WO2018078123A1 - Combination of anti cd19 antibody with a bcl-2 inhibitor and uses thereof - Google Patents

Combination of anti cd19 antibody with a bcl-2 inhibitor and uses thereof Download PDF

Info

Publication number
WO2018078123A1
WO2018078123A1 PCT/EP2017/077654 EP2017077654W WO2018078123A1 WO 2018078123 A1 WO2018078123 A1 WO 2018078123A1 EP 2017077654 W EP2017077654 W EP 2017077654W WO 2018078123 A1 WO2018078123 A1 WO 2018078123A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
sequence
venetoclax
combination
antibody
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2017/077654
Other languages
English (en)
French (fr)
Inventor
Jan Endell
Konstantin PETROPOULOS
Peter Kelemen
Rainer Boxhammer
Markus Rückert
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Morphosys AG
Original Assignee
Morphosys AG
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to SM20210347T priority Critical patent/SMT202100347T1/it
Priority to AU2017348624A priority patent/AU2017348624B2/en
Priority to SI201730811T priority patent/SI3532098T1/sl
Priority to DK17797564.6T priority patent/DK3532098T3/da
Priority to EP21165598.0A priority patent/EP3903821A1/en
Priority to IL301786A priority patent/IL301786B2/en
Priority to IL266216A priority patent/IL266216B2/en
Priority to MX2019004942A priority patent/MX2019004942A/es
Priority to CN202410183851.8A priority patent/CN118045175A/zh
Priority to US16/342,645 priority patent/US12358983B2/en
Priority to LTEP17797564.6T priority patent/LT3532098T/lt
Priority to EP17797564.6A priority patent/EP3532098B1/en
Priority to PL17797564T priority patent/PL3532098T3/pl
Priority to RU2019113370A priority patent/RU2756405C2/ru
Priority to ES17797564T priority patent/ES2871574T3/es
Priority to KR1020197012532A priority patent/KR102500868B1/ko
Priority to BR112019008244-1A priority patent/BR112019008244A2/pt
Application filed by Morphosys AG filed Critical Morphosys AG
Priority to CN201780067047.1A priority patent/CN109890418B/zh
Priority to JP2019522273A priority patent/JP7094950B2/ja
Priority to RS20210792A priority patent/RS62036B1/sr
Priority to NZ751414A priority patent/NZ751414A/en
Priority to IL320372A priority patent/IL320372A/en
Priority to KR1020237005018A priority patent/KR20230028571A/ko
Priority to CA3037246A priority patent/CA3037246A1/en
Priority to HRP20210838TT priority patent/HRP20210838T1/hr
Publication of WO2018078123A1 publication Critical patent/WO2018078123A1/en
Anticipated expiration legal-status Critical
Priority to ZA2019/03302A priority patent/ZA201903302B/en
Priority to CY20211100512T priority patent/CY1124648T1/el
Priority to JP2022100006A priority patent/JP2022137089A/ja
Priority to JP2024125584A priority patent/JP2024167208A/ja
Priority to AU2024287178A priority patent/AU2024287178A1/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/496Non-condensed piperazines containing further heterocyclic rings, e.g. rifampin, thiothixene or sparfloxacin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/63Compounds containing para-N-benzenesulfonyl-N-groups, e.g. sulfanilamide, p-nitrobenzenesulfonyl hydrazide
    • A61K31/635Compounds containing para-N-benzenesulfonyl-N-groups, e.g. sulfanilamide, p-nitrobenzenesulfonyl hydrazide having a heterocyclic ring, e.g. sulfadiazine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0019Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2300/00Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]

Definitions

  • the present disclosure is related to a pharmaceutical combination of an anti-CD19 antibody and a BCL-2 inhibitor for the treatment of non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia.
  • B cells are lymphocytes that play a large role in the humoral immune response. They are produced in the bone marrow of most mammals, and represent 5-15% of the circulating lymphoid pool. The principal function of B cells is to make antibodies against various antigens, and are an essential component of the adaptive immune system.
  • lymphomas and leukemias.
  • NHL non- Hodgkin's lymphoma
  • CLL chronic lymphocytic leukemia
  • ALL acute lymphoblastic leukemia
  • NHL is a heterogeneous malignancy originating from lymphocytes.
  • U.S. United States
  • the incidence is estimated at 65,000/year with mortality of approximately 20,000 (American Cancer Society, 2006; and SEER Cancer Statistics Review).
  • the disease can occur in all ages, the usual onset begins in adults over 40 years, with the incidence increasing with age.
  • NHL is characterized by a clonal proliferation of lymphocytes that accumulate in the lymph nodes, blood, bone marrow and spleen, although any major organ may be involved.
  • the current classification system used by pathologists and clinicians is the World Health Organization (WHO) Classification of Tumours, which organizes NHL into precursor and mature B-cell or T-cell neoplasms.
  • WHO World Health Organization
  • the PDQ is currently dividing NHL as indolent or aggressive for entry into clinical trials.
  • the indolent NHL group is comprised primarily of follicular subtypes, small lymphocytic lymphoma, MALT (mucosa- associated lymphoid tissue), and marginal zone; indolent encompasses approximately 50% of newly diagnosed B-cell NHL patients.
  • Aggressive NHL includes patients with histologic diagnoses of primarily diffuse large B cell (DLBL, DLBCL, or DLCL) (40% of all newly diagnosed patients have diffuse large cell), Burkitt's, and mantle cell.
  • the clinical course of NHL is highly variable. A major determinant of clinical course is the histologic subtype. Most indolent types of NHL are considered to be incurable disease.
  • rituximab anti-CD20 antibody
  • the current standard of care for most patients is rituximab + CHOP (R-CHOP) or rituximab + CVP (R-CVP).
  • Interferon is approved for initial treatment of NHL in combination with alkylating agents, but has limited use in the U.S.
  • Rituximab therapy has been shown to be efficacious in several types of NHL, and is currently approved as a first line treatment for both indolent (follicular lymphoma) and aggressive NHL (diffuse large B cell lymphoma).
  • indolent follicular lymphoma
  • aggressive NHL diffuse large B cell lymphoma
  • mAb monoclonal antibody
  • primary resistance 50% response in relapsed indolent patients
  • acquired resistance 50% response rate upon re-treatment
  • rare complete response 2% complete resonse rate in relapsed population
  • a continued pattern of relapse a continued pattern of relapse.
