WO2018138709A1 - Blood-brain barrier transmigrating compounds and uses thereof - Google Patents

Blood-brain barrier transmigrating compounds and uses thereof Download PDF

Info

Publication number
WO2018138709A1
WO2018138709A1 PCT/IB2018/050576 IB2018050576W WO2018138709A1 WO 2018138709 A1 WO2018138709 A1 WO 2018138709A1 IB 2018050576 W IB2018050576 W IB 2018050576W WO 2018138709 A1 WO2018138709 A1 WO 2018138709A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
abp
fragment
antibody
sequence
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/IB2018/050576
Other languages
English (en)
French (fr)
Inventor
Balu Chakravarthy
Danica Stanimirovic
Yves Durocher
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
National Research Council of Canada
Original Assignee
National Research Council of Canada
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by National Research Council of Canada filed Critical National Research Council of Canada
Priority to AU2018212860A priority Critical patent/AU2018212860A1/en
Priority to KR1020247019801A priority patent/KR20240095466A/ko
Priority to JP2019541280A priority patent/JP7449092B2/ja
Priority to CN201880015949.5A priority patent/CN110382522B/zh
Priority to EP18745446.7A priority patent/EP3574002A4/en
Priority to CA3052058A priority patent/CA3052058A1/en
Priority to US16/481,898 priority patent/US11702466B2/en
Priority to KR1020197025302A priority patent/KR102676279B1/ko
Priority to CN201880091218.9A priority patent/CN111886240A/zh
Priority to US16/965,885 priority patent/US20230257424A1/en
Priority to KR1020207025008A priority patent/KR20200116143A/ko
Priority to CA3089816A priority patent/CA3089816A1/en
Priority to AU2018405992A priority patent/AU2018405992A1/en
Priority to EP18904229.4A priority patent/EP3746460A4/en
Priority to PCT/IB2018/055747 priority patent/WO2019150183A1/en
Priority to JP2020561952A priority patent/JP7458327B2/ja
Publication of WO2018138709A1 publication Critical patent/WO2018138709A1/en
Anticipated expiration legal-status Critical
Priority to AU2022202015A priority patent/AU2022202015B2/en
Priority to US18/183,812 priority patent/US20230279088A1/en
Priority to JP2023094278A priority patent/JP2023123535A/ja
Priority to JP2024031648A priority patent/JP2024081644A/ja
Priority to AU2024201813A priority patent/AU2024201813A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0019Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/001Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof by chemical synthesis
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4711Alzheimer's disease; Amyloid plaque core protein
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/12Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from bacteria
    • C07K16/1267Gram-positive bacteria
    • C07K16/1282Clostridium (G)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2863Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/569Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94Stability, e.g. half-life, pH, temperature or enzyme-resistance
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/10Fusion polypeptide containing a localisation/targetting motif containing a tag for extracellular membrane crossing, e.g. TAT or VP22
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/33Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/70Fusion polypeptide containing domain for protein-protein interaction

