2019-12-11 |
| AU2018227489A1 (en) | 2019-08-22 |
| MA47694A (fr) | 2021-05-19 |
| BR112019017550A2 (pt) | 2020-04-14 |
| JP2020510422A (ja) | 2020-04-09 |
| US20230134375A1 (en) | 2023-05-04 |
| AU2024200157A1 (en) | 2024-01-25 |
| KR20190123749A (ko) | 2019-11-01 |
| IL268517A (en) | 2019-09-26 |
| WO2018160704A9 (en) | 2019-10-17 |
| EP3589313A1 (en) | 2020-01-08 |
| MX2023006212A (es) | 2023-06-09 |
| US20210269527A1 (en) | 2021-09-02 |
| SG11201907278VA (en) | 2019-09-27 |
| CN111050788A (zh) | 2020-04-21 |
| US20200040082A1 (en) | 2020-02-06 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20230134375A1 (en) | Anti-TIGIT Antibodies | |
| JP7802101B2 (ja) | B7-h4抗体及びその使用方法 | |
| AU2019233581B2 (en) | Anti-CD25 for tumour specific cell depletion | |
| JP2023182854A (ja) | 抗tigit抗体 | |
| EP4347655A1 (en) | Anti-ccr8 antibodies and uses thereof | |
| CA3149853A1 (en) | Treatment and prevention of cancer using her3 antigen-binding molecules | |
| KR20190039421A (ko) | 항-tigit 항체, 항-pvrig 항체 및 이들의 조합 | |
| KR20190088480A (ko) | Pd-1에 대한 항체 및 그의 용도 | |
| KR20180030911A (ko) | Pd-1 길항제와 egfr 억제제의 조합물 | |
| KR20170068458A (ko) | 항-nkg2a 항체를 사용한 치료 요법 | |
| KR20240099138A (ko) | 항-cd161 항체 및 그의 용도 | |
| CN116059341A (zh) | 药物组合物及用途 | |
| US20260098093A1 (en) | Treatment and prevention of cancer using vista antigen-binding molecules | |
| KR20230158464A (ko) | 항-pd1 항체와 조합하여 항-tigit 항체를 사용하는암 치료 방법 | |
| TW202400660A (zh) | Cd3/bcma/cd38 三特異性抗體 | |
| WO2023046979A1 (en) | Treatment and prevention of cancer using vista antigen-binding molecules | |
| HK40028734A (zh) | 抗tigit抗體 | |
| CN114641500A (zh) | 使用抗ox40抗体与抗tim3抗体的组合治疗癌症的方法 | |
| RU2832673C2 (ru) | Антитела, направленные против ilt2, и их применение | |
| WO2026022350A1 (en) | Multispecific antigen-binding protein | |
| TW202448504A (zh) | Btn3a活化抗體及免疫檢查點抑制劑之組合 | |
| KR20240153397A (ko) | 항 cd73 항체 및 이의 사용 | |
| HK40107037A (zh) | 抗cd161抗体及其用途 | |
| HK40045433A (en) | Anti-tigit antibodies, anti-pvrig antibodies and combinations thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18760515 Country of ref document: EP Kind code of ref document: A1 |
|
| DPE1 | Request for preliminary examination filed after expiration of 19th month from priority date (pct application filed from 20040101) | ||
| ENP | Entry into the national phase |
Ref document number: 3053486 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2018227489 Country of ref document: AU Date of ref document: 20180228 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2019546327 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112019017550 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 20197027438 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2018760515 Country of ref document: EP Effective date: 20190930 |
|
| ENP | Entry into the national phase |
Ref document number: 112019017550 Country of ref document: BR Kind code of ref document: A2 Effective date: 20190822 |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: 756467 Country of ref document: NZ |