  • B cells do not express CD20, and thus many B-cell disorders are not treatable using anti-CD20 antibody therapy.
  • Chronic lymphocytic leukemia also known as “chronic lymphoid leukemia” or “CLL”
  • CLL chronic lymphocytic leukemia
  • the malignant lymphocytes may look normal and mature, but they are not able to cope effectively with infection.
  • CLL is the most common form of leukemia in adults. Men are twice as likely to develop CLL as women.
  • the key risk factor is age. Over 75% of new cases are diagnosed in patients over age 50. More than 10,000 cases are diagnosed every year and the mortality is almost 5,000 a year (American Cancer Society, 2006; and SEER Cancer Statistics Review).
  • CLL is an incurable disease but progresses slowly in most cases. Many people with CLL lead normal and active lives for many years. Because of its slow onset, early-stage CLL is generally not treated since it is believed that early CLL intervention does not improve survival time or quality of life. Instead, the condition is monitored over time.
  • Initial CLL treatments vary depending on the exact diagnosis and the progression of the disease. There are dozens of agents used for CLL therapy. Combination chemotherapy regimens such as FCR (fludarabine, cyclophosphamide and rituximab), and BR (Ibrutinib and rituximab) are effective in both newly-diagnosed and relapsed CLL. Allogeneic bone marrow (stem cell) transplantation is rarely used as a first-line treatment for CLL due to its risk.
  • ALL acute lymphoblastic leukemia
  • ALL is characterised by the overproduction and continuous multiplication of malignant and immature white blood cells (also known as lymphoblasts) in the bone marrow.
  • 'Acute' refers to the undifferentiated, immature state of the circulating lymphocytes ("blasts"), and that the disease progresses rapidly with life expectancy of weeks to months if left untreated.
  • ALL is most common in childhood with a peak incidence of 4-5 years of age. Children of age 12- 16 die more easily from it than others. Currently, at least 80% of childhood ALL are considered curable. Under 4,000 cases are diagnosed every year and the mortality is almost 1 ,500 a year (American Cancer Society, 2006; and SEER Cancer Statistics Review).
  • the human CD19 molecule is a structurally distinct cell surface receptor expressed on the surface of human B cells, including, but not limited to, pre-B cells, B cells in early development ⁇ i.e., immature B cells), mature B cells through terminal differentiation into plasma cells, and malignant B cells.
  • CD 19 is expressed by most pre-B acute lymphoblastic leukemias (ALL), non-Hodgkin's lymphomas, B cell chronic lymphocytic leukemias (CLL), pro-lymphocytic leukemias, hairy cell leukemias, common acute lymphocytic leukemias, and some Null-acute lymphoblastic leukemias (Nadler et al, J.
  • CD 19 On plasma cells further suggests it may be expressed on differentiated B cell tumors such as multiple myeloma, plasmacytomas, Waldenstrom's tumors (Grossbard et al., Br. J. Haematol, 102:509- 15(1998); Treon et al, Semin. Oncol, 30:248- 52(2003)).
  • the CD 19 antigen is a target for immunotherapy in the treatment of non-Hodgkin's lymphoma (including each the subtypes described herein), chronic lymphocytic leukemia and/or acute lymphoblastic leukemia.
  • Certain CD19 therapies have been shown.
  • T cells expressing an anti-CD19 chimeric antigen receptor (CAR) including both ⁇ 3- ⁇ and the 4-BB costimulatory domain were administered to patients with advanced CLL. Kalos et al., T cells with Chimeric Antigen Receptors Have Potent Antitumor Effects and Can Establish Memory in Patients with Advanced Leukemia, Science Translational Medicine, vol. 3, no. 95 (10 August 201 1 ), which is incorporated by reference in its entirety.
  • CAR anti-CD19 chimeric antigen receptor
  • CD19 antibody in CLL, NHL and ALL is described in Scheuermann et al., CD19 Antigen in Leukemia and Lymphoma Diagnosis and Immunotherapy, Leukemia and Lymphoma, Vol. 18, 385-397 (1995), which is incorporated by reference in its entirety, but fails to suggest the combination exemplified herein.
  • VENCLEXTATM also known as GDC-0199, ABT-199, and RG7601 is a BCL-2 inhibitor indicated for the treatment of patients with chronic lymphocytic leukemia (CLL) with 17p deletion, as detected by an FDA approved test, who have received at least one prior therapy.
  • CLL chronic lymphocytic leukemia
  • Venetoclax is described in US Patent Nos. 8,546,399 and 9,174,982, which are all incorporated by reference in their entireties.
  • the present disclosure relates to a synergistic combination of an antibody specific for CD19 and a BCL-2 inhibitor.
  • Such combinations are useful in the treatment of B cell malignancies, such as, non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia.
  • MEC-1 cells (DSMZ# ACC497) are a chronic B-cell leukemia cell line. MEC-1 cells in the present in vitro model are indicative of how the combination will work in the treatment of chronic lymphoid leukemia (CLL) in humans.
  • CLL chronic lymphoid leukemia
  • the inventors found that the combination of a particular antibody specific for CD19 and venetoclax mediated a synergistic level of specific cell killing in vitro in comparison to the antibody and venetoclax alone. Specifically, the inventors found that the combination of MOR00208 and venetoclax mediated a synergistic level of specific cell killing in vitro in MEC-1 cells compared to the antibody and venetoclax alone.
  • the combination of the exemplified anti-CD19 antibody and venetoclax behaved synergistically in models relevant to CLL.
  • CLL is a B cell related disorders and CD19 is highly expressed on B-cells
  • the exemplified combination would have the same mechanism of action and should also behave synergistically in the treatment of other B cell related disorders, e.g. ALL and NHL.
  • the combination of the exemplified antibody specific for CD19 and venetoclax should be effective in the treatment of humans in non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia.
  • the expected efficacy of the combination of the antibody specific to CD19 exemplified and venetoclax will be confirmed in clinical trials.
  • anti-CD19 antibody and other anti-CD19 antibodies bind CD19, it is believed that synergy should also be seen when treating humans having non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia with a combination of any anti- CD19 antibody and a BCL-2 inhibitor, e.g., venetoclax.
  • a BCL-2 inhibitor e.g., venetoclax.