Definitions

  • the present invention relates to compounds that transmigrate the blood-brain barrier, and uses thereof. More specifically, the present invention relates to compounds that may comprise an antibody or fragment thereof that crosses the blood-brain barrier, an immunoglobulin Fc domain or fragment thereof, and a polypeptide binding to beta-amyloid, fusion proteins and compositions thereof and their use in the treatment of Alzheimer's disease.
  • AD Alzheimer's disease
  • AD is an irreversible neurodegenerative disorder affecting approximately 15% of the population over 65 years of age and is the predominant cause of progressive intellectual and cognitive failure in the ageing population (Hardy et al, 2014).
  • AD Alzheimer's disease
  • ACh acetylcholine
  • excitotoxicity induced by neurotransmitter glutamate is also implicated in the pathogenesis of AD. Therefore, cholinergic augmentation and/or inhibition of glutamate toxicity might improve cognition in AD.
  • AD acetylcholine esterase
  • Alzheimer's disease is the accumulation of a 39-43 amino acid peptide ⁇ - amyloid ( ⁇ ) in the brain in the form of aggregates and plaques.
  • particularly its oligomeric aggregates, plays a central role in the development of AD pathology (Hardy et al, 2014; DeLaGarza, 2003; Selkoe and Hardy, 2016).
  • ⁇ aggregates are believed to initiate a cascade of events leading to synaptic loss and neuronal functions, leading to a progressive loss of memory and other cognitive functions (Hardy et al, 2014; DeLaGarza, 2003; Selkoe and Hardy, 2016; Sengupta et al, 2016).
  • from its precursor protein APP is achieved by the sequential proteolysis of APP by proteases ⁇ and ⁇ secretases (Barageb and Sonawane, 2015). Inhibitors of these enzymes have been shown to reduce ⁇ production and are being developed as potential drugs for treating AD (Hardy et al, 2014; Mangialasche et al, 2010; Selkoe and Hardy, 2016; Ji and Ha, 2010). Similarly, agents that sequester and/or promote ⁇ clearance are also being developed. Notable among these are the development of immunotherapies with AD vaccine.
  • Immunotherapeutic approaches such as active ( ⁇ vaccine, AN1792) and passive immunization (e.g., Bapineuzumab, Solanezumab, Crenezumab, aducanumab etc) have been shown to be quite effective in reducing ⁇ deposition and partial elimination of memory deficits in transgenic animals (Monsonego and Weiner, 2003; Bard et al, 2000, Sevigny J et al., 2016).
  • active and passive immunization e.g., Bapineuzumab, Solanezumab, Crenezumab, aducanumab etc
  • Several clinical trials using both active and passive immunization have shown reduction in brain ⁇ deposition with moderate improvement in cognition. However, clinical trials had to be abandoned due to severe inflammatory reactions (meningo-encephalitic presentation), vasogenic edema, and micro-haemorrhages in AD patients.
  • BBB blood-brain barrier
  • the present invention relates to compounds or compositions that transmigrate the blood-brain barrier, and uses thereof.
  • the present invention provides polypeptides which binds beta-amyloid ( ⁇ -amyloid).
  • the polypeptides (or proteins) that bind ⁇ -amyloid may selectively bind pathologically relevant ⁇ - amyloid ( ⁇ ) aggregates, and may be abbreviated and referred to herein as ABP or ABP variants.
  • the present invention provides fusion proteins (also referred to herein as compounds, compositions or constructs) comprising a beta-amyloid ( ⁇ -amyloid) binding polypeptide (ABP or ABP variant) linked to an antibody or fragment thereof that crosses the blood-brain barrier (BBB), wherein BBB herein refers to an abbreviation for the carrier antibody or fragment that transmigrates the blood brain barrier.
  • BBB blood-brain barrier
  • the fusion protein comprising an ABP or ABP variant and a BBB carrier, or fragment thereof, wherein the ABP and BBB components of the fusion protein may be linked via an Fc region or portion thereof.
  • the fusion protein comprising an ABP or ABP variant and a BBB further comprises an immunoglobumin protein effector domain, known as Fc, or fragment thereof, wherein the ABP and BBB components of the fusion protein may be linked via the Fc region or portion thereof.
  • a construct of the present invention may further comprise a linker (L), wherein L is a small linking peptide or peptide-like chain.
  • the BBB-Fc-L-ABP construct provided may be a single chain polypeptide or a dimeric polypeptide, wherein the single chain polypeptide comprising BBB-Fc-L-ABP may form a dimer by Fc dimerization.
  • a construct of the present invention may comprise BBB-Fc-ABP.
  • the BBB-Fc-ABP construct provided may be a single chain polypeptide (monovalent) or a dimeric polypeptide (bivalent), wherein the single chain polypeptide comprising BBB-Fc-ABP may form a dimer through Fc which allows the dimerization of the fusion protein.
  • a compound of the present invention may be referred to as a fusion protein, construct, fusion molecule, formulation or composition.
  • the compounds of the present invention may be used in the treatment of Alzheimer's disease (AD).
  • AD Alzheimer's disease
  • the polypeptide that binds ⁇ -amyloid may comprise a sequence selected from the group consisting of: SGKTEYMAFPKPFESSSSIGAEKPRNKKLPEEEVESSRTPWLYEQEGEVEKPFIKTGFS VSVEKSTSSNRKNQLDTNGRRRQFDEESLESFSSMPDPVDPTTVTKTFKTRKASAQAS LASKDKTPKSKSKKRNSTQLKSRVKNITHARRILQQSNRNACNEAPETGSDFSMFEA
  • the ABP may comprise a sequence selected from any one of: KTFKTRKASAQASLASKDKTPKSKSKKRGSTQLKSRVKNI (SEQ ID NO:32);
  • KTF KTRKAS AQ AS LAS KD KTP KS KS KKRG SEQ ID NO:38; and a sequence substantially identical to any of the above sequences.
  • the polypeptide that binds ⁇ -amyloid (ABP) variant may comprise a polypeptide sequence selected from the group consisting of SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, and SEQ ID NO: 38.
  • An ABP comprising a polypeptide sequence selected from the group consisting of SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, and SEQ ID NO: 38 may be referred to as an ABP or ABP variant.
  • the present invention additionally comprises an ABP variant sequence having consensus sequence SEQ ID NO: 31 , and may be for example SEQ ID NO: 35, or SEQ ID NO: 36, or any equivalent ⁇ stable polypeptide sequence.
  • An equivalents stable polypeptide sequence exhibits peptide stability during expression and production of fusion protein in mammalian expression system.
  • an ABP variant of the present invention may exhibit improved peptide stability over ABP peptides of the prior art (Ref. WO2006/133566).
  • the present invention provides an isolated polypeptide that binds ⁇ -amyloid
  • the isolated polypeptide that binds ⁇ -amyloid may comprise a sequence selected from the group consisting of SEQ ID NO: 31 , SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, and SEQ ID NO: 38, or a sequence comprising an equivalently stable polypeptide sequence.
  • the present invention provides a fusion protein comprising an ABP or ABP variant selected from the group consisting of SEQ ID NO: 31 , SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, and SEQ ID NO: 38.
  • the ABP variant may comprise the sequence KTFKTGGASAQASLASKDKTPKSKSKKRGSTQLKSRVKNI (SEQ ID NO:35); GTFGTGGASAQASLASKDKTPKSKSKKGGSTQLKSRVKNI (SEQ ID NO:36).
  • a fusion protein of the present invention may comprise an antibody, or fragment thereof, that transmigrates across the blood brain barrier (BBB) (as noted above, BBB is an abbreviation of the antibody carrier that transmigrates the blood brain barrier).
  • BBB blood brain barrier
  • the antibody, or fragment thereof, (BBB) may bind surface receptor epitopes on brain endothelial cell that allow for transmigration across the blood brain barrier.
  • surface receptor epitopes may be TMEM30A or an Insulin-Like Growth Factor 1 Receptor (IGF1 R) epitope, or isoforms, variants, portions, or fragments thereof.
  • the antibody, or fragment thereof may comprise a sequence selected from the group consisting of: an antibody or fragment thereof comprising a complementarity determining region (CDR) 1 sequence of GFKITHYTMG (SEQ ID NO:1), a CDR2 sequence of RITWGGDNTFYSNSVKG (SEQ ID NO:2), a CDR3 sequence of GSTSTATPLRVDY
  • CDR complementarity determining region
  • the antibody or fragment thereof may comprise a sequence selected from the group consisting of:
  • X 15 is A or S;
  • X 2 is K or Q;
  • X 3 is V or E;
  • X 4 is A or P;
  • X 5 is A or E;
  • X 6 is V or A;
  • X 7 is V or F;
  • X 8 is G or E;
  • X 9 is L or R;
  • X 10 is F or W;
  • X is G or S;
  • X 12 is V or Y;
  • X 13 is D or G;
  • X 14 is N or S;
  • X 15 is A or S;
  • X 2 is K or Q
  • X 3 is V or E
  • X 4 is A or P
  • X 5 is V or S
  • X 6 is D or G
  • X 7 is L or R
  • X 8 is F or W
  • X 9 is A or S
  • X 10 is A or T
  • X is A or S
  • X 12 is G or N
  • X 13 is M or L
  • X 14 is N or R
  • X 15 is E or R
  • X 16 is P or A
  • X 17 is S or Y
  • X 18 is Q or L.
  • the antibody, or fragment thereof may comprise a sequence selected from any one of: DVQLQASGGGLVQAGGSLRLSCAASGFKITHYTMGWFRQAPGKEREFVSRITWGGD NTFYSNSVKGRFTISRDNAKNTVYLQMNSLKPEDTADYYCAAGSTSTATPLRVDYWG KGTQVTVSS (SEQ ID NO:14); EVQLVESGGGLVQPGGSLRLSCAASGFKITHYTMGWVRQAPGKGLEWVSRITWGGD NTFYSNSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAAGSTSTATPLRVDYWG QGTLVTVSS (SEQ ID NO: 15)
  • the BBB may be an antibody, or fragment thereof, in a preferred embodiment, the BBB may be a single-domain antibody (sdAb).
  • the sdAb may be humanized.
  • the antibody or fragment thereof (BBB) may be linked to an Fc, or fragment thereof, wherein the BBB-Fc construct may form a dimer.
  • the invention further provides a fusion peptide comprising BBB-Fc-L-ABP, wherein the BBB-Fc portion of the fusion peptide is linked to the ABP via a short peptidic linker (for example a linker having less than 12 amino acids) and the Fc or Fc fragment allows for the dimerization of said fusion peptides to provide dimers, which accordingly protects the construct from degradation and increases its serum half-life.
  • the Fc fragment may be any suitable Fc fragment, selected in order to impart desirable pharmacokinetics, in which the Fc or Fc fragment contributes to the long half-life of the fusion molecule.
  • Fc or Fc fragment embodiments may modulate, modify or suppress an immunological effector function (Shields et al., 2001).
  • Other highly preferred Fc fragment embodiments may mediate clearance of the fusion peptide from the brain (Caram- Salas N, 201 1).
  • Fc or Fc fragments may be Fc mouse Fc2a, or a human Fc1 , selected from any one of SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41 , and a sequence substantially identical thereto with attenuated effector function, which, when included in said fusion peptide, may have enhanced clearance of amyloid from the brain.
  • the BBB may be linked to the ABP via an Fc fragment, and/or any additional suitable linker L.
  • a compound of the present invention comprises a fusion protein; wherein the fusion protein comprises an antibody or fragment thereof, an Fc fragment, and the polypeptide that binds ⁇ - amyloid.
  • the fusion protein may comprise an antibody or fragment thereof linked to the N- terminus of Fc fragment, and the polypeptide that binds ⁇ -amyloid is linked to the C-terminus of the Fc fragment via L, a linking peptide or a chemical linker.
  • the antibody or fragment thereof may be linked to the C-terminus of Fc fragment and the polypeptide that binds ⁇ - amyloid linked to the N-terminus of the Fc fragment.
  • the present invention provides fusion proteins comprising an antibody or fragment thereof selected from the group consisting of SEQ ID NO:13 to SEQ ID NO: 26 ; a polypeptide that binds b-amyloid selected from the group consisting of SEQ ID NO: 27 to SEQ ID NO:38 ; and an Fc fragment selected from the group consisting of SEQ ID No: 39 to SEQ ID NO:41 .
  • the provided Fc may comprise an Fc with attenuated effector functions.
  • the fusion protein may comprise SEQ ID NOs: 42 to SEQ ID NO:52, or a sequence substantially identical thereto.
  • the fusion protein may be a single chain polypeptide, and the single chain polypeptide of the fusion protein may for a dimeric polypeptide.
  • the (GGGSGGGGS or GGGGSGGGGS) linker provided in the fusion protein comprised in SEQ ID NO: 42 to SEQ ID NO: 52 may be any suitable linker sequence.
  • the linker sequence highlighted (ex. GGGSGGGGS) may be any equivalent peptide linking sequence that allows for the linking of the components of the fusion protein provided, as exemplified in SEQ ID NO: 53, wherein the linker may be any peptide or chemical linker.
  • the BBB may be linked to an Fc fragment, thus forming a dimer.
  • the Fc fragment may be any suitable Fc fragment, for example mouse Fc2a or human Fc1 , with attenuated effector function (Shields et al., 2001 ).
  • An ABP variant of the present invention may comprise SEQ ID NO: 31 , for example, may be a sequence selected from any one of SEQ ID NO: 32 to 38.
  • An ABP variant as provided herein exhibits unexpected and significant advantages over ABP polypeptides of the prior art. More specifically, the present ABP variants exhibit increased stability and bio-manufacturability.
  • a compound or composition of the present invention comprising an ABP or variant, as provided herein, when coupled to BBB, via a linker and/or Fc fragment as provided herein, exhibits a synergistic and unexpected efficacy in transmigrating the blood brain barrier.
  • Such an ABP variant when coupled to BBB, via a selected Fc fragment as provided herein, provides an unexpected, rapid and improved clearance of ⁇ from the brain.
  • a fusion protein of the present invention comprising an ABP or ABP variant as provided herein exhibits a synergistic and unexpected efficacy in transmigrating the BBB and improved clearance of ⁇ from the brain.
  • a therapeutic composition comprising a blood brain barrier transmigrating antibody or fragment thereof (BBB), an Fc (Fc), linked to a polypeptide that binds ⁇ -amyloid (ABP or ABP variant), wherein said polypeptide confers a synergistic increase in stability and efficacy of the therapeutic composition provided.
  • BBB blood brain barrier transmigrating antibody or fragment thereof
  • Fc Fc
  • ABP ⁇ -amyloid
  • this fusion protein comprising Fc provided a substantially longer serum half-life compared to free ABP or BBB-ABP (WO 2006/133566), thereby providing an improved therapeutic compound.
  • the ABP variants of the present invention, and fusion proteins (constructs) comprising ABP overcome the disadvantages of the prior art.
  • the linking of ABP with a BBB carrier WO 2006/133566) alone does not assure the generation of an effective molecule.
  • Fusions comprising an Fc aimed at enhancing serum half-life do not ensure efficient transport of ABP across the blood brain barrier.
  • Specific engineering and formulation of a fusion molecule comprising a BBB carrier-, Fc fragment- and ABP provide an efficient BBB- permeable therapeutic compound.
  • the efficient blood brain barrier-permeable therapeutic compound comprises a specifically engineered formulation of a BBB-Fc-ABP, wherein the formulation exhibits a synergistic improvement in compound stability and efficacy.
  • the compound provided herein may be referred to as a compound, a fusion protein, formulation, composition or construct.
  • the provided construct may comprise an antibody or fragment thereof (which may be abbreviated BBB), an Fc fragment (abbreviated Fc), and a polypeptide that binds ⁇ -amyloid (abbreviated ABP).
  • BBB-Fc-ABP or BBB-Fc-L-ABP comprises components that synergistically overcome the deficiencies encountered in the prior art with respect to blood brain barrier transmigration, efficacy and compound stability. Accordingly, compounds provided herein comprise a novel formulation having superior and unexpected efficacy in transmigrating the blood brain barrier, therapeutic efficacy and compound stability.
  • Fc fusions may increase serum half-life, although serum half-life is not necessarily increased in Fc fusions. Moreover, Fc fusions do not necessarily improve transmigration across the blood brain barrier.
  • the present invention provides a polypeptide that binds ⁇ -amyloid
  • the polypeptide sequence may be selected from the group consisting of SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31 , SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, and SEQ ID NO: 38 and a sequence substantially identical in peptide stability.
  • ABP variant sequence may comprise SEQ ID NO: 31 , and may be selected from the group consisting of SEQ ID NO: 31 , SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, and sequence substantially identical in peptide stability, for example, any sequence variant of SEQ ID NO:31 .
  • An ABP variant having SEQ ID NO: 31 of the present invention overcomes the disadvantages of the prior art with respect to polypeptide stability.
  • a compound comprising an ABP of the present invention exhibits improved compound stability and bio-manufacturability.
  • a compound comprising an ABP or ABP variant as provided herein exhibits a synergistic and unexpected therapeutic improvement.
  • An ABP variant of the present invention may comprise a sequence selected from any one of SEQ ID NO: 31 to SEQ ID NO: 38, and an equivalent ⁇ stable polypeptide sequence.
  • An ABP variant of the present invention is superior over ABP sequences of the prior art, wherein the present ABP variant polypeptides exhibit improved stability (as shown in comparison between Fig. 2A and Fig 16).
  • the present invention also provides fusion proteins (also referred to as compounds, constructs, or fusion molecules) comprising an ABP, or ABP variant, of the present invention.
  • the fusion protein may comprise an Fc fragment.
  • the fusion protein may comprise an antibody or fragment thereof that transmigrates the blood brain barrier, an Fc fragment, and a ⁇ -amyloid binding polypeptide sequence that may be selected from the group consisting of SEQ ID NO: 31 , SEQ ID NO: 32-38.
  • the provided BBB-Fc-ABP formulations exhibit synergistic improvement in compound stability and therapeutic efficacy in removing toxic amyloid from the brain.
  • the fusion protein or construct which may be referred to herein as BBB-Fc-ABP, may vary in orientations with respect to the components comprised therein.
  • the fusion protein forms a dimer (as shown in Fig .1 ) wherein the fusion peptide dimerizes via the Fc region.
  • the provided compound may comprise a fusion protein comprising a BBB linked to the N-terminus of the Fc fragment (Fc) and an ABP or ABP variant (ABP) linked to the C-terminus of the Fc fragment via a short peptidic linker attached to the C-terminus (Fig 1 A, wherein the compound is shown as a dimer of the fusion protein).
  • the provided compound may comprise a BBB linked to the C-terminus of the Fc fragment (Fc) wherein the ABP or ABP variant (ABP) may be linked to the N-terminus of the Fc fragment via a suitable linker (L) (Fig 1 B).
  • the ABP or ABP variant may be N-terminally (fusion) or C-terminally (chemical linking) fused/linked to Fc.
  • the BBB may be linked to the N-terminus of the ABP, and the ABP linked to the N-terminus of the Fc fragment (Fig 1 C).
  • the BBB may be linked to the C-terminus of the ABP, and the ABP is linked to the C-terminus of the Fc fragment (Fig 1 D).
  • the compounds provided herein comprise fusion proteins comprising a sequence selected from any one of SEQ ID NO:42 SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO: 45, SEQ ID NO:46, SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO:49, SEQ ID NO:50, SEQ ID NO:51 , SEQ ID NO:52, SEQ ID NO: 53 and a sequence substantially identical to any of these sequences.
  • the fusion protein of the present is a fusion protein (BBB-Fc-ABP or BBB-Fc-L-ABP, wherein L may be any suitable linker) dimer (as shown in Fig 1 , and preferably, Fig 1A or 1 B)".
  • the compound or fusion protein provided may comprise a polypeptide comprising sequence SEQ ID NO:35 (ABP-GG-G) or SEQ ID NO:36 (ABP-6G); an antibody or fragment thereof comprising sequence SEQ ID NO:17 (FC5-H3); and an Fc fragment comprising sequence SEQ ID NO:40 (hFc1 X7).
  • the compound may comprise sequence SEQ ID NO:46 [FC5-H3-hFc1 X7-L-ABP(GG-G)] or SEQ ID NO:47 [FC5-H3- hFc1 X7-L-ABP(6G)], wherein the L may be any suitable linker.
  • the compounds of the present invention transmigrate the blood-brain barrier.
  • the present invention encompasses a nucleic acid molecule encoding any compound of the present invention as described herein.
  • Vectors comprising the nucleic acid molecule of a fusion protein or compound of the present invention are also included in the scope of the present invention.
  • the present invention encompasses a composition comprising a compound or fusion protein of the present invention and a pharmaceutically-acceptable carrier, diluent, or excipient.
  • Kits comprising a pharmaceutical composition of the present invention are also included in the scope of the present invention.
  • composition of the present invention may be used for treating Alzheimer's disease in a patient.
  • composition of the present invention may be used for reducing toxic ⁇ -amyloid ( ⁇ ) levels in the brain or CSF of a subject having increased levels of brain ⁇ .
  • the present invention provides a method of treating Alzheimer's disease, wherein a pharmaceutical composition of the present invention may be administered to a subject in need thereof.