  • An aspect of the present disclosure comprises a combination wherein the antibody specific for CD19 comprises an HCDR1 region of sequence SYVMH (SEQ ID NO: 1 ), an HCDR2 region of sequence NPYNDG (SEQ ID NO: 2), an HCDR3 region of sequence GTYYYGTRVFDY (SEQ ID NO: 3), an LCDR1 region of sequence RSSKSLQNVNGNTYLY (SEQ ID NO: 4), an LCDR2 region of sequence RMSNLNS (SEQ ID NO: 5), and an LCDR3 region of sequence MQHLEYPIT (SEQ ID NO: 6) and venetoclax.
  • the combination is synergistic.
  • the combination is used for the treatment of non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia. Description of Drawings
  • Figures 1-3 shows the cytotoxicity of MOR00208 and venetoclax in combination in MEC-1 cell line. MEC-1 cells were pre-treated with venetoclax for 24 hours.
  • Figure 4 shows the amino acid sequence of the variable domains of MOR00208.
  • Figure 5 shows the amino acid sequence of the Fc regions of MOR00208.
  • Figures 6-8 show Chou-Talay Combination Index curves of MOR00208 and venetoclax in MEC-1 cell line.
  • FIG. 9 MOR00208 in combination with ABT-199 showed superior reduction of tumor growth compared to either mono therapy in a s.c. Toledo SCID mouse model.
  • Group mean values ⁇ standard error of mean (SEM) are depicted.
  • Asterics indicated statistical siginificance of the tumor doubling time of the combination treatment vs the MOR0028 single treatment or the respective ABT- 199 single treatment: * p-value ⁇ 0.05, ** p-value ⁇ 0.01 and **** p-value ⁇ 0.0001 .
  • Treatment started upon randomization at a median tumor volume of 266 mm 3 (123 - 406 mm 3 ) 23 days after tumor injection.
  • MOR00208 (1 1 mg/kg) was administered by intraperitoneal injection (i.p.) twice weekly.
  • ABT-199 (20 or 40 mg/kg) was administered by per os (p.o.) daily.
  • FIG. 10 MOR00208 in combination with ABT showed superior median survival compared to either monotherapy in a s.c. Toledo SCID mouse model.
  • the Kaplan-Meier curves depicte the survival from randomization until the humane endpoint (Tumor volume of 2000 mm 3 ). Treatment started upon randomization at a median tumor volume of 266 mm 3 (123 - 406 mm 3 ) 23 days after tumor injection.
  • MOR00208 (1 1 mg/kg) was administered by intraperitoneal injection (i.p.) twice weekly.
  • ABT-199 (20 or 40 mg/kg) was administered by per os (p.o.) daily.
  • “Synergy”, “synergism” or “synergistic” mean more than the expected additive effect of a combination.
  • the "synergy”, “synergism” or “synergistic” effect of a combination is determined herein by the methods of Chou et al., Clarke et al. and/or Webb et al. See Ting-Chao Chou, Theoretical Basis, Experimental Design, and Computerized Simulation of Synergism and Antagonism in Drug Combination Studies, Pharmacol Rev 58:621-681 (2006), which is incorporated by reference in its entirety.
  • antibody means monoclonal antibodies, including any isotype, such as, IgG, IgM, IgA, IgD and IgE.
  • An IgG antibody is comprised of two identical heavy chains and two identical light chains that are joined by disulfide bonds. Each heavy and light chain contains a constant region and a variable region. Each variable region contains three segments called “complementarity-determining regions" ("CDRs") or “hypervariable regions", which are primarily responsible for binding an epitope of an antigen. They are referred to as CDR1 , CDR2, and CDR3, numbered sequentially from the N- terminus. The more highly conserved portions of the variable regions outside of the CDRs are called the "framework regions".
  • an “antibody fragment” means an Fv, scFv, dsFv, Fab, Fab' F(ab')2 fragment, or other fragment, which contains at least one variable heavy or variable light chain, each containing CDRs and framework regions.
  • Bcl-2 (B-cell lymphoma 2), encoded in humans by the BCL2 gene, is the founding member of the Bcl-2 family of regulator proteins that regulate cell death (apoptosis), by either inducing (pro- apoptotic) or inhibiting (anti-apoptotic) apoptosis.
  • Bcl-2 is refenced by the NCBI Gene number 596.
  • Bcl-2 is specifically considered an important anti-apoptotic protein and is thus classified as an oncogene.
  • Bcl-2 derives its name from B-cell lymphoma 2, as it is the second member of a range of proteins initially described in chromosomal translocations involving chromosomes 14 and 18 in follicular lymphomas.
  • Orthologs (such as Bcl2 in mice) have been identified in numerous mammals for which complete genome data are available.
  • BCL-2 inhibitor is a class of drug that functions by inhibiting anti-apoptotic B-cell lymphoma-2 (Bcl-2) protein, leading to programmed cell death of cells.
  • BCL-2 inhibitor include venetoclax. Venetoclax is marketed by Abbvie and Genentech (trade name VENCLEXTATM, also known as GDC-0199, ABT-199, and RG7601 ). Venetoclax is currently labelled for the treatment of patients with chronic lymphocytic leukemia (CLL) with 17p deletion, as detected by an FDA approved test, who have received at least one prior therapy.
  • CLL chronic lymphocytic leukemia
  • venetoclax is 4-(4- ⁇ [2-(4- Chlorophenyl)-4,4-dimethyl-1 -cyclohexen-1 -yl]methyl ⁇ -1 -piperazinyl)-N-( ⁇ 3-nitro-4-[(tetrahydro-2H- pyran-4-ylmethyl)amino]phenyl ⁇ sulfonyl)-2-(1 H-pyrrolo[2,3-b]pyridin-5-yloxy)benzamide and has the following structure:
  • BCL-2 inhibitors include:
  • Genasense An antisense oligonucleotide drug Genasense (G3139) was developed by Genta Incorporated to target Bcl-2.
  • An antisense DNA or RNA strand is non-coding and complementary to the coding strand (which is the template for producing respectively RNA or protein).
  • An antisense drug is a short sequence of RNA that hybridises with and inactivates mRNA, preventing the protein from being formed.
  • Human lymphoma cell proliferation (with t(14;18) translocation) could be inhibited by antisense RNA targeted at the start codon region of Bcl-2 mRNA.
  • Genasense which is complementary to the first 6 codons of Bcl-2 mRNA.
  • ABT-737 and ABT-263 In the mid-2000s, Abbott Laboratories developed a novel inhibitor of Bcl-2, Bcl-xL and Bcl-w, known as ABT-737. This compound is part of a group of BH3 mimetic small molecule inhibitors (SMI) that target these Bcl-2 family proteins, but not A1 or Mcl-1 .