  • the present invention provides a method of reducing toxic ⁇ -amyloid ( ⁇ ) levels in the brain of a subject having increased levels of brain ⁇ .
  • the method of the present invention comprises the administration of a compound of the present invention to a patient with AD. More specifically, the present method comprises the steps of repeated parenteral administration of a sufficient amount of a pharmaceutical composition of the present invention to a subject.
  • parenteral administration is subcutaneous or intravenous administration.
  • the method of the present invention reduces toxic ⁇ -amyloid levels, after repeated parenteral administration of a composition provided herein, in the brains of subjects having increased brain levels of ⁇ . More specifically, toxic ⁇ -amyloid levels are reduced within four weeks of repeated parenteral administration of the composition of the present invention.
  • the method of the present invention reduces toxic ⁇ -amyloid levels in the cerebrospinal fluid (CSF) of subjects after parenteral administration of the composition of the present invention. More specifically, toxic ⁇ -amyloid levels in the cerebrospinal fluid (CSF) of subjects is significantly reduced within 24 hours of a single parenteral administration of the composition of the present invention; wherein significant reduction is up to 50% within 24 hours.
  • the present invention provides a blood brain barrier-permeable single domain antibody (sdAb), wherein the sdAb is either camelid FC5 or a humanized version thereof.
  • sdAb blood brain barrier-permeable single domain antibody
  • FC5 displayed in bivalent format on Fc has been shown to have improved blood brain barrier-crossing properties compared to FC5 in V H H format (Farrington et al., 2014).
  • the present invention provides a compound comprising a BBB that facilitates blood brain barrier transmigration in vitro and an Fc fragment and increases serum half-life of the fusion molecule, wherein serum half-life of the Fc fusion becomes similar to that of a full IgG.
  • Prolonged serum half-life of FC5-Fc-ABP also increases overall brain exposure, which is particularly important for treating chronic diseases such as Alzheimer's Disease.
  • FC5-Fc-ABP fusion molecule as well as a humanized version FC5(H3)-hFc-ABP, and IGF1 R5-H2-ABP fusion molecules were produced in CHO cells.
  • the ABP variants of the present invention as provided in SEQ ID NO: 31 , are methodically re-engineered with specific point-mutations or deletions that enhance bio-manufacturability and stability of the fusion molecule (SEQ ID NO. 45, SEQ ID NO. 46; SEQ ID NO. 47, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO: 51 , SEQ ID NO: 52, SEQ ID NO: 53).
  • the fusion molecules of the present invention comprising the ABP variants not only retain ⁇ binding ability, the provided fusion molecules comprising the ABP variants not only penetrate the blood brain barrier, but advantageously allow for the clearance of ⁇ from the brain, for example, the rapid clearance of ⁇ from the brain within 24 hours of administration.
  • the ABP variants of the present invention were specifically engineered to enhance stability and manufacturability of the construct (as shown in FIG. 16).
  • the enhanced stability and bio- manufacturability of the construct of the present invention is significant in the present art.
  • the present invention accordingly encompasses ABP and ABP variants that enhance stability and bio-manufacturability of the fusion molecules provided, but also retain therapeutic activity (as provided in FIG. 15A).
  • the fusion molecules comprising different ABP variants as provided in SEQ ID NO:31 , such as in SEQ ID NOs: 32-38 retain the ⁇ oligomer binding ability of the parent ABP in vitro (Figs. 2B.2C, 12 and 15 A,B and C) as well as the BBB-penetrating property of the parent FC5 both in vitro and in vivo (Figs. 4, 5A, 6, 7, 17A, 17B, 18 and 19).
  • the ABP is transported across the BBB by the carrier, for example FC5, in vitro and in vivo, as established by its presence in the rat and dog CSF (Figs. 5 and 6).
  • the ABP fusion was also transported and delivered to the target regions in the brain, such as hippocampus and cortex in both wild type and AD transgenic mice (Fig. 8 and 19).
  • the brain-delivered ABP also promoted ⁇ clearance in the CSF (Figs. 9C and 1 1A and 1 1 B) and in cortical and hippocampal regions of AD transgenic mice and rat (Figs. 9B and 1 1 C).
  • ⁇ clearance in rat AD model correlated with enhanced hippocampal volume and neuronal connectivity (Fig. 12A and 12B) indicating desired pharmacological/physiological response to treatment.
  • a single bolus of BBB-Fc-ABP reduced brain ⁇ burden by 50% within 24 hrs of treatment (Fig 9B) compared to three months of multiple treatments with free ABP to achieve similar results in animals (Fig 9A).
  • the BBB-enabled ABP was shown to be far more potent than free ABP in reducing brain ⁇ burden.
  • this compound has a substantially longer serum half-life compared to free- or FC5- ABP, an essential characteristic of a better therapeutic, due to its fusion with Fc (Fig 10).
  • FC5 have relatively lower affinity towards their respective receptors and thus are likely cleared from the brain faster, and accordingly facilitate faster clearance of ABP-bound ⁇ .
  • the fusion molecule of the present invention likely employs faster perivascular drainage pathway for ⁇ clearance. This is supported by a nearly 50% reduction in CNS ⁇ within 24 hr of treatment compared to free ABP (Fig 9B) and antibody-based therapeutics, which require months of treatment with repeated multiple doses to achieve similar results.
  • the present compound is less likely to elicit neuro-inflammatory response compared to antibody-based therapeutics.
  • Fig 1 shows schematic drawings of a blood brain barrier-crossing, amyloid-binding fusion protein.
  • the fusion protein comprises a BBB-crossing single-domain antibody (BBB or BBB carrier), an Fc fragment (Fc) and an amyloid-binding peptide (ABP).
  • BBB BBB-crossing single-domain antibody
  • Fc Fc
  • ABP amyloid-binding peptide
  • Fig 2 shows the production of FC5-mFc-ABP and humanized FC5(H3)-hFc-ABP (ABP SEQ ID NO: 32) fusion molecule in CHO cells.
  • FIG. 2A a Coomassie blue stained gel after separation of FC5 fusion molecules by SDS-PAGE (NR- non-reducing and R- reducing conditions) showing successful production of recombinant fusion molecule.
  • FIG. 2B and FIG. 2C ⁇ -oligomer binding of free ABP and BBB-Fc-ABP fusion protein by ELISA and Western blot (WB) Overlay assay. Free or fused ABP was immobilized on ELISA plate and exposed to AB.
  • Bound AB was detected with AB-specific antibody 6E10 or 4G8.
  • the fusion molecules were also separated by SDS-PAGE, transferred to PVDF paper and exposed to AB.
  • Bound AB was detected with specific antibody as above. Results show that ABP retained its AB oligomer binding ability after fusion with the BBB carrier.
  • Mo AB monomers; ON: AB Oligomers
  • Fig 3 shows an immunohistofluorescence assay of the binding of FC5-Fc-ABP to amyloid deposits in AD- Tg mice (B6.Cg-Tg, Jackson Lab).
  • ABP retains the ability to bind naturally produced AB aggregates in AD-Tg mouse brain as shown by immunohistofluorescence assay.
  • Brain sections from wild type and AD-transgenic mice were incubated with IR 800-labelled FC5-mFc-ABP and the bound fusion molecule was visualized under fluorescence microscope. Selective binding (bright spots) were seen in brain sections from AD-Tg mice that produce ⁇ deposits and not in brain sections from wild type mice that does not produce amyloid deposits.
  • Fig 4 shows BBB permeability of FC5 is retained after fusion with ABP in vitro.
  • Blood brain barrier crossing of FC5-ABP fusion molecules was assessed in in vitro BBB models from rat and human. Fusion molecules crossing BBB were detected by nanoLC-MRM method (FIG. 4A, FIG. 4B and FIG. 4C) and by Western blot analysis using Fc-specific antibody (FIG. 4D, done in triplicate).
  • FC5-mFc-ABP crossed the BBB as effectively as FC5-mFc, whereas Fc- ABP without the BBB carrier moiety FC5 did not traverse across the brain endothelial cell monolayer.
  • control single domain antibodies EG2 and A20.1 , or control full IgG (anti-HEL) did not cross the blood brain barrier. Similar results were obtained with humanized FC5-H3-hFc-ABP fusion protein (FIG. 4C and FIG. 4D).
  • Fig 5 shows serum and CSF pharmacokinetics of FC5-Fc-ABP in vivo.
  • FC5-mFc-ABP was administered intravenously into rats via tail vein injection at the indicated doses (2.5, 6.25, 12.5, and 25 mg/kg). Serum and CSF were serially collected. FC5-Fc-ABP levels were quantified using nanoLC- MRM method. As shown in Fig 5, FC5-mFc-ABP appeared in the CSF in a time- and dose-dependent manner with Cmax between 12 and 24 h, indicating transport of ABP by FC5 into brain and CSF compartments in vivo. Serum PK parameters (FIG.
  • FC5-mFc-ABP shows serum and CSF PK profile of FC5-mFc-ABP in beagle dog.
  • FC5-mFc-ABP was administered by intravenous injection to 10-12-year old beagle dogs and serum and CSF were serially collected and analyzed by nanoLC-MRM (FIG. 6A) and by Western blot using Fc- specific antibody (FIG. 6B).
  • Asterisks indicates blood-contaminated sample (not shown in MRM analyses).
  • FC5-mFc-ABP appeared in the CSF in a time-dependent manner indicating transport of ABP by FC5 across dog blood brain barrier in vivo.
  • the PK parameters and CSF exposure were analyzed by WinNonlin software and are shown in Table 2 below.
  • Fig 7 shows BBB permeability and CSF appearance of FC5 fused with human Fc (hFc) and chemically linked to ABP (FC5-hFc-ABP) in vivo (rat model).
  • FC5-hFc was linked with ABP- cystamide using a heterobifunctional cross-linker sulfo-SMCC (sulfosuccinimidyl 4-[N- maleimidomethyl] cyclohexane-1 -carboxylate) according manufacturer's instructions (ThermoFisher Scientific).
  • sulfo-SMCC sulfosuccinimidyl 4-[N- maleimidomethyl] cyclohexane-1 -carboxylate
  • FC5-hFc-ABP appears in the CSF in a time-dependent manner in contrast to Fc-ABP without the BBB carrier.
  • C-terminus of ABP is linked to Fc fragment (random region) and N-terminus is free, unlike in the fusion construct, wherein it is N-terminus of ABP that is fused to C-terminus of Fc and C-terminus of ABP is free. This reversal in the orientation of ABP did not affect its ⁇ -binding ability and transport across the blood brain barrier.
  • Fig. 8 shows levels of FC5-mFc-ABP measured in various brain regions (cortex and hippocampus) after intravenous injection in mice. 15mg/kg dose of FC5-mFc-ABP was injected intravenously into the tail vein of either wild type (WT) or AD-transgenic (AD-Tg, B6.Cg-Tg, Jackson Lab) mice and brains were collected at 4 and 24 hrs after intra-cardiac saline perfusion. Hippocampal and cortical tissues were dissected and analyzed by nanoLC-MRM (FIG. 8A) and by Western blot using Fc-specific antibodies (FIG. 8B).
  • FC5-mFc-ABP Specific peptides belonging to all the three components of the fusion molecule (BBB, in this example FC5, Fc and ABP) were detected by MRM in both cortex and hippocampus, indicating that FC5 carrier successfully delivered ABP to the target areas of the brain. Measured levels ranged between 750-1400 ng/g brain tissue at different time points, compared to ⁇ 50 ng/g tissue typically measured for control single-domain antibody A20.1 fused to Fc, or Fc fragment alone. This was further confirmed by Western blot analysis probing for Fc and ABP in tissue extracts (FIG. 8B). No protein signal of the fusion molecule was detected in animals receiving just saline by Western blot. There was a dose-dependent increase in FC5-mFc-ABP levels detected by Western blot in the target regions of the brain.
  • Fig 9 shows the effect of ABP on ⁇ levels in transgenic (Tg) mice: Comparison between treatment with ABP alone (FIG. 9A) or ABP fused with BBB carrier FC5 (FIG. 9B and FIG. 9C).
  • mice were dosed subcutaneously (sc) with 300 nmol/kg of free ABP every second day over a 3-month or a 2-month period, respectively.
  • sc subcutaneously
  • ⁇ levels in the brain were measured by ELISA.
  • the treatment with ABP alone resulted in 25-50% reduction in brain ⁇ after 2-3 months of multiple treatments (every second day) (FIG. 9A).
  • FC5-mFc-ABP construct was injected intravenously into double- transgenic AD mice (B6.Cg-Tg ,15 mg/kg; equivalent of 220 nmol/kg) and brain ⁇ levels were measured by both ELISA and nanoLC-MRM 24 h after injection.
  • FC5-mFc-ABP FIG. 9B
  • CSF analysis also indicated a significant decrease in ⁇ . ⁇ levels within 24 hrs following FC5-mFc-ABP treatment (FIG. 9C).
  • Fig 10 shows an example of enhanced serum half- life of FC5-Fc-ABP construct compared to FC5-ABP (i.e. without Fc component): FC5-ABP and FC5-Fc-ABP were injected into rats via tail vein and serial serum samples were collected at various time points and analyzed by direct ELISA with FC5-specific antibody.
  • FC5-ABP construct was rapidly cleared in the serum (less than 1 hr) compared to FC5-Fc-ABP (Fig 10 B), indicating substantial increase in the serum stability of the molecule comprising the Fc fragment.
  • Fig 11 shows the effect of FC5-mFc-ABP on brain amyloid burden in Tg rats: AD-Tg rats were dosed with either saline or FC5-mFc-ABP via tail vein every week over a period of four weeks (loading dose of 30mg/kg and subsequent four weekly doses of 15 mg/kg).
  • CSF levels of FC5-mFc-ABP and ⁇ were analyzed by nanoLC MRM (FIG. 1 1A and FIG 1 1 B).
  • brain ⁇ levels were determined by PET scan using a specific ⁇ -binding agent [18F] NAV4694.
  • FC5-mFc-ABP reduced CSF ⁇ level in rats within 24 hrs (FIG. 1 1 A and FIG. 1 1 B).
  • PET scan which clearly indicated a significant reduction (30-50%) of rat brain AB levels following four weeks of treatment with FC5-mFc-ABP (FIG. 1 1 C).
  • Fig 12 shows volumetric Magnetic Resonance Imaging (MRI, using Fast Imaging with Steady- state Precession) and functional MRI (fMRI) of Tg rats before and after treatment with saline or FC5-mFc-ABP.
  • MRI Magnetic Resonance Imaging
  • fMRI functional MRI
  • Fig 13 shows time- and dose -dependent appearance of FC5-mFc-ABP in the CSF of beagle dog and a decrease in CSF AB levels as seen Tg mice (Fig 9C) and Tg rats (Fig 1 1A and B).
  • FC5-mFc-ABP was administered by intravenous injection to 10-12-year old beagle dogs at 15 mg/kg and 30 mg/kg and serum and CSF were serially collected and analyzed by nanoLC- MRM for FC5-mFc-ABP and ⁇ levels. As can be seen, FC5-mFc-ABP appeared in the CSF in a time-and dose-dependent manner.
  • Fig 14 shows the generation of ABP fusion molecule with a different BBB carrier.
  • ABP was successfully fused with another humanized BBB carrier IGF1 R5 (H2).
  • IGF1 R5 H2
  • the bi-functionality of the molecule was retained, ABP's ability to bind ⁇ oligomer (ELISA and overlay assays) and also IGF1 R5's ability deliver ABP across BBB model in vitro (data not shown). This clearly indicates that ABP can be fused to different BBB-crossing single-domain antibodies to be delivered to the brain.
  • Fig 15 shows ⁇ oligomer binding by different single-domain antibody-Fc-ABP constructs (FIG. 15A, 15B and 15C).
  • ABP has been modified by site-specific mutations or removal of C-terminus portion of the molecules as indicated in the SEQ ID NOs. All constructs retained similar potency in binding ⁇ oligomers by ELISA method.
  • Fig 16 shows the production of FC5-hFc1 X7-ABP with specific mutations to improve stability and bio-manufacturability.
  • FC5-hFc1X7-ABP carrying specific mutation such as the ABP of SEQ ID NO: 35 or SEQ ID NO: 36
  • specific mutation such as the ABP of SEQ ID NO: 35 or SEQ ID NO: 36
  • NR non-reducing
  • Fig 2 Separated protein transferred to nitrocellulose membrane and immunoblotted with either FC5-specific or hFc-specific or ABP-specific antibodies.
  • ⁇ -binding of ABP in the fusion molecule was also tested by overlay assay. Bound ⁇ was detected with ⁇ -specific antibody 6E10.
  • the methodic modification of ABP with specific mutation substantially enhanced the stability of the molecule generated, as indicated by single protein band under reducing and non-reducing conditions.
  • Fig 17 shows blood brain barrier permeability of various FC5-Fc-ABP constructs and IGF1 R5- Fc-ABP construct in vitro.
  • BBB- crossing was assessed in in vitro rat BBB model as described in Fig 4 and molecules crossing blood brain barrier were detected by nanoLC-MRM method. All ABP variants fused to humanized FC5 and IGF1 R carriers crossed the blood brain barrier effectively.
  • A20.1 a non-BBB permeable sdAb did not cross blood brain barrier, likewise ABP fused to A20.1 did not cross BBB (FIG. 17A).
  • Fig 17B shows humanized FC5(H3)-hFc1X7-ABP construct (ABP, SEQ ID NO: 35 and SEQ ID NO: 36) are transported across in vitro blood-brain barrier intact by FC5. Blood brain barrier - crossing was assessed in in vitro rat BBB model as described for Fig. 4 and molecule crossing BBB was detected by Western blot and ELISA assays.
  • Fig 18 (1 ) A and B show immunoblots probed with hFc- and ABP-specific antibodies, respectively.
  • the molecular size is exactly identical to that of the fusion molecule that was applied to in vitro blood brain barrier model.
  • Fig 18(1) C shows sandwich ELISA in which the molecule after crossing the BBB was captured by FC5-sepcific antibody on ELISA plate and detected with ABP-specific antibody.
  • This sandwich ELISA confirmed that FC5(H3)-hFc1X7-ABP remained intact after crossing rat blood brain barrier in vitro. Similar results were obtained with FC5(H3)-hFc1X7-ABP (ABP, SEQ ID NO: 36); Fig 18(2) A, B, and C.
  • Fig. 19 shows humanized FC5(H3)-hFc1X7-ABP constructs (ABP, SEQ ID NO: 35 and SEQ ID NO: 36) are transported across in vivo blood-brain barrier and delivered to the brain intact by FC5.
  • the FC5-ABP fusion molecule was administered intravenously into wild type and AD- Tg mice via tail vein and brains were collected following intra-cardiac perfusion as described for Fig. 8.
  • Brain cortex was homogenized and extracted in RIPA buffer and the extract was subjected to Western blot and sandwich ELISA analysis as described for Fig. 18.
  • Fig. 19A shows immunoblot probed with ABP-specific antibody. The molecular size is exactly identical to that of the fusion molecule that was injected into the animals.
  • Fig. 19 B shows sandwich ELISA of the same extract, molecule in the extract captured with FC5-specific antibody on the ELISA plate and detected with ABP-specific antibody. This confirms immunoblot results that FC5(H3)-hFc1X7-ABP is transported across the BBB in vivo and delivered to the brain intact.
  • Fig. 20 shows immunohistochemical analysis of ex-vivo binding (A) and in vivo binding (B) of FC5(H3)-hFc1X7-ABP (ABP, SEQ ID NO: 36) to endogenous ⁇ deposits in AD-Tg mouse brain (B6.Cg-Tg, Jackson Lab). Brain sections from AD-transgenic mice were incubated with FC5(H3)-hFc1X7-ABP (ABP, SEQ ID NO: 36) and the bound fusion molecule was visualized with HRP-conjugated FC5-specific antibody.
  • Fig. 21 shows target engagement by FC5(H3)-hFc1X7-ABP (ABP, SEQ ID NO: 32) in vivo.
  • Fig 21 A shows binding of Alexa 647-labeled FC5-hFc-ABP construct to natural amyloid- ⁇ ( ⁇ ) deposits in AD transgenic mice in vivo after intra-hippocampal injection. Identity of ⁇ was confirmed by probing the brain sections with ⁇ -specific antibody 6E10 labelled with Alexa 488 and demonstrating co-localization of two signals (Merge).
  • Fig 21 B shows demonstration of target engagement by ELISA.
  • FC5-ABP fusion construct was detected by sandwich ELISA using FC5 antibody as capturing antibody and ABP antibody as the detection antibody. In vivo binding of ABP to endogenous ⁇ was detected by the same sandwich ELISA but with ⁇ - specific antibody as the detection antibody. It is clear from the FIG 21 A and 21 B that the FC5- ABP construct remains intact 4hrs post-injection in both wild type and AD transgenic mice. Most importantly, in Tg mice which expresses human ⁇ , injected ABP binds ⁇ and is pulled down as a complex (FC5(H3)-hFc-ABP*AB) indicating ⁇ -target engagement by ABP in vivo.
  • Fig. 22 shows PK, PD comparison between non-humanized and humanized FC5-Fc-ABP constructs.
  • FC5-mFc2a-ABP or FC5(H3)-hFc1x7-ABP was administered intravenously into rats via tail vein injection at 15 mg/kg as described for Fig 5.
  • Serum and CSF were serially collected.
  • FC5-Fc-ABP levels were quantified using nanoLC- MRM method.
  • serum and CSF PK profile were very similar for non-humanized and humanized constructs.
  • FC5-mFc2a-ABP or FC5(H3)-hFc1x7-ABP was administered intravenously into Tg mice via tail vein injection at 15 mg/kg as described for Fig 9B.
  • FC5-Fc-ABP and ⁇ levels in the CSF were measured by nanoLC-MRM as described in Fig 9B. As shown in Fig 22 B, the levels of non-humanized and humanized FC5-Fc-ABP in the CSF were similar, and most importantly, changes (decrease) in CSF ⁇ levels were also very similar, indicating that humanization of FC5-Fc-ABP construct did not affect the PK and PD profile of the fusion construct.
  • the present invention provides polypeptides, fusion proteins comprising said polypeptides, and fusion proteins comprising said polypeptides and antibodies or fragments thereof that transmigrate the blood-brain barrier.
  • the present invention provides polypeptides which binds beta-amyloid ( ⁇ -amyloid).
  • the polypeptides (or proteins) that bind ⁇ -amyloid may selectively bind pathologically relevant ⁇ - amyloid ( ⁇ - 42 ) aggregates, and may be abbreviated and referred to herein as ABP or ABP variants (or collectively as ABP).
  • the present invention provides fusion proteins comprising ABP or an ABP variant linked to an antibody or fragment thereof that crosses the blood-brain barrier.
  • the fusion protein comprising ABP and a BBB additionally comprises an Fc or fragment thereof, wherein the ABP and BBB components of the fusion protein may be linked via an Fc region or portion thereof.
  • a construct of the present invention may comprise BBB-Fc-ABP or BBB-Fc-L-ABP, wherein L may be any suitable linker.
  • the BBB-Fc-APB or BBB-Fc-L-ABP construct provided may be a single chain polypeptide or a dimeric polypeptide, wherein the single-chain polypeptide comprising BBB-Fc-ABP may form a multimer (preferably a dimer) via the component Fc region.
  • the present invention relates to compounds that transmigrate the blood-brain barrier, and uses thereof. More specifically, the present invention relates to compounds comprising a BBB and an ABP and their use in the treatment of Alzheimer's disease (AD).
  • AD Alzheimer's disease
  • ABSP 40-amino acid ⁇ -binding peptide
  • This ⁇ -binding peptide inhibits ⁇ binding to cellular proteins and inhibits A ⁇ -induced cell toxicity in vitro (Chakravarthy et al, 2013).
  • This ⁇ -binding peptide binds amyloid deposits in AD transgenic mice brain, as well as binds amyloid deposits in the brains from AD patients in vitro.
  • ABP targets natural amyloid deposits in vivo.
  • ABP can potentially target CNS ⁇ , can assist in clearing ⁇ from the brain, and reduce its toxic effect.
  • systemically-administered ABP has limited ability to cross BBB and access the brain parenchyma by itself.
  • the present invention advantageously provides an ABP fused to a BBB- permeable single-domain antibody, such as FC5 or IGF1 R, via an Fc fragment to provide a bi- specific blood brain barrier-permeable therapeutic (Farrington et al, 2014).
  • the BBB-Fc-ABP construct of the present invention may dimerize, i.e.
  • the BBB-Fc-ABP single-chain fusion protein may form dimers of two single chain fusion proteins to yield a dimeric compound wherein each single chain of the dimer comprises a BBB, a Fc fragment and an ABP, to provide a BBB-Fc-ABP dimer.
  • the BBB-Fc-ABP or BBB-Fc-L-ABP construct and dimers thereof allows for the efficient transmigration of ABP across the blood brain barrier. Accordingly, the advantageous therapeutic clearing of ⁇ through the binding of ABP in CSF and brain parenchyma is provided in the constructs and methods of the present invention.
  • the 40-amino acid ABP polypeptide is presently fused to the C-terminus of an Fc fragment, whereas a BBB-permeable single-domain antibody, such as FC5 (WO 2002/057445), is fused to the N-terminus of the same Fc fragment, to create a bi-specific BBB-permeable therapeutic (Farrington et al, 2014).
  • the Fc fragment may be mouse (SEQ ID NO. 39) or human (SEQ ID NO: 40; SEQ ID NO: 41 ).
  • the Fc fragment of the present invention was engineered to reduce effector functions (Shields et al., 2001 ).
  • the Fc fragment may be hFc1x7 (SEQ ID NO:40) wherein the Fc fragment in the BBB-Fc-ABP fusion protein advantageously allows for the dimerization of the fusion protein to yield a therapeutically effective fusion molecule (BBB-Fc-ABP dimer) capable of transmigrating the blood brain barrier.
  • the BBB-Fc-ABP fusion protein may be FC5-H3-hFc1x7-ABP(6G) (SEQ ID NO: 47) and dimers thereof.
  • the fusion protein may comprise a linker sequence L that is as embodied in SEQ ID NO: 47 or SEQ ID NO:53, or any suitable linker sequence.
  • the present invention provides an isolated polypeptide which binds beta-amyloid ( ⁇ -amyloid).
  • a polypeptide of the present invention may comprise a sequence.
  • X FXzTXsX ⁇ ASAQASLASKDKTPKSKSKKXsXeSTQLXySX f jVXgNI SEQ ID NO: 31
  • X ! G or A
  • X 2 G or V
  • X 3 G or A
  • X 4 G or A
  • X 5 G or V
  • X 6 G or V
  • X 7 G or V
  • X 8 G or A
  • X 9 G or A
  • a polypeptide (ABP and ABP variant) of the present invention may be selected from the group consisting of: SEQ ID NO:27 to SEQ ID NO:38 or a sequence substantially identical thereto.
  • the polypeptide provided is an ABP variant comprising a sequence substantially equivalent to SEQ ID NO: 31 .
  • a sequence that is substantially equivalent thereto may confer equivalent stability to the fusion molecules.
  • the present invention provides a compound, namely a fusion protein, comprising an antibody or fragment thereof that transmigrates across the blood brain barrier (BBB) and a polypeptide that binds ⁇ -amyloid.
  • the present invention provides fusion proteins comprising a BBB, a polypeptide that binds ⁇ -amyloid, and an Fc.
  • immunoglobulin refers to a protein constructed from paired heavy and light polypeptide chains; various Ig isotypes exist, including IgA, IgD, IgE, IgG, and IgM.
  • each chain fold folds into a number of distinct globular domains joined by more linear polypeptide sequences. For example, the immunoglobulin light chain folds into a variable (V L ) and a constant (C L ) domain, while the heavy chain folds into a variable (V H ) and three constant (C H , C H 2, C H 3) domains.
  • V H and V L Interaction of the heavy and light chain variable domains (V H and V L ) results in the formation of an antigen binding region (Fv).
  • Each domain has a well-established structure familiar to those of skill in the art.
  • the light and heavy chain variable regions are responsible for binding the target antigen and can therefore show significant sequence diversity between antibodies.
  • the constant regions show less sequence diversity, and are responsible for binding a number of natural proteins to elicit important biochemical events.
  • the variable region of an antibody contains the antigen- binding determinants of the molecule, and thus determines the specificity of an antibody for its target antigen.
  • the majority of sequence variability occurs in six hypervariable regions, three each per variable heavy (V H ) and light (V L ) chain; the hypervariable regions combine to form the antigen-binding site, and contribute to binding and recognition of an antigenic determinant.
  • the specificity and affinity of an antibody for its antigen is determined by the structure of the hypervariable regions, as well as their size, shape, and chemistry of the surface they present to the antigen.
  • Various schemes exist for identification of the regions of hypervariability the two most common being those of Kabat and of Chothia and Lesk. Kabat et al (1991 ) define the "complementarity-determining regions" (CDR) based on sequence variability at the antigen- binding regions of the V H and V L domains.
  • an "antibody fragment” as referred to herein may include any suitable antigen-binding antibody fragment known in the art.
  • the antibody fragment may be a naturally-occurring antibody fragment, or may be obtained by manipulation of a naturally-occurring antibody or by using recombinant methods.
  • an antibody fragment may include, but is not limited to a Fv, single-chain Fv (scFv; a molecule consisting of V L and V H connected with a peptide linker), Fab, F(ab') 2 , single-domain antibody (sdAb; a fragment composed of a single V L or V H ), and multivalent presentations of any of these.
  • Antibody fragments such as those just described may require linker sequences, disulfide bonds, or other type of covalent bond to link different portions of the fragments; those of skill in the art will be familiar with the requirements of the different types of fragments and various approaches and various approaches for their construction.
  • the antibody fragment may be an sdAb derived from naturally- occurring sources. Heavy chain antibodies of camelid origin (Hamers-Casterman et al, 1993) lack light chains and thus their antigen binding sites consist of one domain, termed V H H. sdAb have also been observed in shark and are termed V N AR (Nuttall et al, 2003).
  • sdAb may be engineered based on human Ig heavy and light chain sequences (Jespers et al, 2004; To et al, 2005).
  • the term "sdAb” includes those sdAb directly isolated from V H , V H H, VL, or VNAR reservoir of any origin through phage display or other technologies, sdAb derived from the aforementioned sdAb, recombinantly produced sdAb, as well as those sdAb generated through further modification of such sdAb by humanization, affinity maturation, stabilization, solubilization, camelization, or other methods of antibody engineering.
  • homologues, derivatives, or fragments that retain the antigen-binding function and specificity of the sdAb.
  • SdAb possess desirable properties for antibody molecules, such as high thermostability, high detergent resistance, relatively high resistance to proteases (Dumoulin et al, 2002) and high production yield (Arbabi-Ghahroudi et al, 1997); they can also be engineered to have very high affinity by isolation from an immune library (Li et al, 2009) or by in vitro affinity maturation (Davies & Riechmann, 1996). Further modifications to increase stability, such as the introduction of non-canonical disulfide bonds (Hussack et al, 201 1 a, b; Kim et al, 2012), may also be brought to the sdAb.
  • An sdAb comprises a single immunoglobulin domain that retains the immunoglobulin fold; most notably, only three CDR/hypervariable loops form the antigen-binding site.
  • not all CDR may be required for binding the antigen.
  • one, two, or three of the CDR may contribute to binding and recognition of the antigen by the sdAb of the present invention.
  • the CDR of the sdAb or variable domain are referred to herein as CDR1 , CDR2, and CDR3.
  • the antibody or fragment thereof as described herein may transmigrate the blood-brain barrier.
  • the brain is separated from the rest of the body by a specialized endothelial tissue known as the blood-brain barrier (BBB).
  • BBB blood-brain barrier
  • the endothelial cells of the BBB are connected by tight junctions and efficiently prevent many therapeutic compounds from entering the brain.
  • one specific feature of the BBB is the existence of enzymatic barrier(s) and high level(s) of expression of ATP-dependent transporters on the abluminal (brain) side of the BBB, including P-glyco protein (Gottesman and Pastani, 1993; Watanabe, 1995), which actively transport various molecules from the brain into the blood stream (Samuels, 1993).
  • the antibody or fragment thereof as described above may be used to carry other molecules, such as therapeutics, for delivery to the brain tissue.
  • the antibody or fragment thereof may be any suitable antibody or fragment thereof known in the art to transmigrate the blood brain barrier.
  • the present invention provides a compound, or fusion protein, comprising an antibody or fragment thereof that transmigrates the blood brain barrier (BBB).
  • An antibody or fragment of the present invention may bind to, for example, transmembrane protein 30A (TMEM30A), as described in WO 2007/036021 , or to an Insulin-Like Growth Factor 1 Receptor (IGF1 R) epitope, or isoforms, variants, portions, or fragments thereof.
  • TEM30A transmembrane protein 30A
  • IGF1 R Insulin-Like Growth Factor 1 Receptor
  • the antibody or fragment thereof in the compound of the present invention may comprise a complementarity determining region (CDR) 1 sequence of HYTMG (SEQ ID NO:1); a CDR2 sequence of RITWGGDNTFYSNSVKG (SEQ ID NO:2); and a CDR3 sequence of GSTSTATPLRVDY (SEQ ID NO:3); or a CDR1 sequence of EYPSNFYA (SEQ ID NO:4), a CDR2 sequence of VSRDGLTT (SEQ ID NO:5), a CDR3 sequence of AIVITGVW KVDVNSRSYHY (SEQ ID NO:6); or a CDR1 sequence of GGTVSPTA (SEQ ID NO:7), a CDR2 sequence of ITWSRGTT
  • CDR complementarity determining region
  • the antibody or fragment thereof may be an sdAb of camelid origin or derived from a camelid V H H, and thus may be based on camelid framework regions; alternatively, the CDR described above may be grafted onto V NAR , V H H, V H or V L framework regions.
  • the hypervariable loops described above may be grafted onto the framework regions of other types of antibody fragments (Fv, scFv, Fab) of any source (for example, mouse or human) or proteins of similar size and nature onto which CDR can be grafted (for example, see Nicaise et al, 2004).
  • the present invention further encompasses an antibody or fragment thereof that is chimeric (or chimerized), veneered, or humanized. Chimeric antibodies or fragments thereof are constructs in which the native variable domain (of mouse or camelid origin) is linked to human constant domain(s) (see Gonzales et al 2005).
  • Veneering or re-surfacing of antibodies involves replacing exposed residues in the framework region of the native antibody or fragment thereof with the amino acid residues in their human counterpart (Padlan, 1991 ; Gonzales et al 2005).
  • Humanization of an antibody or antibody fragment comprises replacing an amino acid in the sequence with its human counterpart, as found in the human consensus sequence, without loss of antigen-binding ability or specificity; this approach reduces immunogenicity of the antibody or fragment thereof when introduced into human subjects.
  • one or more than one of the CDR defined herein may be fused or grafted to a human variable region (V H , or V L ), to other human antibody (IgA, IgD, IgE, IgG, and IgM), to human antibody fragment framework regions (Fv, scFv, Fab), or to human proteins of similar size and nature onto which CDR can be grafted (Nicaise et al, 2004).
  • V H human variable region
  • V L human variable region
  • IgA, IgD, IgE, IgG, and IgM human antibody fragment framework regions
  • Fv, scFv, Fab human proteins of similar size and nature onto which CDR can be grafted
  • the conformation of said one or more than one hypervariable loop is likely preserved, and the affinity and specificity of the sdAb for its target (i.e., an epitope on brain endothelial cells, such as TMEM30A, or an IGF1 R epitope) brain endothelial cells) is likely minimally affected.
  • the target i.e., an epitope on brain endothelial cells, such as TMEM30A, or an IGF1 R epitope
  • FC5 (comprising a sequence of any one of SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17), and IGF1 R (comprising a sequence of any one of SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21 , SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, or SEQ ID NO: 26) bind to the surface of receptor epitopes on brain endothelial cells and subsequently transmigrates the blood-brain barrier (BBB).
  • BBB blood-brain barrier
  • FC5 has also been shown to act as a carrier to usher molecules of various sizes across the BBB (see for example, WO 201 1 /127580).
  • the antigen mediating FC5 transmigration was tentatively identified as transmembrane domain protein 30A (TMEM30A; WO 2007/036021), which is enriched on the surface of brain endothelial cells.
  • TMEM30A transmembrane domain protein 30A
  • the antibody or fragment thereof may comprise the sequence:
  • X 4 E or G
  • X 5 R or L
  • X 6 F or W
  • X 7 L or V, or a sequence substantially identical thereto;
  • X 2 is K or Q
  • X 3 is V or E
  • X 4 is A or P
  • X 5 is A or E
  • X 6 is V or A
  • X 7 is V or F
  • X 8 is G or E
  • X 9 is L or R
  • X 10 is F or W
  • X is G or S
  • X 12 is V or Y
  • X 13 is D or G
  • X 14 is N or S
  • X 15 is A or S
  • X 16 is L or V
  • X 17 is K or R
  • X 18 is A or S
  • X ig is L or Q; or a sequence substantially identical thereto;
  • the antibody or fragment thereof may comprise a sequence selected from any one of:
  • a substantially identical sequence may comprise one or more conservative amino acid mutations. It is known in the art that one or more conservative amino acid mutations to a reference sequence may yield a mutant peptide with no substantial change in physiological, chemical, physico-chemical or functional properties compared to the reference sequence; in such a case, the reference and mutant sequences would be considered "substantially identical" polypeptides.
  • a conservative amino acid substitution is defined herein as the substitution of an amino acid residue for another amino acid residue with similar chemical properties (e.g. size, charge, or polarity). These conservative amino acid mutations may be made to the framework regions of the sdAb while maintaining the CDR sequences listed above and the overall structure of the CDR of the antibody or fragment; thus the specificity and binding of the antibody are maintained.
  • a substantially equivalent sequence may comprise one or more conservative amino acid mutations; wherein the mutant peptide is substantially equivalent with respect to peptide stability and bio-manufacturability.
  • Substantially equivalent may refer to equivalent with respect to fusion molecule stability; for example, the lack of a degradation product, or a low molecular weight band, as seen in SDS PAGE (reducing and non-reducing conditions). It is known in the art that one or more conservative amino acid mutations to a reference sequence may yield a mutant peptide with no substantial change in physiological, chemical, physico- chemical or functional properties compared to the reference sequence; in such a case, the reference and mutant sequences would be considered "substantially equivalent" polypeptides.
  • a conservative mutation may be an amino acid substitution.
  • Such a conservative amino acid substitution may substitute a basic, neutral, hydrophobic, or acidic amino acid for another of the same group.
  • basic amino acid it is meant hydrophilic amino acids having a side chain pK value of greater than 7, which are typically positively charged at physiological pH.
  • Basic amino acids include histidine (His or H), arginine (Arg or R), and lysine (Lys or K).
  • neutral amino acid also “polar amino acid”
  • hydrophilic amino acids having a side chain that is uncharged at physiological pH, but which has at least one bond in which the pair of electrons shared in common by two atoms is held more closely by one of the atoms.
  • Polar amino acids include serine (Ser or S), threonine (Thr or T), cysteine (Cys or C), tyrosine (Tyr or Y), asparagine (Asn or N), and glutamine (Gin or Q).
  • hydrophobic amino acid (also “non-polar amino acid”) is meant to include amino acids exhibiting a hydrophobicity of greater than zero according to the normalized consensus hydrophobicity scale of Eisenberg (1984). Hydrophobic amino acids include proline (Pro or P), isoleucine (lie or I), phenylalanine (Phe or F), valine (Val or V), leucine (Leu or L), tryptophan (Trp or W), methionine (Met or M), alanine (Ala or A), and glycine (Gly or G).
  • “Acidic amino acid” refers to hydrophilic amino acids having a side chain pK value of less than 7, which are typically negatively charged at physiological pH. Acidic amino acids include glutamate (Glu or E), and aspartate (Asp or D).
  • Sequence identity is used to evaluate the similarity of two sequences; it is determined by calculating the percent of residues that are the same when the two sequences are aligned for maximum correspondence between residue positions. Any known method may be used to calculate sequence identity; for example, computer software is available to calculate sequence identity. Without wishing to be limiting, sequence identity can be calculated by software such as NCBI BLAST2 service maintained by the Swiss Institute of Bioinformatics (and as found at ca.expasy.org/tools/blast/), BLAST-P, Blast-N, or FASTA-N, or any other appropriate software that is known in the art.
  • the substantially identical sequences of the present invention may be at least 90% identical; in another example, the substantially identical sequences may be at least 90, 91 , 92, 93, 94, 95, 96, 97, 98, 99, or 100% identical, or any percentage therebetween, at the amino acid level to sequences described herein. Importantly, the substantially identical sequences retain the activity and specificity of the reference sequence. In a non-limiting embodiment, the difference in sequence identity may be due to conservative amino acid mutation(s). In a non-limiting example, the present invention may be directed to an antibody or fragment thereof comprising a sequence at least 95%, 98%, or 99% identical to that of the antibodies described herein.
  • the antibody or fragment thereof in the compound of the present invention may be linked to an Fc domain, for example, but not limited to human Fc domains.
  • the Fc domains may be selected from various classes including, but not limited to, IgG, IgM, or various subclasses including, but not limited to lgG1 , lgG2, etc.
  • the Fc gene is inserted into a vector along with the sdAb gene to generate a sdAb-Fc fusion protein (Bell et al, 2010; Iqbal et al, 2010); the fusion protein is recombinantly expressed then purified.
  • multivalent display formats may encompass chimeric formats of FC5-H3 and its mutational variants linked to an Fc domain.
  • Such antibodies are easy to engineer and to produce, can greatly extend the serum half-life of sdAb (Bell et al., 2010).
  • the Fc domain in the compound as just described may be any suitable Fc fragment known in the art.
  • the Fc fragment may be from any suitable source; for example, the Fc may be of mouse or human origin.