  • SMI BH3 mimetic small molecule inhibitors
  • ABT-737 is superior to previous BCL-2 inhibitors given its higher affinity for Bcl-2, Bcl-xL and Bcl-w.
  • In vitro studies showed that primary cells from patients with B-cell malignancies are sensitive to ABT-737. In animal models, it improves survival, causes tumor regression and cures a high percentage of mice.
  • ABT-737 showed efficacy for treating lymphoma and other blood cancers. Because of its unfavorable pharmacologic properties ABT-737 is not appropriate for clinical trials, while its derivative ABT-263 has similar activity on small cell lung cancer (SCLC) cell lines and has entered clinical trials.
  • SCLC small cell lung cancer
  • VH refers to the variable region of an immunoglobulin heavy chain of an antibody, or antibody fragment.
  • VL refers to the variable region of the immunoglobulin light chain of an antibody, or antibody fragment.
  • CD19 refers to the protein known as CD19, having the following synonyms: B4, B-lymphocyte antigen CD19, B-lymphocyte surface antigen B4, CVID3, Differentiation antigen CD19, MGC12802, and T-cell surface antigen Leu-12.
  • Human CD19 has the amino acid sequence of:
  • SIRGQPGPNHEEDADSYENMDNPDGPDPAWGGGGRMGTWSTR (SEQ ID NO: 7)
  • MOR00208 is an anti-CD19 antibody.
  • the amino acid sequence of the variable domains is provided in Figure 4.
  • the amino acid sequence of the heavy and light chain Fc regions of MOR00208 are provided in Figure 5.
  • “MOR00208” and “XmAb 5574” are used as synonyms to describe the antibody shown in Figures 4 and 5.
  • the MOR00208 antibody is described in US patent application serial number 12/377,251 , which is incorporated by reference in its entirety.
  • Fc region means the constant region of an antibody, which in humans may be of the lgG1 , 2, 3, 4 subclass or others.
  • the sequences of human Fc regions are available at IMGT, Human IGH C-REGIONs,
  • RefmAb33 is an antibody whose amino acid sequence is as follows:
  • RefmAb33 is specific for RSV, and is used as isotype control, as it shares the same Fc region as MOR00208.
  • a “combination” means more than one item, e.g. a compound such as an antibody and venetoclax.
  • the present disclosure also relates to combinations, pharmaceuticals, and pharmaceutical compositions containing the described combinations.
  • the two components of the combination of the present invention e.g. the antibody specific for CD19 and venetoclax, may be administered together, simultaneously, separately or subsequently, either physically or in time.
  • Venetoclax is currently taken orally and is currently dosed once per day.
  • MOR00208 is currently administered intravenously, and is currently dosed either once a week or once every two weeks.
  • both drugs are active in the patient at the same time.
  • venetoclax is administered prior to and/or separately from the administration of the antibody specific for CD19, e.g. MOR00208.
  • Administered together can mean administered at the same time.
  • a pharmaceutical composition includes an active agent, eg. an antibody for therapeutic use in humans.
  • a pharmaceutical composition may include acceptable carriers or excipients.
  • administerable includes but is not limited to delivery by an injectable form, such as, for example, an intravenous, intramuscular, intradermal or subcutaneous route or mucosal route, for example, as a nasal spray or aerosol for inhalation or as an ingestable solution, capsule or tablet.
  • a “therapeutically effective amount” of a compound or combination refers to an amount sufficient to cure, alleviate or partially arrest the clinical manifestations of a given disease or disorder and its complications.
  • the amount that is effective for a particular therapeutic purpose will depend on the severity of the disease or injury as well as on the weight and general state of the subject. It will be understood that determination of an appropriate dosage may be achieved, using routine experimentation, by constructing a matrix of values and testing different points in the matrix, all of which is within the ordinary skills of a trained physician or clinical scientist.
  • Cross competes means the ability of an antibody or other binding agent to interfere with the binding of other antibodies or binding agents to CD19 in a standard competitive binding assay.
  • the ability or extent to which an antibody or other binding agent is able to interfere with the binding of another antibody or binding molecule to CD19, and, therefore whether it can be said to cross- compete according to the invention, can be determined using standard competition binding assays.
  • One suitable assay involves the use of the Biacore technology (e.g. by using the BIAcore 3000 instrument (Biacore, Uppsala, Sweden)), which can measure the extent of interactions using surface plasmon resonance technology.
  • Another assay for measuring cross-competing uses an ELISA- based approach.
  • a high throughput process for "epitope binning" antibodies based upon their cross- competition is described in International Patent Application No. WO 2003/48731
  • epitope includes any protein determinant capable of specific binding to an antibody or otherwise interacting with a molecule.
  • Epitopic determinants generally consist of chemically active surface groupings of molecules such as amino acids or carbohydrate or sugar side chains and can have specific three-dimensional structural characteristics, as well as specific charge characteristics.
  • An epitope may be "linear” or “conformational.”
  • linear epitope refers to an epitope with all of the points of interaction between the protein and the interacting molecule (such as an antibody) occur linearally along the primary amino acid sequence of the protein (continuous).
  • formational epitope refers to an epitope in which discontinuous amino acids that come together in three dimensional conformation.
  • epitope mapping techniques include Epitope Mapping Protocols in Methods in Molecular Biology, Vol. 66 (Glenn E.Morris, Ed., 1996) Humana Press, Totowa, New Jersey.
  • linear epitopes may be determined by e.g., concurrently synthesizing large numbers of peptides on solid supports, the peptides corresponding to portions of the protein molecule, and reacting the peptides with antibodies while the peptides are still attached to the supports.
  • Such techniques are known in the art and described in, e.g., U.S. Patent No. 4,708,871 ; Geysen et al, (1984) Proc. Natl. Acad. Sci. USA 8:3998-4002; Geysen et al, (1985) Proc. Natl. Acad. Sci. USA 82:78-182; Geysen et al, (1986) Mol. Immunol.
  • conformational epitopes are readily identified by determining spatial conformation of amino acids such as by, e.g., hydrogen/deuterium exchange, x-ray crystallography and two-dimensional nuclear magnetic resonance. See, e.g., Epitope Mapping Protocols, supra.