  • Other preferred Fc or Fc fragment embodiments may modulate, modify or suppress an immunological effector function (Shields 2001 ).
  • Other highly preferred Fc fragment embodiments may mediate clearance of the fusion peptide from the brain (Caram- Salas N 201 1).
  • the Fc may be the mouse Fc2a fragment or human Fc1 fragment (Bell et al, 2010; Iqbal et al, 2010).
  • the multimerized construct may comprise the isolated or purified antibody or fragment as described herein and an Fc of sequence of SEQ ID NO:39; SEQ ID NO:40; SEQ ID NO:41 . Accordingly, the BBB-Fc-ABP fusion proteins provided herein may form dimers via the Fc to provide a bivalent, bifunctional BBB-Fc-ABP.
  • the compound of the present invention comprises an antibody or fragment thereof linked to a polypeptide that binds ⁇ -amyloid.
  • the linker may be any polypeptide, comprising neutral or hydrophilic amino acids, of suitable length. In a non-limiting example, the length is preferably less than 12 amino acids, and the polypeptide is GGGSGGGS. Other chemical linkers may be employed using non-peptidic forms such as amide or ester linkages in a correct orientation.
  • SEQ ID NO: 53 provides a fusion protein comprising any suitable linker, wherein any fusion protein of the present invention, i.e. SEQ ID NO: 42 - 52 may comprise any suitable linker as exemplified in SEQ ID NO: 53.
  • the polypeptide that binds ⁇ -amyloid may bind pathologically relevant ⁇ -amyloids, such as ⁇ ! ⁇ aggregates, which are implicated in AD pathology; the polypeptide may bind ⁇ with high affinity (in the nM range), inhibit ⁇ binding to cellular proteins and A ⁇ 1 _42-induced cell toxicity in vitro, and binds amyloid deposits in AD transgenic mice brain as well as in the brains from AD patients in vitro.
  • the polypeptide in the compound of the present invention does not bind the reverse peptide ⁇ 42 - ⁇ .
  • the polypeptide that binds ⁇ -amyloid may comprise a sequence selected from the group consisting of: (SEQ ID NO:27); (SEQ ID NO:28); (SEQ ID NO:29); (SEQ ID NO:30); (SEQ ID NO:31 ); (SEQ ID NO:32); (SEQ ID NO:33); (SEQ ID NO:34); (SEQ ID NO:35); (SEQ ID NO:36); (SEQ ID NO:37); (SEQ ID NO:38); and a sequence substantially identical thereto.
  • a "substantially identical" sequence is as described above.
  • the present invention provides a polypeptide that binds ⁇ -amyloid and variants thereof (i.e. ABP and ABP variants).
  • ABP variant may comprise a sequence having SEQ ID NO: 31 , for example, the ABP variant provided may comprise a sequence selected from the group consisting of: SEQ ID NO: 31 to SEQ ID NO:38 or a sequence substantially equivalent thereto.
  • ABP polypeptide sequences comprising specific systematic and methodical modifications based on detailed biophysical characterization of the ABP.
  • the specific and methodically directed modifications to the ABP polypeptide comprise the novel and unobvious ABP variants of the present invention, as provided in SEQ ID NO:31 .
  • the peptide provided herein may comprise an ABP comprising a sequence that may be selected from the group consisting of SEQ ID NO: 27 - SEQ ID NO: 38, and a sequence substantially equivalent thereto.
  • the peptide provided herein may comprise an ABP variant, for example, an ABP comprising a sequence that may be selected from any one of SEQ ID NO: 32 to SEQ ID NO:38, or any equivalent sequence to SEQ ID NO:31 .
  • a construct comprising an ABP or an ABP variant, as provided herein, exhibits advantageous improvement in compound stability and bio- manufacturability (as can be seen in Fig.14).
  • the fusion proteins and compounds provided herein exhibit improved therapeutic efficacy. More specifically, the compounds provided comprise specifically modified ABP that allows the generation of stable BBB-Fc-ABP fusion molecule for enhanced bio-manufacturability (production in human mammalian expression system).
  • the specific modifications to ABP provided herein were systematic and methodical modifications based on detailed biophysical characterization of the ABP.
  • the modified ABP provided herein may comprise, for example, a sequence selected from SEQ ID NO: 32 - SEQ ID NO: 38, and a sequence substantially equivalent thereto, such as SEQ ID NO: 31 .
  • the compounds provided herein advantageously exhibit improved stability and bio-manufacturability, and a most significant increase in the efficacy of reducing ⁇ levels in brain; wherein a 50% amyloid reduction was observed within 24 hr of treatment with a construct of the present invention.
  • linked also referred to herein as “conjugated” it is meant that two moieties are joined directly or indirectly (e.g., via a linker), covalently or non-covalently (e.g., adsorption, ionic interaction).
  • a covalent linkage may be achieved through a chemical cross-linking reaction, or through fusion using recombinant DNA methodology combined with any peptide expression system, such as bacteria, yeast or mammalian cell-based systems.
  • a suitable linker When conjugating the antibody or fragment thereof to the polypeptide binding ⁇ or Fc, a suitable linker may be used.
  • a suitable linker may be any polypeptide, comprising neutral or hydrophilic amino acids, of suitable length that allows for the conjugation of the components of the BBB-Fc-ABP protein fusion.
  • the linker that allows the components of the fusion protein (for example, in SEQ ID NO: 42-52) to be according linked, and is not limited to the GGGGSGGGGS or (GGGS) n linker highlighted therein and may be any suitable linker (i.e. as in the non-limited fusion protein of SEQ ID NO: 53).
  • the length is preferably less than 12 amino acids, and the polypeptide may be GGGSGGGS.
  • Other chemical linkers may be employed using non-peptidic forms such as amide or ester linkages in a correct orientation.
  • linkers or method of linking an antibody or fragment thereof to a polypeptide are well-known to a person of skill in the art.
  • the compound provided herein comprises an antibody or fragment thereof, a polypeptide that binds ⁇ -amyloid, and an Fc fragment, linked to provide a construct (also referred to herein as a compound or fusion molecule), wherein the construct comprises a fusion protein and dimers thereof.
  • the antibody or fragment thereof may be linked to a polypeptide that binds ⁇ -amyloid via an Fc fragment, or a suitable linker.
  • the antibody or fragment thereof comprises a sequence selected from any one of: SEQ ID NO:14, SEQ ID NO:14, SEQ ID NO: 15, SEQ ID NO:16, SEQ ID NO:17, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 22, SEQ ID NO 23, SEQ ID NO:25, SEQ ID NO:26, and a sequence substantially identical thereto.
  • the antibody or fragment thereof transmigrates the blood brain barrier.
  • the antibody or fragment may be a sdAb; wherein the sdAb may be humanized.
  • the polypeptide that binds ⁇ -amyloid comprises a sequence selected from the group consisting of: SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:31 , SEQ ID NO:32, SEQ ID NO:33, SEQ ID NO:34, SEQ ID NO:35, SEQ ID NO:36, SEQ ID NO:37, SEQ ID NO:38, and a sequence substantially identical thereto, and preferably a sequence comprising SEQ ID NO: 31 .
  • the Fc fragment comprises a sequence selected from any one of SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41 , and a sequence substantially identical thereto.
  • the Fc fragment of the present invention may be any suitable Fc fragment with attenuated effector function.
  • the Fc fragment provided in the fusion protein allows for the formation of dimeric structures; wherein for example a single-chain fusion protein comprising a sequence selected from the group consisting of SEQ ID NO: 42 to SEQ ID NO: 53 may form dimeric structures conjugated via the Fc fragment therein.
  • a compound or construct of the present invention may comprise a sequence selected from the group consisting of SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44 SEQ ID NO:45, SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO: 51 , SEQ ID NO: 52, SEQ ID NO: 53 and a sequence substantially identical thereto, or dimeric structures thereof.
  • the present invention provides fusion proteins comprising a BBB-crossing single-domain antibody (BBB), an Fc fragment (Fc) and an amyloid-binding peptide (ABP), wherein each moiety may be linked to provide fusion molecules, as illustrated in FIG. 1 .
  • the BBB may linked to the N-terminus of the Fc and the ABP linked to the C-terminus of the Fc fragment (FIG. 1 A).
  • Fig.1 shows the corresponding dimers of the single-chain fusion protein comprising BBB-Fc-ABP.
  • the 3 components i.e. BBB, Fc, and ABP
  • the polypeptide that binds ⁇ -amyloid may comprise the sequence SEQ ID NO: 31 .
  • the ABP variant comprises the sequence:
  • GTFGTGGASAQASLASKDKTPKSKSKKGGSTQLKSRVKNI (SEQ ID NO:36) referred to herein as ABP(6G) and a sequence substantially equivalent thereto.
  • the antibody or fragment thereof may comprise the sequence EVQLVESGGGLVQPGGSLRLSCAASGFKITHYTMGWFRQAPGKGLEFVSRITWGGD NTFYSNSVKGRFTISRDNSKNTVYLQMNSLRAEDTAVYYCAAGSTSTATPLRVDYWG QGTLVTVSS (SEQ ID NO: 17) referred to herein as FC5-H3.
  • the antibody or fragment thereof may further comprise the sequence of a human Fc, such as
  • the compound of the present invention may comprise the sequence:
  • FC5 (SEQ ID NO: 14) mFc2a (SEQ ID NO: 39) ABP (SEQ ID NO: 30)
  • FC5(H3) (SEQ ID NO: 17)
  • mFc2a (SEQ ID NO: 39)
  • ABP (SEQ ID NO: 30)
  • FC5(H3) (SEQ ID NO: 17) hFd x7 (SEQ ID NO: 40) ABP (SEQ ID NO: 30)
  • FC5(H3) (SEQ ID NO: 17) hFd x7 (SEQ ID NO: 40) ABP(G) SEQ ID NO: 32)
  • FC5(H3) (SEQ ID NO: 17) hFc1 x7 (SEQ ID NO: 40) ABP(GG-G) SEQ ID NO: 35
  • FC5(H3) (SEQ ID NO: 17) hFc1 x7 (SEQ ID NO: 40)
  • ABP(6G) SEQ ID NO: 36)
  • FC5(H3) (SEQ ID NO: 17) hFdXO (SEQ ID No: 41 ) ABP(GG-G) SEQ ID NO: 35
  • FC5(H3) (SEQ ID NO: 17) hFc1 x7 (SEQ ID NO: 40) ABP(trc) SEQ ID NO: 38)
  • IGF1 R-5(H2) (SEQ ID NO: 26)
  • mFc2a (SEQ ID NO: 39)
  • ABP (SEQ ID NO: 30)
  • the BBB-Fc-ABP fusion protein constructs may also comprise a linker (L) wherein the BBB-Fc-ABP construct is a BBB-Fc-L-ABP fusion protein of the present invention, wherein L may be GGGSGGGGS or any suitable linker, as exemplified in the consensus linker sequence in SEQ ID NO:53.
  • L may be GGGSGGGGS or any suitable linker, as exemplified in the consensus linker sequence in SEQ ID NO:53.
  • the compound of the present invention may comprise variations in each of the components comprised therein, for example, ABP may be ABP (GG-G), as provided in SEQ ID NO: 46.
  • the linker sequence provided therein (as highlighted for example, in SEQ ID NO:42 to SEQ ID NO: 53) may be any linker that allows for the linking of the BBB-Fc-ABP fusion protein.
  • the compound of the present invention may also comprise additional sequences to aid in expression, detection or purification of a recombinant antibody or fragment thereof. Any such sequences or tags known to those of skill in the art may be used.
  • the antibody or fragment thereof may comprise a targeting or signal sequence (for example, but not limited to ompA), a detection/purification tag (for example, but not limited to c-Myc, His 5 , or His 6 ), or a combination thereof.
  • the additional sequence may be a biotin recognition site such as that described by Cronan et al (WO 95/04069) or Voges et al (WO/2004/076670).
  • linker sequences may be used in conjunction with the additional sequences or tags, or may serve as a detection/purification tag.
  • the present invention also encompasses nucleic acid sequences encoding the compounds as described herein. Given the degeneracy of the genetic code, a number of nucleotide sequences would have the effect of encoding the polypeptide, as would be readily understood by a skilled artisan.
  • the nucleic acid sequence may be codon-optimized for expression in various micro-organisms.
  • the present invention also encompasses vectors comprising the nucleic acids as just described.
  • the invention encompasses cells comprising the nucleic acid and/or vector as described.
  • the present invention further encompasses a composition comprising one or more than one compound as described herein and a pharmaceutically acceptable diluent, excipient, or carrier.
  • the composition may also comprise a pharmaceutically acceptable diluent, excipient, or carrier.
  • the diluent, excipient, or carrier may be any suitable diluent, excipient, or carrier known in the art, and must be compatible with other ingredients in the composition, with the method of delivery of the composition, and is not deleterious to the recipient of the composition.
  • the composition may be in any suitable form; for example, the composition may be provided in suspension form or powder form (for example, but limited to lyophilised or encapsulated).
  • the carrier when the composition is provided in suspension form, may comprise water, saline, a suitable buffer, or additives to improve solubility and/or stability; reconstitution to produce the suspension is effected in a buffer at a suitable pH to ensure the viability of the antibody or fragment thereof.
  • Dry powders may also include additives to improve stability and/or carriers to increase bulk/volume; for example, and without wishing to be limiting, the dry powder composition may comprise sucrose or trehalose. It would be within the competency of a person of skill in the art to prepare suitable compositions comprising the present compounds.
  • a method of treating Alzheimer's disease in which a compound or composition of the present invention is administered to a subject in need thereof.
  • Any appropriate route of administration may be utilized, including but not limited to intravenous, intraperitoneal, parenteral, intracranial, intramuscular, subcutaneous, oral, or nasal.
  • the optimal dose for administration and route of administrations are generally determined experimentally.
  • a method of reducing toxic ⁇ -amyloid levels in the cerebrospinal fluid (CSF) and brain parenchyma of subjects having increased ⁇ -amyloid levels is provided. More specifically, toxic ⁇ -amyloid levels in the cerebrospinal fluid (CSF) and brain parenchyma of subjects is reduced as early as 24 hours of a single parenteral administration of the composition of the present invention.
  • Fusion molecules comprising:
  • FC5 sdAb SEQ ID NO:14
  • murine Fc SEQ ID NO:39
  • ABP ABP
  • FC5-H3 FC5-H3; SEQ ID NO: 17
  • human Fc SEQ ID NO: 40
  • ABP ABP
  • fusion protein construct comprises a BBB-crossing single-domain antibody, an Fc fragment and an amyloid- binding peptide.
  • FC5-mFc-ABP and humanized FC5(H3)-hFc-ABP described in Example 1 were expressed in CHO cells, and the expressed compounds were purified on MabSelect Sure affinity columns
  • FC5 variants FC5 and FC5-H3 V H H fused to N-terminal of mouse or human Fc antibody fragment fused to ABP variants at their C-terminus as described in example 1 were prepared, expressed, and purified.
  • the FC5-Fc-ABP variant DNAs (DNA synthesis suppliers) were cloned into mammalian expression vector pTT5 (Durocher 2002).
  • Polyplexes for a final concentration of 1 mg of DNA per liter of cells were pre-formed by mixing a combination of plasmid vector (80%), pTT-AKTdd (15%, activated mutant of Protein Kinase B), and pTTo-GFP (5%, to monitor transfection efficiency) with PEI MAX solution (Polysciences cat no 24765).
  • the PEI:DNA ratio was 4:1 (W:W), both prepared in supplemented F17 medium (4 mM Glutamine, 0.1 % Kolliphor). The mixture was incubated for 5 minutes at room temperature prior to addition to the cell culture.
  • the volume of the DNA/PEI polyplexe represent 10% of final culture volume (e.i. 100 ml per 1 L culture).
  • the cultures were fed with tryptone N1 at a final concentration of 1 % (with 40% w/v solution, Organotechnie) and 0.5 mM valproic acid (200 mM solution).
  • the transfection/production were monitored for cell density and viability as well as for productivity titer (mg of Fc per L) and were harvested (supernatant) by centrifugation when the cell viability reach a minimum of 65%.
  • Clarified cell culture medium was filtered through a 0.45 ⁇ membrane prior to its application on a column packed with 5 ml of protein-A MabSelect SuRe resin (GE Healthcare).
  • the column was washed with 5 volumes of phosphate-buffered saline pH 7.1 (PBS) and the antibody was eluted with 100 mM sodium citrate buffer pH 3.0. Fractions containing the eluted antibody were pooled and a buffer exchange was performed by loading on a desalting Econo-Pac column (BioRad) equilibrated in PBS. Desalted antibody was then sterile-filtered by passing through a Millex GP (Millipore) filter unit (0.22 ⁇ ) and aliquoted.
  • Millex GP Millex GP
  • ELISA ⁇ -binding assays were carried out as described by Chakravarthy et al (2013). Maxisorp 96-well ELISA plates (Nunc) were coated with (100-500 ng/well) either free ABP (synthetic) or various FC5-ABP constructs overnight at 4°C in PBS. The wells were blocked with 1 % BSA in TBS-T for 30 min and then incubated with AB ⁇ preparations consisting predominantly of either monomer and dimers (Mo) or higher oligomers (Oli) in TBS-T at RT for 45 min with gentle agitation.
  • bound AB was detected by incubating HRP-conjugated AB-specific antibody (6E10 or 4G8) for 90 min at RT in TBS-T.
  • the bound antibody was detected with SureBlueTM TMB reagent kit (KPL) by colorimetric measurement at 450nm according to manufacturer's instructions.
  • FIG. 2A A Coomassie blue stained gel after separation of FC5 fusion molecules by SDS-PAGE (NR- non-reducing and R- reducing conditions) indicating successful production of recombinant fusion molecule is shown in Fig. 2A.
  • Free or fused ABP was immobilized on ELISA plate by coating samples in phosphate buffered saline (PBS) overnight at 4°C and exposed to AB preparations as described by Chakravarthy et al., 2013.
  • PBS phosphate buffered saline
  • Bound ⁇ was detected with ⁇ -specific antibody 6E10 or 4G8 (Chakravarthy et al., 2013). The fusion molecules were also separated by SDS-PAGE, transferred to PVDF paper and exposed to ⁇ oligomers. Bound ⁇ was detected with specific antibody as above. Results show that ABP retained its ⁇ oligomer binding ability after fusion with the BBB carrier.
  • Mo AB monomers; Oli: ⁇ Oligomers
  • Example 3 Binding of BBB-Fc-L-ABP fusion molecules to ⁇ deposits in AD-Tg mice (B6.Cg- Tg, Jackson Lab) in vitro
  • Example 2 The constructs produced in Example 2 were submitted to immunohistofluorescence assay to evaluate whether the FC5-Fc-ABP fusion molecules retained the ability to bind naturally- produced amyloid deposits in mouse brain as described (Chakravarthy et al., 2014).
  • IR 800-labelled FC5-mFc-ABP (1 :250 dilution of 5.0 ⁇ 9/ ⁇ solution) in antibody diluent was added and incubated for 1 h at room temperature. Sections were then washed twice with TBS, rinsed in Milli Q water, excess rinse solution removed and sections were cover-slipped with Dako Fluorescent Mounting Media. Sections visualized under fluorescence microscope (Fig. 3). Selective binding (bright spots) was seen in brain sections from AD-Tg mice that produce AB deposits and not in brain sections from Wt mice that does not produce amyloid deposits, indicating that ABP in the FC5- Fc-ABP construct retains the ability to bind naturally produced AB aggregates in AD-Tg mouse brain.
  • the BBB may be FC5 or an anti-IGF1 R antibody.
  • FC5-Fc-ABP fusion molecules were assessed in in vitro BBB models from rat and human (Fig. 4). Fusion molecules crossing BBB were screened in in vitro BBB permeability assay, using a single-time point for Papp determination. The quantification of variants was done by MRM-ILIS (FIG. 4A, 4B and 4C).
  • SV-ARBEC SV40-immortalized Adult Rat Brain
  • HBEC Human Brain Endothelial Cells
  • BBB blood-brain barrier
  • Sv-ARBEC 80,000 cells/membrane
  • the bottom chamber of the insert assembly contained 2 ml of growth medium supplemented with the immortalized neonatal rat astrocytes-conditioned medium in a 1 :1 (v/v) ratio.
  • MRM-ILIS The methods are all as described in Haqqani et al. (2013). Briefly, to develop the SRM (selected reaction monitoring also known as multiple reaction monitoring (MRM)) assay for VHH, each V H H was first analyzed by nanoLC-MS/MS using data-dependent acquisition to identify all ionizible peptides. For each peptide, the 3 to 5 most intense fragment ions were chosen. An initial SRM assay was developed to monitor these fragments at attomole amounts of the digest (about 100-300 amol). Fragments that showed reproducible intensity ratios at low amounts (i.e., had Pearson r2 > 0.95 compared to higher amounts) were considered stable and were chosen for the final SRM assay.
  • MRM selected reaction monitoring also known as multiple reaction monitoring
  • elution times for each peptide were also included, with care taken to not choose peptides that have close m/z (mass- to-charge ratio) and elution times.
  • a typical multiplexed SRM analysis of V H H in cell media or body fluids involved spiking known amount of ILIS (0.1 -10 nM) followed by injecting 100-400 ng of CSF or cultured media proteins (0.3-1 ⁇ _) or about 50-100 ng of serum proteins (1 -3 nanoliters) into the nanoLC-MS system.
  • the precursor m/z of each target peptide ion was selected in the ion trap (and the remaining unrelated ions were discarded) at the specified elution time for the target, followed by collision induced dissociation (CID) fragmentation, and selection of only the desired fragment ions in the ion trap for monitoring by the detector.