  • Antigenic regions of proteins can also be identified using standard antigenicity and hydropathy plots, such as those calculated using, e.g., the Omiga version 1.0 software program available from the Oxford Molecular Group. This computer program employs the Hopp/Woods method, Hopp et al, (1981 ) Proc. Natl. Acad. Sci USA 78:3824- 3828; for determining antigenicity profiles, and the Kyte-Doolittle technique, Kyte et al, (1982) J. Mol. Biol. 157: 105-132; for hydropathy plots.
  • An aspect of the present disclosure is a combination comprising an antibody specific for CD19 and a BCL-2 inhibitor for use in the treatment of non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia.
  • the combination is synergistic.
  • the combination of the exemplified anti-CD19 antibody and venetoclax behaved synergistically in in vitro models relevant to CLL.
  • CLL is a B cell related disorder and CD19 is highly expressed on B-cells
  • the exemplified combination should have the same mechanism of action and should also behave synergistically in the treatment of other B cell related disorders, e.g. ALL and NHL. Therefore, the combination of the exemplified antibody specific for CD19 and venetoclax should be effective in the treatment of humans in non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia.
  • the expected efficacy of the combination of the antibody specific to CD19 exemplified and venetoclax will be confirmed in clinical trials.
  • MEC-1 cells (DSMZ# ACC497), a chronic B-cell leukemia cell line, were tested. MEC-1 cells in the present in vitro model are indicative of how the combination will work in the treatment of chronic lymphoid leukemia (CLL) in humans.
  • CLL chronic lymphoid leukemia
  • the Chou index values indicate clear synergism of the combination of MOR00208 and venetoclax in the specific killing of MEC-1 cells as compared to MOR00208 and venetoclax alone.
  • the combination of the exemplified antibody specific for CD19 and venetoclax should be effective in the treatment of humans in non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia.
  • anti-CD19 antibody and other anti-CD19 antibodies bind CD19
  • synergy should also be seen when treating humans having non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia with a combination of any anti- CD19 antibody and a B-cell lymphoma-2 (Bcl-2) protein inhibitor
  • the anti-CD19 antibody is, for example, described in US patent application serial number 12/377,251 (Xencor), WO2005012493, WO2010053716 (Immunomedics); WO2007002223 (Medarex); WO2008022152 (Xencor); WO2008031056 (Medimmune); WO 2007/076950 (Merck Patent GmbH); WO 2009/052431 (Seattle Genetics); and WO2010095031 (Glenmark Pharmaceuticals), all of which are incorporated by reference in their entireties.
  • the antibody specific for CD19 comprises an antibody that cross-competes with the antibody comprising an HCDR1 region of sequence SYVMH (SEQ ID NO: 1 ), an HCDR2 region of sequence NPYNDG (SEQ ID NO: 2), an HCDR3 region of sequence GTYYYGTRVFDY (SEQ ID NO: 3), an LCDR1 region of sequence RSSKSLQNVNGNTYLY (SEQ ID NO: 4), an LCDR2 region of sequence RMSNLNS (SEQ ID NO: 5), and an LCDR3 region of sequence MQHLEYPIT (SEQ ID NO: 6).
  • SYVMH SEQ ID NO: 1
  • an HCDR2 region of sequence NPYNDG SEQ ID NO: 2
  • an HCDR3 region of sequence GTYYYGTRVFDY SEQ ID NO: 3
  • an LCDR1 region of sequence RSSKSLQNVNGNTYLY SEQ ID NO: 4
  • an LCDR2 region of sequence RMSNLNS SEQ ID NO: 5
  • the antibody specific for CD19 comprises an antibody that binds to the same epitope as an antibody comprising an HCDR1 region of sequence SYVMH (SEQ ID NO: 1 ), an HCDR2 region of sequence NPYNDG (SEQ ID NO: 2), an HCDR3 region of sequence GTYYYGTRVFDY (SEQ ID NO: 3), an LCDR1 region of sequence RSSKSLONVNGNTYLY (SEQ ID NO: 4), an LCDR2 region of sequence RMSNLNS (SEQ ID NO: 5), and an LCDR3 region of sequence MQHLEYPIT (SEQ ID NO: 6).
  • the antibody specific for CD19 comprises an HCDR1 region of sequence SYVMH (SEQ ID NO: 1 ), an HCDR2 region of sequence NPYNDG (SEQ ID NO: 2), an HCDR3 region of sequence GTYYYGTRVFDY (SEQ ID NO: 3), an LCDR1 region of sequence RSSKSLONVNGNTYLY (SEQ ID NO: 4), an LCDR2 region of sequence RMSNLNS (SEQ ID NO: 5), and an LCDR3 region of sequence MQHLEYPIT (SEQ ID NO: 6).
  • the antibody specific for CD19 has a cytotoxic activity. In embodiments, the antibody specific for CD19 comprises a constant region having ADCC inducing activity. In embodiments, the antibody specific for CD19 induces ADCC.
  • the antibody specific for CD19 induces ADCC and comprises an HCDR1 region of sequence SYVMH (SEQ ID NO: 1 ), an HCDR2 region of sequence NPYNDG (SEQ ID NO: 2), an HCDR3 region of sequence GTYYYGTRVFDY (SEQ ID NO: 3), an LCDR1 region of sequence RSSKSLONVNGNTYLY (SEQ ID NO: 4), an LCDR2 region of sequence RMSNLNS (SEQ ID NO: 5), and an LCDR3 region of sequence MQHLEYPIT (SEQ ID NO: 6).
  • the antibody specific for CD19 comprises an HCDR1 region of sequence SYVMH (SEQ ID NO: 1 ), an HCDR2 region of sequence NPYNDG (SEQ ID NO: 2), an HCDR3 region of sequence GTYYYGTRVFDY (SEQ ID NO: 3), an LCDR1 region of sequence RSSKSLONVNGNTYLY (SEQ ID NO: 4), an LCDR2 region of sequence RMSNLNS (SEQ ID NO: 5), and an LCDR3 region of sequence MQHLEYPIT (SEQ ID NO: 6) and a constant region having ADCC inducing activity.