  • CID collision induced dissociation
  • raw files generated by the LTQ were converted to the standard mass spectrometry data format mzXML and intensities were extracted using an in- house software called Q-MRM (Quantitative-MRM; see Haqqani et al. 2013), which is a modified version of MatchRx software.
  • V H H extracted-ion chromatograms were generated for each of its fragment ion that consisted of combined intensities within 0.25 Da of the fragment m/z over the entire elution time. To obtain a final intensity value for each fragment, all intensities within 0.5 min of the expected retention times were summed.
  • a V H H was defined as detectable in a sample if the fragments of at least one of its peptides showed the expected intensity ratios, i.e., the final intensity values showed a strong Pearson correlation r >0.95 and p ⁇ 0.05 compared with the final intensities values of its corresponding pure V H H.
  • V H H medium, serum, CSF
  • the digests were acidified with acetic acid (5% final concentration) and analyzed on a reversed-phase nanoAcquity UPLC (Waters, Milford, MA) coupled to LTQ XL ETD or LTQ Orbitrap ETD mass spectrometer (ThermoFisher, Waltham, MA). The desired aliquot of the sample was injected and loaded onto a 300 ⁇ I.D.
  • PepMaps C18 trap (ThermoFisher) then eluted onto a 100 ⁇ I.D. x 10 cm 1 .7 ⁇ BEH130C18 nanoLC column (Waters) using a gradient from 0% - 20% acetonitrile (in 0.1 % formic) in 1 minute, 20% - 46% in 16 min, and 46% - 95% in 1 min at a flow rate of 400 nL/min.
  • the eluted peptides were ionized into the mass spectrometer by electrospray ionization (ESI) for MS/MS and SRM analysis using CID for fragmentation of the peptide ions.
  • ESI electrospray ionization
  • the CID was performed with helium as collision gas at normalized collision energy of 35% and 30 ms of activation time. Ion injection times into linear ion trap were adjusted by the instrument using an automatic gain control (AGC) target value of 6 x 10 3 and a maximum accumulation time of 200 ms.
  • AGC automatic gain control
  • the P app value is commonly used to determine the ability of a molecule to cross the BBB.
  • P app values are a measure of the specific permeability of the compound across brain endothelial monolayer.
  • FC5 constructs The specific peptides used for detection and quantification of FC5 constructs are shown in Table 1 below.
  • FC5-mFc-ABP crossed the blood brain barrier as effectively as FC5-mFc, whereas Fc-ABP without the BBB carrier moiety FC5 did not traverse across the brain endothelial cell monolayer.
  • control single domain antibodies EG2 and A20.1 or control full IgG (anti-HEL) did not cross the blood brain barrier.
  • humanized FC5(H3)-hFc-ABP fusion protein FIGG. 4C and FIG. 4D.
  • IGF1 R5-mFc-ABP ABP Fig 17 A and B).
  • FC5-mFc-ABP was administered intravenously into rats via tail vein at the indicated doses (2.5, 6.25, 12.5, and 25 mg/kg). Serum and CSF were serially collected. FC5-Fc-ABP levels were quantified using nanoLC- MRM method. The technique used for multiple sampling of cisterna magna CSF was developed at NRC by modification of previously described methods (Huang et al.,1995; Kornhuber et al., 1986)). All animals were purchased from Charles River Laboratories International, Inc.
  • test antibodies FC5 Fc-fusions
  • CSF sample collections were made from cisterna magna by needle puncture up to five times over 96 hours.
  • rats were briefly and lightly anesthetized with 3% isoflurane, placed in a stereotaxic frame with the head rotated downward at a 45° angle.
  • a 2-cm midline incision between the ears beginning at the occipital crest was made and muscles separated to expose dura mater covering cisternae magna.
  • a 27G butterfly needle (QiuckMedical, Cat# SV27EL) with tubing attached to 1 ml syringe was used to puncture dura and aspirate the ⁇ 20 ⁇ of CSF. The CSF was then transferred into the sample glass vial (Waters, Cat#186000384c) and placed in -80°C freezer until further analysis.
  • Blood samples were collected from the tail vein in a commercially available tube (BD microtainer, Cat# 365956). After clotting at room temperature for 15-30 minutes, the clot was removed by centrifuging at 1 100 rcf (3422rpm) for 10 min; serum was then transferred into a clean glass vial (Waters, Cat#186000384c), frozen on dry ice and stored at -80°C until further analysis. At the end of collection, rats were sacrificed by cardiac puncture. Blood and CSF PK analyses were performed using WnLin 6.0 program.
  • Serum and CSF samples were analyzed by mass spectrometry and nanoLC-SRM based quantification as described in Example 4 using peptide signatures shown in Table 1 .
  • FC5-mFc-ABP appeared in the CSF in a time- and dose-dependent manner with Cmax between 12 and 24 h, indicating transport of ABP by FC5 into brain and CSF compartments in vivo (A).
  • Serum PK parameters show that alpha- and beta- half-life of FC5-mFc-ABP is similar to that of a full IgG (a benchmark antibody containing rat Fc) and is substantially higher than that of ABP or FC5 or FC5-ABP without Fc.
  • Dose range 2.5 mg3 ⁇ 4g. 6 nig kg, 1 ' 2 . mg kg, 25 mg kg,
  • FC5-mFc-ABP Serum and CSF PK profile of FC5-mFc-ABP was assessed in beagle dog.
  • FC5-mFc-ABP was administered by intravenous injection to 10-12-year old beagle dogs and serum and CSF were serially collected and analyzed by nanoLC-MRM (left panel) and by Western blot using Fc- specific antibody (FIG. 6B) as described above in Example 5.
  • Asterisks indicates blood- contaminated sample (not shown in MRM analyses).
  • FC5-mFc-ABP appeared in the CSF in a time-dependent manner indicating transport of ABP by FC5 across dog blood brain barrier in vivo, confirming the translational nature of the BBB carrier.
  • the PK parameters and CSF exposure were analyzed by WinNonlin software and are shown in Table 3 below.
  • FC5-hFc-ABP BBB permeability and CSF appearance of FC5 fused with human Fc (hFc) and chemically linked to ABP (FC5-hFc-ABP) in vivo (rat model).
  • FC5-hFc was linked with ABP-cystamide using a heterobifunctional cross-linker sulfo-SMCC (sulfosuccinimidyl 4-[N-maleimidomethyl] cyclohexane-1 -carboxylate) according manufacurer's instructions (ThermoFisher Scientific).
  • Chemically conjugated molecule was administered intravenously into rats via tail vein at 6.25 mg/kg and serum and CSF samples were collected at 4 and 24 hrs and analyzed as described in Fig. 5.
  • FC5-hFc-ABP appears in the CSF in a time-dependent manner, however Fc-ABP without the BBB carrier does not, confirming FC5-mediated transport of ABP across the blood brain barrier
  • FC5-Fc-ABP constructs of Example 2 transmigrate the blood brain barrier and penetrate the brain parenchyma in vivo was assessed in mice.
  • FC5-mFc-L-ABP was administered by intravenous injection via tail vein at either 15 mg/kg to wild type (WT) and AD-transgenic (AD-Tg, B6.Cg-Tg, Jackson Lab) mice (Fig. 8A and 8B) or at 7.5, 15 and 30 mg/kg to AD-Tg mice, and circulated for 4 and 24h.
  • Mice were then thoroughly perfused with 10 ml of heparinized (100U/ml) saline at a rate of 1 ml/min via the left common carotid artery to facilitate specific perfusion of the brain. Brains were then removed, and hippocampal and cortical tissues were dissected and immediately frozen and stored at - 80°C until use.
  • Frozen tissue was homogenized in ice-cold homogenization buffer containing 50 mM Tris-HCI pH 8, 150 mM NaCI and protease inhibitor cocktail (Sigma-Aldrich, Oakville, ON) using Dounce homogenizer (10-12 stroke at 4°C). Samples were then sonicated three times for 10 s each at 4°C and insoluble material was removed (10,000 xg for 10 min at 4°C). The supernatant was analyzed for protein content, and about 0.5 ⁇ g of protein was used for SRM analysis (Fig. 8A) using methods described in Example 4 and peptide signatures shown in Table 1 . Samples were also analysed by Western blot using mFc-specific antibodies (FIG. 8B and 8C).
  • FC5 Specific "signature" peptides belonging to all the three components of the fusion molecule (FC5, Fc and ABP) were detected by MRM in both cortex and hippocampus, indicating that FC5 carrier successfully delivered ABP to the target areas of the brain (only data from FC5 peptide is shown in Fig 8A). Measured levels ranged between 750-1400 ng/g brain tissue at different time points, compared to ⁇ 50 ng/g tissue typically measured for control single-domain antibody A20.1 fused to Fc, or Fc fragment alone. This was further confirmed by Western blot analysis probing for Fc and ABP in tissue extracts (8B and 8C). No protein signal of the fusion molecule was detected in animals receiving just saline by Western blot.
  • FC5-mFc-ABP levels There was a dose-dependent increase in FC5-mFc-ABP levels detected by Western blot in the target regions of the brain (FIG. 8C). These results clearly indicate that FC5 successfully delivers ABP to the target regions of the brain (i.e., the hippocampus and cortex) in wild type (WT) and AD-Tg mice.
  • WT wild type
  • AD-Tg mice Example 9: Clearance of ⁇ from mouse brain
  • FIG. 9A Comparison between treatment with ABP alone (FIG.9A) or ABP fused with BBB carrier FC5 (FIG. 9B and 9C).
  • Two different AD Tg mouse models triple transgenic (3X Tg-AD, sv129/ C57BL6 mice harboring PS1 M146V, APP Swe and tauP301 L transgenes, Dr. F.M. LaFerla, University of California) and double transgenic (B6.Cg-Tg, harboring PSEN1 dE9 and APP Sw e transgenes, Jackson Lab) were used; mice were dosed subcutaneously (sc) with 300 nmol/kg of free ABP every second day over a 3-month or a 2-month period, respectively.
  • sc subcutaneously
  • ⁇ levels in the brain were measured by ELISA using a commercial assay kit (InVitrogen, KHB3544) according to manufacturer's assay procedure.
  • the treatment with ABP alone resulted in 25-50% reduction in brain ⁇ after 2-3 months of multiple treatments (every second day) (9A).
  • the FC5-mFc-ABP construct was injected intravenously into double-transgenic AD mice (B6.Cg-Tg ,15 mg/kg; equivalent of 220 nmol/kg) and brain ⁇ levels were measured by both ELISA and nanoLC-MRM 24 h after injection as described above in Example 8.
  • FC5-ABP FC5 SEQ ID NO 17; and ABP SEQ ID NO 36
  • FC5-hFc-ABP FC5 SEQ ID NO 17; hFc 1x7 SEQ ID NO 40 and ABP SEQ ID NO 36
  • FC5-ABP and FC5-Fc-ABP constructs were produced in CHO cells as described in Example 2.
  • Serum PK was determined as described in Example 5.
  • FC5-ABP and FC5-Fc-ABP constructs were administered intravenously into rat tail vein at 15mg/kg. Serum was serially collected and FC5-ABP and FC5-Fc-ABP levels were quantified by direct ELISA using FC5- and ABP-specific antibodies.
  • Serum samples were diluted (1 :5,000) in phosphate-buffered saline (PBS) and applied to Maxisorb plates and incubated overnight at 4°C.
  • ELISA plates were washed 3 X 100 ⁇ PBS and blocked with 1 % BSA in TBST for 30 min at room temperature (RT). Blocking solution was removed and the plates were incubated with HRP-conjugated FC5 monoclonal antibody (90 min). Following incubation and wash, 100 ⁇ SureBlue reagent was added and incubated in the dark at RT for 10-15 min. At the end of reaction, 100 ⁇ 1 M HCI was added and the developed colour was read at 450 nm in a plate reader.
  • FC5-ABP without Fc was very rapidly cleared in the serum (within an hr) compared to FC5-ABP construct containing Fc component (FC5-Fc-ABP).
  • This assay was also repeated with ABP-specific antibody with similar results.
  • ELISA plates were incubated first with ABP rabbit polyclonal antibody (90 min), followed by HRP-conjugated rabbit secondary antibody (30 min) and the bound antibody was detected as described above (data not shown).
  • Example 11 Clearance of ⁇ from rat brain
  • AD-Tg rats were dosed with either saline or FC5-mFc-ABP via tail vein every week over a period of four weeks (loading dose of 30mg/kg and subsequent four weekly doses of 15 mg/kg).
  • CSF levels of FC5-mFc-ABP and ⁇ were analyzed by nanoLC MRM. Before and after four weeks of treatment, brain ⁇ levels were determined by PET scan using a specific ⁇ -binding agent [18F] NAV4694.
  • FC5-mFc-ABP reduced CSF ⁇ level in rats within 24 hrs.
  • Example 12 Increased hippocampal volume and improved neuronal connectivity
  • saline- and FC5-mFc-ABP- treated Tg mice were subjected volumetric and functional Magnetic Resonance Imaging (MRI) before after the treatment.
  • Volumetric MRI (Fig. 12A) showed an increased hippocampal volume in ABP- treated Tg mice compared to saline-treated controls suggesting that ABP treatment arrested hippocampal atrophy.
  • Functional MRI (Fig. 12B) showed improved connectivity in anterior cingulated cortex in ABP-treated Tg mice compared to saline-treated controls suggesting restoration of neuronal connectivity. This data confirms the significance, efficacy and superior therapeutic advantages now provided.
  • Example 13 FC5-mFc2a-ABP treatment shows decreased levels of CSF ⁇ in dogs
  • FC5-mFc-ABP serum and CSF PK profile of FC5-mFc-ABP was assessed in beagle dog with two dose (15 mg/kg and 30 mg/kg.
  • CSF levels of ⁇ was also measured by nanoLC- MRM as described in Example 9.
  • FC5-mFc-ABP appeared in the CSF in a dose- and time-dependent manner (Fig 13B).
  • Tg mice and Tg rat there was a significant decrease in CSF ⁇ level that was inversely proportional to CSF FC5- mFc2a-ABP levels.
  • Example 14 Generation of ABP fusion molecule with a different BBB carrier
  • ABP was successfully fused with another humanized BBB carrier IGF1 R5 (H2). As shown in FIG. 12, the bi-functionality of the molecule was retained, ABP's ability to bind ⁇ oligomer (ELISA and overlay assays) and also IGF1 R5's ability deliver ABP across BBB model in vitro (data not shown). This clearly indicates that ABP can be fused to different BBB-crossing single-domain antibodies to be delivered to the brain.
  • Example 15 ⁇ oligomer binding by different BBB-crossing single-domain antibodv-Fc-ABP constructs
  • FC5-Fc-ABP constructs with modified ABPs site-specific mutations or removal of C- terminus portion of the molecule as indicated by SEQ ID Nos shown in Tablel . and Fig 15 are provided. As shown in Fig. 15, all constructs retained similar potency in binding ⁇ oligomers by ELISA method.
  • FC5-hFc1X7-L-ABP with specific mutations to improve stability and bio-manufacturability.
  • FC5-hFc1X7-L-ABP carrying specific mutations (ABP, SEQ ID NO 35; ABP, SEQ ID NO 36) were produced in CHO cells and separated on SDS-PGE under reducing (R) and non-reducing (NR) conditions and stained with Coomassie, blue as described in Fig 2.
  • Separated protein transferred to nitrocellulose membrane and immunoblotted with FC5-specific, hFc-specific and ABP-specific antibodies.
  • ⁇ -binding of ABP in the fusion molecule was also tested by overlay assay. Bound ⁇ was detected with ⁇ -specific antibody 6E10.
  • ABP SEQ ID NO: 35 and, ABP SEQ ID NO: 36 substantially enhanced the stability of the molecule generated, as is clearly indicated herein, for example, by a single protein band under reducing and non-reducing conditions (compare with other ABP constructs of Fig 2A, wherein double protein bands can be seen).
  • This substantial enhancement in the stability of the fusion molecule advantageously facilitates the bio-manufacturability of a homogeneous molecule.
  • Example 17 BBB permeability of various FC5-FC-L-ABP constructs and IGF1R5-FC-ABP construct in vitro.
  • BBB- crossing was assessed in in vitro rat BBB model as described in Fig 4 and molecules crossing the blood brain barrier were detected by nanoLC-MRM method. All ABP variants fused to humanized FC5 and IGF1 R carriers crossed the BBB effectively.
  • A20.1 a non-BBB permeable sdAb did not cross BBB, and likewise, ABP fused to A20.1 did not permeate the BBB (FIG. 17A).
  • Fig 17B it is shown that "finger-print" peptides for all the three components of the fusion molecule, FC5, Fc and ABP were detected by nanoLC-MRM.
  • Example 18 Humanized FC5-FC-ABP construct [FC5(H3)-hFc-ABP (with ABP SEQ ID NO: 35 and ABP SEQ ID NO: 36)1 crosses in vitro rat blood brain barrier intact. Blood brain barrier- crossing of humanized FC5-ABP fusion molecules were assessed as described in Example 4. Fusion molecules crossing the blood brain barrier were analyzed by Western blot and ELISA methods. Immunoblots were probed with hFc-specific-, and ABP-specific antibodies. Both the antibodies recognized the molecule crossing the BBB (bottom chamber) and the molecular size was identical to that of FC5-ABP fusion construct that was applied to in vitro BBB (top chamber) indicating that the molecule that crossed the BBB remained intact. This was substantiated by sandwich ELISA assay where in the BBB-crossed molecule was captured with FC5-specific antibody and the captured molecule was detected with ABP antibody.
  • Example 19 Humanized FC5-FC-ABP construct [FC5(H3)-hFc-L-ABP (with ABP SEQ ID NO: 35 and ABP SEQ ID NO: 36)1 is transported across the BBB in vivo and delivered to the brain intact by FC5. Blood brain barrier-crossing and brain delivery of humanized FC5-ABP fusion molecule in mice was assessed as described in Example 8. Four hrs following intravenous administration of the molecule and intracardiac perfusion, brain was removed and the cortices were extracted in RIPA buffer and the presence of injected FC5-ABP fusion molecule was detected by Western blot probed with ABP-specific antibody and by sandwich ELISA by capturing the molecule with FC5-specific antibody and detecting with ABP-specific antibody.
  • Example 20 Ex-vivo (A) and in vivo (B) binding of humanized FC5-FC-ABP construct [FC5(H3)-hFc-ABP (ABP SEQ ID NO 361 (target engagement)
  • Sections were rinsed in PBS, treated with 3% H 2 0 2 in PBS for 30 minutes to block endogenous peroxidase, then rinsed again. Following a one hour incubation in Dako serum free protein block containing 0.3% triton X-100, sections were incubated with FC5(H3)-hFc1x7-ABP or the molar equivalent of FC5-hFc1 x7 in Dako diluent containing 0.3% triton X-100 for 90 minutes at room temperature.
  • FC5(H3)-hFc-ABP construct Similar binding of ⁇ deposits were detected following intra-hippocampal injection of FC5(H3)- hFc-ABP construct into AD transgenic mice (B). Four hours after intra-hippocampal injection, Tg mice were perfused and the brains were removed and sectioned. FC5(H3)-hFc-ABP binding to ⁇ deposits (shiny white dots) were visualised with ABP-specific polyclonal antibody. Brain sections were first incubated with ABP-specific monoclonal antibody followed by Alexa-647 conjugated anti rabbit-Fc secondary antibody
  • Example 21 Target engagement by humanized FC5-Fc-ABP construct (FC5(H3)-hFc-ABP [SEQ ID NO: 46) in vivo.
  • Fluorophore-labelled (FIG.18A) or naive FC5-ABP (FIG 18B) fusion molecule was microinjected into the hippocampal region of wild-type (Wt) and AD-Tg (Tg) mice. 30 min after microinjection of fluorophore-labelled FC5-ABP fusion molecule, brains were removed, sectioned and observed under fluorescence microscope.
  • injected molecule bound to ⁇ deposits as confirmed by its co-localization with AB-specific antibody.
  • FC5-ABP fusion molecule In a parallel study, four hrs after intra-hippocampal injection of naive FC5-ABP fusion molecule, hippocampal formation from injected (ips) and non-injected (con) regions were collected and homogenized in Tris-buffered saline. Hippocampal extracts were subjected to sandwich ELISA with FC5 antibody as capturing antibody and either ABP or AB-specific antibody as detection antibody. As shown in 21 B, microinjected FC5-ABP molecule remained intact and ABP was able to engage and bind the target ⁇ in vivo as indicated by the presence of AB in the pulled-down complex detected by AB-specific antibody.
  • Example 22 PK/PD comparison between non-humanized and humanized FC5-Fc-L-ABP constructs
  • FC5-mFc2a-ABP or FC5(H3)-hFc1 x7-ABP was administered intravenously into rats via tail vein injection at 15 mg/kg as described for Fig 5. Serum and CSF were serially collected. FC5- Fc-ABP levels were quantified using nanoLC- MRM method. As shown in Fig 22 A, serum and CSF PK profile were very similar for non-humanized and humanized constructs. FC5-mFc2a- ABP or FC5(H3)-hFc1 x7-ABP was administered intravenously into Tg mice via tail vein injection at 15 mg/kg as described for Fig 9B.
  • FC5-Fc-ABP and AB levels in the CSF were measured by nanoLC-MRM as described in Fig 9B. As shown in Fig 22 B, the levels of non- humanized and humanized FC5-Fc-ABP in the CSF were similar, and most importantly, changes (decrease) in CSF AB levels were also very similar, indicating that humanization of FC5-Fc-ABP construct did not affect the PK and PD profile of the fusion construct.
  • X 2 A or E
  • X 3 F or V
  • X 4 E or G
  • X 5 R or L
  • X 6 F or W
  • X 7 L or V;
  • X- is E or Q
  • X 2 is K or Q
  • X 3 is V or E
  • X is A or P
  • X 5 is V or A
  • X-i is E or Q
  • X 2 is K or Q
  • X 3 is V or E
  • X is A or P
  • X 5 is A or E
  • Xi7 is K or R
  • 8 is A or S
  • X-ig is L or Q
  • X-i is E or Q
  • X 2 is K or Q
  • X 3 is V or E
  • X 4 is A or P
  • X 5 is V or S
  • X12 is G or N; X-
  • A; Xi7 is S or Y; and X-
  • AEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTL ISRTPEVTCV Human FdXO VVDVSHEGPEVKFNWHVDGVEVHNAKTKPREEQYNSTYRVVSVLTVL HQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSV HEGLHNHYTQK SLSLSPG
  • LGGPSVFLFPPKPKDTL ISRTPEVTCVVVDVSHEGPEVKFNWYVDGV
  • LGGPSVFLFPPKPKDTL ISRTPEVTCVVVDVSHEGPEVKFNWYVDGV