  • the antibody specific for CD19 comprises a variable heavy chain of the sequence EVQLVESGGGLVKPGGSLKLSCAASGYTFTSYVMHWVRQAPGKGLEWIGYINPY NDGTKYNEKFQGRVTISSDKSISTAYMELSSLRSEDTAMYYCARGTYYYGTRVFDYWG QGTLVTVSS (SEQ ID NO: 10) and a variable light chain of the sequence DIVMTQSPATLSLSPGERATLSCRSSKSLQNVNGNTYLYWFQQKPGQSPQLLIYR MSNLNSGVPDRFSGSGSGTEFTLTISSLEPEDFAVYYCMQHLEYPITFGAGTKLEIK (SEQ ID NO: 1 1 ).
  • said antibody comprises a heavy chain constant domain of the sequence
  • the antibody specific for CD19 comprises a light chain constant domain of the sequence
  • the BCL-2 inhibitor is venetoclax.
  • the components of the combination, the antibody specific for CD19 and venetoclax are administered separately.
  • venetoclax is administered prior to administration of the antibody specific for CD19.
  • the components of the combination are administered at a time where both components (drugs) are active in the patient at the same time. It is implied by “synergism" that both drugs are active in the patient at the same time.
  • the components of the combination are administered together, simultaneously, separately or subsequently, either physically or in time. In embodiments, the components of the combination are administered simultaneously.
  • the combination is a pharmaceutical composition.
  • the composition comprises an acceptable carrier.
  • the combination is administered in an effective amount.
  • An aspect of the present disclosure comprises an antibody specific for CD19 comprising an HCDR1 region of sequence SYVMH (SEQ ID NO: 1 ), an HCDR2 region of sequence NPYNDG (SEQ ID NO: 2), an HCDR3 region of sequence GTYYYGTRVFDY (SEQ ID NO: 3), an LCDR1 region of sequence RSSKSLQNVNGNTYLY (SEQ ID NO: 4), an LCDR2 region of sequence RMSNLNS (SEQ ID NO: 5), and an LCDR3 region of sequence MQHLEYPIT (SEQ ID NO: 6) for the treatment of non- Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia, wherein said antibody is used in a synergistic combination with venetoclax.
  • An aspect of the present disclosure comprises an antibody specific for CD19 comprising an HCDR1 region of sequence SYVMH (SEQ ID NO: 1 ), an HCDR2 region of sequence NPYNDG (SEQ ID NO: 2), an HCDR3 region of sequence GTYYYGTRVFDY (SEQ ID NO: 3), an LCDR1 region of sequence RSSKSLQNVNGNTYLY (SEQ ID NO: 4), an LCDR2 region of sequence RMSNLNS (SEQ ID NO: 5), and an LCDR3 region of sequence MQHLEYPIT (SEQ ID NO: 6) for the treatment of non- Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia, wherein said antibody is used in a combination with venetoclax.
  • said antibody is administered in combination with venetoclax. In another embodiment said antibody is used in a combination with venetoclax, wherein said antibody and venetoclax are administered separately. In further embodiments, said antibody is administered prior to venetoxlax. In further embodiments venetoclax is administered prior to said antibody.
  • An aspect of the present disclosure comprises a synergistic combination of an antibody specific for CD19 comprising an HCDR1 region of sequence SYVMH (SEQ ID NO: 1 ), an HCDR2 region of sequence NPYNDG (SEQ ID NO: 2), an HCDR3 region of sequence GTYYYGTRVFDY (SEQ ID NO: 3), an LCDR1 region of sequence RSSKSLQNVNGNTYLY (SEQ ID NO: 4), an LCDR2 region of sequence RMSNLNS (SEQ ID NO: 5), and an LCDR3 region of sequence MQHLEYPIT (SEQ ID NO: 6) and venetoclax for the treatment of non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia.
  • the non-Hodgkin's lymphoma is selected from the group consisting of follicular lymphoma, small lymphocytic lymphoma, mucosa- associated lymphoid tissue, marginal zone, diffuse large B cell, Burkitt's, and mantle cell.
  • the non-Hodgkin's lymphoma is follicular lymphoma. In embodiments, the non-Hodgkin's lymphoma is small lymphocytic lymphoma. In embodiments, the non-Hodgkin's lymphoma is mucosa-associated lymphoid tissue. In embodiments, the non-Hodgkin's lymphoma is marginal zone lymphoma. In embodiments, the non-Hodgkin's lymphoma is diffuse large B cell lymphoma. In embodiments, the non-Hodgkin's lymphoma is Burkitt's lymphoma. In embodiments, the non-Hodgkin's lymphoma is mantle cell lymphoma.
  • the combination is for the treatment of chronic lymphocytic leukemia. In embodiments, the combination is for the treatment of acute lymphoblastic leukemia.
  • Another aspect comprises a method of treating non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia in an individual in need thereof, which method comprises administration of an antibody specific for CD19 and a BCL-2 inhibitor.
  • the antibody specific for CD19 comprises an HCDR1 region of sequence SYVMH (SEQ ID NO: 1 ), an HCDR2 region of sequence NPYNDG (SEQ ID NO: 2), an HCDR3 region of sequence GTYYYGTRVFDY (SEQ ID NO: 3), an LCDR1 region of sequence RSSKSLQNVNGNTYLY (SEQ ID NO: 4), an LCDR2 region of sequence RMSNLNS (SEQ ID NO: 5), and an LCDR3 region of sequence MQHLEYPIT (SEQ ID NO: 6).
  • the antibody comprises the exemplified antibody specific for CD19.
  • the BCL-2 inhibitor is venetoclax.
  • Another aspect includes a use of an antibody specific for CD19 wherein said antibody comprises an HCDR1 region of sequence SYVMH (SEQ ID NO: 1 ), an HCDR2 region of sequence NPYNDG (SEQ ID NO: 2), an HCDR3 region of sequence GTYYYGTRVFDY (SEQ ID NO: 3), an LCDR1 region of sequence RSSKSLQNVNGNTYLY (SEQ ID NO: 4), an LCDR2 region of sequence RMSNLNS (SEQ ID NO: 5), and an LCDR3 region of sequence MQHLEYPIT (SEQ ID NO: 6) in the manufacture of a medicament for the treatment of non-Hodgkin's lymphoma, chronic lymphocytic leukemia and/or acute lymphoblastic leukemia in synergistic combination with venetoclax.
  • Example 1 Cytotoxicity of MEC-1 cells using MOR00208 and venetoclax alone and in combination Materials
  • Cell lines tested MEC-1 cells (DSMZ# ACC497). Culture conditions of cell lines used are according to supplier ' s information.
  • Cell Medium Iscove's Modified Dulbecco's Medium (IMDM),
  • FCS Sigma CAT No.: F7524 LOT No.: 1 1 1 M3396.
  • NKs RPMI1640, with GlutaMAX, Invitrogen, Cat No.: 31870, 10% FCS; Biocoll: Biochrome AG CAT No.: L61 15 LOT No.: 0034D; MACS NK cell isolation kit: Miltenyi Biotec CAT No.: 130-092-657 LOT No.: 5150402327;
  • the cytotoxic potential of MOR00208 and venetoclax alone and in combination were tested in the MEC-1 cell line (CLL).
  • Target cell killing is measured using the following parameters: venetoclax mono treatment at concentrations of 3 ⁇ , 6.5 ⁇ , and 10 ⁇ ; MOR00208 mono treatment at concentrations of 0.01 pM, 0.1 pM, 1 pM, 10 pM, 100 pM and 10 nM, and the combination treatment of the listed venetoclax and MOR00208 concentrations.
  • the following are used as controls: RefmAb33, NK cells alone, MEC-1 cells alone or DMSO.
  • target cells were pretreated with venetoclax or with DMSO control for 24 hours followed by removal of the dead cells prior to the ADCC assay.
  • a dead cell removal kit was used to remove cells killed by the cytotoxic effect of venetoclax.
  • the dead cell removal kit was implemented to mimick the removal of dead cells that also occurs in vivo and to prevent false negative interference of the dead cells with the subsequent ADCC assay.
  • target cells are counted and stained using CFSE at a final concentration of 1 g mL.
  • control group i.e.
  • the effector : target (E:T) cell ratio was adjusted to 2:1 , i.e. 1x10E6/mL effector cells (NK cells) and 5x10E5/mL target cells (MEC-1 cells).
  • NK cells effector cells
  • MEC-1 cells 5x10E5/mL target cells
  • the number of target cells was reduced according to the observed cytotoxic effects of venetoclax during the 24 hour treatment while the number of effector cells was kept constant at 1x10 6 /mL.
  • the ADCC assays were performed as follows: using 96 well plates, 100 ⁇ of MEC-1 target cell suspension was added per well, followed by 100 ⁇ - NK effector cell suspension per well.
  • Combination Index (CI) calculations are completed in order to determine synergy of the combination of the exemplified anti-CD19 antibody and venetoclax as compared to MOR00208 and venetoclax alone. Such calculations are described in Ting-Chao Chou, Theoretical Basis, Experimental Design, and Computerized Simulation of Synergism and Antagonism in Drug Combination Studies, Pharmacol Rev 58:621-681 (2006), which is incorporated by reference in its entirety and Chou TC, Talalay P, Quantitative analysis of dose-effect relationships: the combined effects of multiple drugs or enzyme inhibitors. Adv Enzyme Regul 22: 27-55 (1984), which is incorporated by reference in its entirety. The methods of Chou-Talalay are carried out using the Cl-isobol method.
  • the median-effect equation models the effect of an inhibitor (such as a drug) as
  • the constant m determines the shape of the dose-effect curve.
  • the Cl-isobol method provides a quantitative assessment of synergism between drugs.
  • D1 and D2 are the doses of drug 1 and drug 2 of the combination, respectively; and Dx1 , and Dx2 is the dose of a treatment with only drug 1 and drug 2 that would give the same effect as that of the combination.
  • the doses Dx1 and Dx2 need to be estimated from the dose-effect data of single drug treatments. Essentially, a median effect equation is fitted to the data of each drug. From the median effect equation of a drug, we can estimate the dose (i.e. D) necessary to produce an effect (i.e. Fa, Fu). The further a point lies from the additive line, the bigger the different between 1 and its CI, thus the stronger the (synergistic or antagonistic) effect is.
  • MOR00208 concentrations where MOR00208 alone shows normal cell killing activity, clear synergism is shown by the CI values less than 1 , which represents the activity of MOR00208 and venetoclax.
  • the highest concentration of MOR00208 exemplified herein is obtained in the ongoing clinical trials, where MOR00208 is dosed at 12 mg/kg once weekly. Accordingly it is believed that the exemplified in vitro model is predictive of activity in humans. Therefore, the combination of MOR00208 and venetoclax should also behave synergistically in the treatment of non-Hodgkin's lymphoma (NHL), chronic lymphoid leukemia (CLL), and acute lymphoblastic leukemia (ALL) in humans.
  • NHL non-Hodgkin's lymphoma
  • CLL chronic lymphoid leukemia
  • ALL acute lymphoblastic leukemia
  • Example 2 Efficacy of MOR00208 in combination with ABT-199 in a subcutaneous human lymphoma cell xenograft model in SCID mice The efficacy benefit of MOR00208 in combination with venetoclax (ABT-199) was further studied in a SCID mouse model with subcutaneous TOLEDO human lymphoma cell tumors. Tumor growth and mortality were assessed.
  • the culture medium was RPMI 1640 containing 2mM L-glutamine (ref: BE12-702F, Lonza, Verviers, Belgium) supplemented with 10% fetal bovine serum (ref: P30-1506, Lonza), HBSS (ref: BE10-543F), Glucose (ref: G8769, Sigma, France), Hepes (ref: BE17-737E, Lonza) and Sodium pyruvate (ref: BE13-1 15E, Lonza). The cells are adherent to plastic flasks.
  • tumor cells were detached from the culture flask by a 5-minute treatment with trypsin-versene (ref: BE02-007E, Lonza), in Hanks' medium without calcium or magnesium (ref: BE10-543F, Lonza) and neutralized by addition of complete culture medium. The cells were counted in a hemocytometer and their viability was assessed by 0.25% trypan blue exclusion assay.
  • Tumors were induced by subcutaneous injection of 10x10 6 of Toledo cells in 200 ⁇ of RPMI 1640 containing matrigel (50:50, v:v, ref: 356237, BD Biosciences, France) into the right flank of SCID mice.
  • RPMI 1640 containing matrigel (50:50, v:v, ref: 356237, BD Biosciences, France) into the right flank of SCID mice.
  • 60 mice were randomized according to their individual tumor volume into 6 groups each of 10 animals using Vivo Manager ® software (Biosystemes, Couternon, France).
  • a statistical test (analysis of variance, ANOVA) was performed to test for homogeneity between groups.
  • MOR208 was injected intraperitoneal ⁇ (IP) into the peritoneal cavity of mice. Combined substance was administered by oral gavage (per os, PO) via a gavage tube.