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Immunology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Engineering & Computer Science (AREA)
  • Biomedical Technology (AREA)
  • Neurology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Neurosurgery (AREA)
  • Toxicology (AREA)
  • Epidemiology (AREA)
  • Zoology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Hospice & Palliative Care (AREA)
  • Psychiatry (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Dermatology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicinal Preparation (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
PCT/IB2018/050576 2017-01-30 2018-01-30 Blood-brain barrier transmigrating compounds and uses thereof Ceased WO2018138709A1 (en)

Priority Applications (21)

Application Number Priority Date Filing Date Title
AU2018212860A AU2018212860A1 (en) 2017-01-30 2018-01-30 Blood-brain barrier transmigrating compounds and uses thereof
KR1020247019801A KR20240095466A (ko) 2017-01-30 2018-01-30 혈액-뇌 장벽을 관통이동하는 화합물 및 이의 용도
JP2019541280A JP7449092B2 (ja) 2017-01-30 2018-01-30 血液脳関門移動化合物及びその使用
CN201880015949.5A CN110382522B (zh) 2017-01-30 2018-01-30 血脑屏障穿过化合物及其用途
EP18745446.7A EP3574002A4 (en) 2017-01-30 2018-01-30 BLOOD ENCEPHALIC BARRIER MIGRATION AGENTS AND ASSOCIATED USES
CA3052058A CA3052058A1 (en) 2017-01-30 2018-01-30 Blood-brain barrier transmigrating compounds and uses thereof
US16/481,898 US11702466B2 (en) 2017-01-30 2018-01-30 Fusion protein comprising a blood-brain barrier (BBB)-crossing single domain antibody Fc5, an immunoglobulin Fc fragment and a beta-amyloid binding polypeptide (ABP)
KR1020197025302A KR102676279B1 (ko) 2017-01-30 2018-01-30 혈액-뇌 장벽을 관통이동하는 화합물 및 이의 용도
CA3089816A CA3089816A1 (en) 2017-01-30 2018-07-31 Blood-brain barrier transmigrating compounds and uses thereof
JP2020561952A JP7458327B2 (ja) 2017-01-30 2018-07-31 血液脳関門移動化合物及びその使用
KR1020207025008A KR20200116143A (ko) 2017-01-30 2018-07-31 혈액-뇌 장벽을 관통이동하는 화합물 및 이의 용도
CN201880091218.9A CN111886240A (zh) 2017-01-30 2018-07-31 血脑屏障迁移化合物及其用途
AU2018405992A AU2018405992A1 (en) 2017-01-30 2018-07-31 Blood-brain barrier transmigrating compounds and uses thereof
EP18904229.4A EP3746460A4 (en) 2017-01-30 2018-07-31 COMPOUNDS CROSSING THE BLOOD-BRAIN BARRIER AND THEIR USES
PCT/IB2018/055747 WO2019150183A1 (en) 2017-01-30 2018-07-31 Blood-brain barrier transmigrating compounds and uses thereof
US16/965,885 US20230257424A1 (en) 2017-01-30 2018-07-31 Blood-brain barrier transmigrating compounds and uses thereof
AU2022202015A AU2022202015B2 (en) 2017-01-30 2022-03-23 Blood-brain barrier transmigrating compounds and uses thereof
US18/183,812 US20230279088A1 (en) 2017-01-30 2023-03-14 Fusion protein comprising a blood-brain barrier (bbb)-crossing single domain antibody fc5, an immunoglobulin fc fragment and a beta-amyloid binding polypeptide (abp)
JP2023094278A JP2023123535A (ja) 2017-01-30 2023-06-07 血液脳関門移動化合物及びその使用
JP2024031648A JP2024081644A (ja) 2017-01-30 2024-03-01 血液脳関門移動化合物及びその使用
AU2024201813A AU2024201813A1 (en) 2017-01-30 2024-03-20 Blood-brain barrier transmigrating compounds and uses thereof

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201762452015P 2017-01-30 2017-01-30
US62/452,015 2017-01-30
US201762530980P 2017-07-11 2017-07-11
US62/530,980 2017-07-11

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US16/481,898 A-371-Of-International US11702466B2 (en) 2017-01-30 2018-01-30 Fusion protein comprising a blood-brain barrier (BBB)-crossing single domain antibody Fc5, an immunoglobulin Fc fragment and a beta-amyloid binding polypeptide (ABP)
US18/183,812 Division US20230279088A1 (en) 2017-01-30 2023-03-14 Fusion protein comprising a blood-brain barrier (bbb)-crossing single domain antibody fc5, an immunoglobulin fc fragment and a beta-amyloid binding polypeptide (abp)

Publications (1)

Publication Number Publication Date
WO2018138709A1 true WO2018138709A1 (en) 2018-08-02

Family

ID=62977950

Family Applications (2)

Application Number Title Priority Date Filing Date
PCT/IB2018/050576 Ceased WO2018138709A1 (en) 2017-01-30 2018-01-30 Blood-brain barrier transmigrating compounds and uses thereof
PCT/IB2018/055747 Ceased WO2019150183A1 (en) 2017-01-30 2018-07-31 Blood-brain barrier transmigrating compounds and uses thereof

Family Applications After (1)

Application Number Title Priority Date Filing Date
PCT/IB2018/055747 Ceased WO2019150183A1 (en) 2017-01-30 2018-07-31 Blood-brain barrier transmigrating compounds and uses thereof

Country Status (8)

Country Link
US (3) US11702466B2 (https=)
EP (2) EP3574002A4 (https=)
JP (4) JP7449092B2 (https=)
KR (3) KR102676279B1 (https=)
CN (2) CN110382522B (https=)
AU (4) AU2018212860A1 (https=)
CA (2) CA3052058A1 (https=)
WO (2) WO2018138709A1 (https=)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2020092202A3 (en) * 2018-10-29 2020-07-23 Biogen Ma Inc. Humanized and stabilized fc5 variants for enhancement of blood brain barrier transport
JP2023502968A (ja) * 2019-11-15 2023-01-26 ユニバーシティ オブ テネシー リサーチ ファウンデーション アミロイド沈着物を標的化するための修飾免疫グロブリン
US11702466B2 (en) 2017-01-30 2023-07-18 National Research Council Of Canada Fusion protein comprising a blood-brain barrier (BBB)-crossing single domain antibody Fc5, an immunoglobulin Fc fragment and a beta-amyloid binding polypeptide (ABP)

Families Citing this family (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN111201030B (zh) 2017-07-25 2024-11-01 真和制药有限公司 通过阻断tim-3和其配体的相互作用治疗癌症
WO2020160156A2 (en) 2019-01-30 2020-08-06 Immutics, Inc. Anti-gal3 antibodies and uses thereof
EP4157338A4 (en) 2020-05-26 2024-11-13 TrueBinding, Inc. METHOD FOR TREATING INFLAMMATORY DISEASES BY GALECTIN-3 BLOCKING
CA3217756A1 (en) * 2021-05-05 2022-11-10 Jonathan S. Wall Peptide-fc fusions for treating amyloid disorders
JP2024521082A (ja) 2021-05-18 2024-05-28 ユニバーシティ オブ テネシー リサーチ ファウンデーション アミロイド障害を処置するための抗体-ペプチド融合タンパク質
KR102475326B1 (ko) * 2022-01-27 2022-12-07 한국기초과학지원연구원 신규한 펩타이드 유사체 및 이를 포함하는 알츠하이머 병 예방 조성물

Family Cites Families (27)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5385915A (en) 1990-05-16 1995-01-31 The Rockefeller University Treatment of amyloidosis associated with Alzheimer disease using modulators of protein phosphorylation
US5874239A (en) 1993-07-30 1999-02-23 Affymax Technologies N.V. Biotinylation of proteins
WO2001088088A2 (en) 2000-05-18 2001-11-22 Hyseq, Inc. Novel nucleic acids and polypeptides
US20030190598A1 (en) * 2000-05-26 2003-10-09 Jasmid Tanha Single-domain antigen-binding antibody fragments derived from llama antibodies
CA2441903C (en) * 2000-05-26 2012-07-31 National Research Council Of Canada Single-domain brain-targeting antibody fragments derived from llama antibodies
AU2002304814A1 (en) 2001-03-14 2002-11-05 Hybrigenics Protein-protein interactions in adipocytes
US20040142325A1 (en) * 2001-09-14 2004-07-22 Liat Mintz Methods and systems for annotating biomolecular sequences
JP2003135075A (ja) * 2001-11-05 2003-05-13 Research Association For Biotechnology 新規な全長cDNA
CN100335900C (zh) 2001-11-30 2007-09-05 加拿大国家研究局 新的自组装分子
EP1452601A1 (en) 2003-02-28 2004-09-01 Roche Diagnostics GmbH Enhanced expression of fusion polypeptides with a biotinylation tag
WO2005103716A2 (en) * 2004-04-27 2005-11-03 Galapagos N.V. Methods, agents, and compound screening assays for inducing differentiation of undifferentiated mammalian cells into osteoblasts
ATE439443T1 (de) * 2005-06-17 2009-08-15 Ca Nat Research Council NEUES Aß-BINDUNGSPROTEIN UND DESSEN PEPTIDDERIVATE SOWIE VERWENDUNGEN DAVON
WO2007036022A1 (en) 2005-09-27 2007-04-05 National Research Council Of Canada Targeted delivery of compounds using multimerization technology
TW200907056A (en) * 2007-03-28 2009-02-16 Astrazeneca Ab New method
CA2796215C (en) 2010-04-14 2021-05-18 National Research Council Of Canada Compositions and methods for brain delivery of analgesic peptides
US20110269735A1 (en) * 2010-04-19 2011-11-03 Celera Corporation Genetic polymorphisms associated with statin response and cardiovascular diseases, methods of detection and uses thereof
PL2621955T3 (pl) 2010-10-01 2018-07-31 National Research Council Of Canada Przeciwciała anty-CEACAM6 i ich zastosowania
US9676849B2 (en) * 2012-01-10 2017-06-13 Biogen Ma Inc. Enhancement of transport of therapeutic molecules across the blood brain barrier
HUE045144T2 (hu) 2012-08-29 2019-12-30 Hoffmann La Roche Véragygát-shuttle
PE20170088A1 (es) 2014-03-06 2017-03-09 Nat Res Council Canada Anticuerpos especificos del receptor del factor 1 de crecimiento similar a la insulina y usos de los mismos
DK3114141T3 (da) 2014-03-06 2020-08-10 Nat Res Council Canada Insulinlignende vækstfaktor 1-receptor-specifikke antistoffer og anvendelse deraf
NZ724869A (en) * 2014-03-06 2022-07-01 Nat Res Council Canada Insulin-like growth factor 1 receptor -specific antibodies and uses thereof
ES2924282T3 (es) * 2014-12-19 2022-10-05 Medimmune Ltd Moléculas de transporte a través de la barrera hematoencefálica y usos de las mismas
US20200231652A1 (en) 2015-08-31 2020-07-23 National Research Council Of Canada Tgf-b-receptor ectodomain fusion molecules and uses thereof
BR112019000220A2 (pt) * 2016-07-06 2019-04-24 National Research Council Of Canada anticorpos humanizados que transmigram a barreira hematoencefálica e usos dos mesmos
WO2018109663A1 (en) 2016-12-12 2018-06-21 National Research Council Of Canada Antibody variants transmigrating the blood-brain barrier and uses thereof
WO2018138709A1 (en) 2017-01-30 2018-08-02 National Research Council Of Canada Blood-brain barrier transmigrating compounds and uses thereof

Non-Patent Citations (5)

* Cited by examiner, † Cited by third party
Title
CHAKRAVARTHY, B ET AL.: "A synthetic peptide corresponding to a region of the human pericentriolar material 1 (PCM-1) protein binds fj-amyloid (Abeta1-42 ) oligomers", J NEUROCHEM, vol. 126, no. 3, August 2013 (2013-08-01), pages 415 - 424, XP055530455, ISSN: 0022-3042 *
CHAKRAVARTHY, B ET AL.: "Brain delivery of an amyloid-beta oligomer (AbetaO)-targetin, peptide-therapeutic by a novel blood-brain barrier (BBB)-crossing domain antibody", ALZHEIMER'S AND DEMENTIA, vol. 13, no. 7, July 2017 (2017-07-01), pages P625, XP055551102, Retrieved from the Internet <URL:https://doi.org/10.1016/jjalz.2017.06.703> [retrieved on 20180430] *
CHAKRAVARTHY, B ET AL.: "Evidence that a synthetic amyloid-beta oligomer-binding peptide (ABP) targets amyloid-b deposits in transgenic mouse brain and human Alzheimer's disease brain", BIOCHEM BIOPHYS RES COMMUN, vol. 445, no. 3, 14 March 2014 (2014-03-14), pages 656 - 660, XP028633197, ISSN: 0006-291X *
PARDRIDGE, W.M: "Re-engineering therapeutic antibodies for Alzheimer's disease as blood-brain barrier penetrating bispecific antibodies", EXPERT OPINION ON BIOLOGICAL THERAPY, vol. 16, no. 12, December 2016 (2016-12-01), pages 1455 - 1468, XP055551124, ISSN: 1471-2598, Retrieved from the Internet <URL:https://doi.org/10.1080/14712598.2016.1230195> *
SUMBRIA, RK ET AL.: "Disaggregation of amyloid plaque in brain of Alzheimer's Diseas transgenic mice with daily subcutaneous administration of a tetravalent bispecific antibody the targets the transferrin receptor and the Abeta amyloid peptide", MOL. PHARMACEUTICS, vol. 10, 7 August 2013 (2013-08-07), pages 3507 - 3513, XP055167129, ISSN: 1543-8384 *

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11702466B2 (en) 2017-01-30 2023-07-18 National Research Council Of Canada Fusion protein comprising a blood-brain barrier (BBB)-crossing single domain antibody Fc5, an immunoglobulin Fc fragment and a beta-amyloid binding polypeptide (ABP)
WO2020092202A3 (en) * 2018-10-29 2020-07-23 Biogen Ma Inc. Humanized and stabilized fc5 variants for enhancement of blood brain barrier transport
CN113508135A (zh) * 2018-10-29 2021-10-15 比奥根Ma公司 增强血脑屏障转运的人源化和稳定化的fc5变体
JP2022509372A (ja) * 2018-10-29 2022-01-20 バイオジェン・エムエイ・インコーポレイテッド 血液脳関門輸送の促進のためのヒト化され安定化されたfc5バリアント
JP2023502968A (ja) * 2019-11-15 2023-01-26 ユニバーシティ オブ テネシー リサーチ ファウンデーション アミロイド沈着物を標的化するための修飾免疫グロブリン
JP7722990B2 (ja) 2019-11-15 2025-08-13 ユニバーシティ オブ テネシー リサーチ ファウンデーション アミロイド沈着物を標的化するための修飾免疫グロブリン

Also Published As

Publication number Publication date
EP3574002A1 (en) 2019-12-04
CN111886240A (zh) 2020-11-03
US20230279088A1 (en) 2023-09-07
CA3089816A1 (en) 2019-08-08
CN110382522B (zh) 2024-08-30
AU2022202015B2 (en) 2023-12-21
JP2024081644A (ja) 2024-06-18
JP2023123535A (ja) 2023-09-05
AU2018405992A1 (en) 2020-08-20
US20230257424A1 (en) 2023-08-17
EP3746460A4 (en) 2022-04-20
KR20240095466A (ko) 2024-06-25
JP7449092B2 (ja) 2024-03-13
EP3574002A4 (en) 2021-04-21
JP7458327B2 (ja) 2024-03-29
AU2024201813A1 (en) 2024-04-11
CN110382522A (zh) 2019-10-25
KR102676279B1 (ko) 2024-06-20
JP2020505926A (ja) 2020-02-27
KR20190112768A (ko) 2019-10-07
WO2019150183A1 (en) 2019-08-08
JP2021512159A (ja) 2021-05-13
AU2022202015A1 (en) 2022-04-14
KR20200116143A (ko) 2020-10-08
US20190352383A1 (en) 2019-11-21
CA3052058A1 (en) 2018-08-02
AU2018212860A1 (en) 2019-08-15
US11702466B2 (en) 2023-07-18
EP3746460A1 (en) 2020-12-09

Similar Documents

Publication Publication Date Title
AU2022202015B2 (en) Blood-brain barrier transmigrating compounds and uses thereof
AU2022252753B2 (en) ANTIBODIES TO a-SYNUCLEIN AND USES THEREOF
KR102355310B1 (ko) 인슐린-유사 성장 인자 1 수용체-특이적 항체 및 그의 용도
KR102355308B1 (ko) 인슐린-유사 성장 인자 1 수용체-특이적 항체 및 그의 용도
CN111886251A (zh) 抗a-syn/igf1r的双特异性抗体及其用途
US10906973B2 (en) Antibody variants transmigrating the blood-brain barrier and uses thereof
CN117024589A (zh) 抗a-syn/igf1r的双特异性抗体及其用途
CA3098162A1 (en) Blood-brain barrier transmigrating therapeutic compounds and uses thereof
CA3046906C (en) Antibody variants transmigrating the blood-brain barrier and uses thereof
HK40022840B (zh) 抗α-突触核蛋白抗体及其用途

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18745446

Country of ref document: EP

Kind code of ref document: A1

DPE1 Request for preliminary examination filed after expiration of 19th month from priority date (pct application filed from 20040101)
ENP Entry into the national phase

Ref document number: 3052058

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2019541280

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2018212860

Country of ref document: AU

Date of ref document: 20180130

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20197025302

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2018745446

Country of ref document: EP

Effective date: 20190830