  • the treatment schedule initiated at D23 was as follows:
  • Animals from group 2 received daily PO administration of ABT-199 at 20 mg/kg/adm
  • Animals from group 3 received daily PO administration of ABT-199 at 40 mg/kg/adm.
  • the combination treatment of MOR00208 and ABT-199 at a dose of 20 and 40 mg/kg resulted in a superior and statistically significant inhibition of the growth of the Toledo lymphoma cells compared to the vehicle control and both monotherapy regimens.
  • the anti-tumor effect of MOR00208 in combination with ABT-199 shows even more pronounced when the survival of the mice from randomization until the humane endpoint (tumor volume of 2000 mm3) is analyzed.
  • the median survival and the respective increased life span of the combination groups were superior compared to the respective monotherapies.
  • Table 8 Effect of MOR00208 and ABT-199 alone and in combination on median survival in a s.c. Toledo SCID mouse model.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Organic Chemistry (AREA)
  • Epidemiology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Microbiology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Mycology (AREA)
  • Engineering & Computer Science (AREA)
  • Oncology (AREA)
  • Biophysics (AREA)
  • Hematology (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Endocrinology (AREA)
  • Dermatology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Peptides Or Proteins (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
PCT/EP2017/077654 2016-10-28 2017-10-27 Combination of anti cd19 antibody with a bcl-2 inhibitor and uses thereof Ceased WO2018078123A1 (en)

Priority Applications (30)

Application Number Priority Date Filing Date Title
BR112019008244-1A BR112019008244A2 (pt) 2016-10-28 2017-10-27 combinação compreendendo um anticorpo específico de cd19
SI201730811T SI3532098T1 (sl) 2016-10-28 2017-10-27 Kombinacija protitelesa proti CD19 in zaviralca BCL-2 ter uporaba le-te
DK17797564.6T DK3532098T3 (da) 2016-10-28 2017-10-27 Kombination af anti-cd19-antistof med en bcl-2-inhibitor og anvendelser deraf
EP21165598.0A EP3903821A1 (en) 2016-10-28 2017-10-27 Combination of anti cd19 antibody with a bcl-2 inhibitor and uses thereof
IL301786A IL301786B2 (en) 2016-10-28 2017-10-27 Combination of anti-CD19 antibody with BCL-2 inhibitor and their uses
IL266216A IL266216B2 (en) 2016-10-28 2017-10-27 Combination of anti-cd19 antibody with bcl-2 inhibitor and uses thereof
MX2019004942A MX2019004942A (es) 2016-10-28 2017-10-27 Combinacion de anticuerpo anti cd19 con un inhibidor de bcl-2 y usos de la misma.
CN202410183851.8A CN118045175A (zh) 2016-10-28 2017-10-27 抗cd19抗体与bcl-2抑制剂的组合及其用途
US16/342,645 US12358983B2 (en) 2016-10-28 2017-10-27 Combination of anti CD19 antibody with a BCL-2 inhibitor and uses thereof
CN201780067047.1A CN109890418B (zh) 2016-10-28 2017-10-27 抗cd19抗体与bcl-2抑制剂的组合及其用途
EP17797564.6A EP3532098B1 (en) 2016-10-28 2017-10-27 Combination of anti cd19 antibody with a bcl-2 inhibitor and uses thereof
PL17797564T PL3532098T3 (pl) 2016-10-28 2017-10-27 Kombinacja przeciwciała anty cd19 z inhibitorem blc-2 i ich zastosowania
RU2019113370A RU2756405C2 (ru) 2016-10-28 2017-10-27 Комбинация антитела CD19 с ингибитором BCL-2 и пути ее применения
ES17797564T ES2871574T3 (es) 2016-10-28 2017-10-27 Combinación de anticuerpo anti CD19 con un inhibidor de BCL-2 y usos de la misma
KR1020197012532A KR102500868B1 (ko) 2016-10-28 2017-10-27 항-cd19 항체 및 bcl-2 억제제의 조합 및 이의 용도
SM20210347T SMT202100347T1 (it) 2016-10-28 2017-10-27 Combinazione di anticorpo anti-cd19 con inibitore di bcl-2 e loro usi
AU2017348624A AU2017348624B2 (en) 2016-10-28 2017-10-27 Combination of anti CD19 antibody with a BCL-2 inhibitor and uses thereof
LTEP17797564.6T LT3532098T (lt) 2016-10-28 2017-10-27 Anti cd19 antikūno derinys su bcl-2 inhibitoriumi, ir jo naudojimas
JP2019522273A JP7094950B2 (ja) 2016-10-28 2017-10-27 抗cd19抗体とbcl-2阻害剤との組み合わせおよびその使用
RS20210792A RS62036B1 (sr) 2016-10-28 2017-10-27 Kombinacija anti cd19 antitela sa bcl-2 inhibitorom i njihova upotreba
NZ751414A NZ751414A (en) 2016-10-28 2017-10-27 Combination of anti cd19 antibody with a bcl-2 inhibitor and uses thereof
IL320372A IL320372A (en) 2016-10-28 2017-10-27 Combination of anti-CD19 antibody with BCL-2 inhibitor and uses thereof
KR1020237005018A KR20230028571A (ko) 2016-10-28 2017-10-27 항-cd19 항체 및 bcl-2 억제제의 조합 및 이의 용도
CA3037246A CA3037246A1 (en) 2016-10-28 2017-10-27 Combination of anti cd19 antibody with a bcl-2 inhibitor and uses thereof
HRP20210838TT HRP20210838T1 (hr) 2016-10-28 2017-10-27 Kombinacija protutijela anti-cd19 s inhibitorom bcl-2 te njihove uporabe
ZA2019/03302A ZA201903302B (en) 2016-10-28 2019-05-24 Combination of anti cd19 antibody with a bcl-2 inhibitor and uses thereof
CY20211100512T CY1124648T1 (el) 2016-10-28 2021-06-10 Συνδυασμος αντισωματος αντι- cd19 με εναν αναστολεα bcl-2 και χρησεις αυτου
JP2022100006A JP2022137089A (ja) 2016-10-28 2022-06-22 抗cd19抗体とbcl-2阻害剤との組み合わせおよびその使用
JP2024125584A JP2024167208A (ja) 2016-10-28 2024-08-01 抗cd19抗体とbcl-2阻害剤との組み合わせおよびその使用
AU2024287178A AU2024287178A1 (en) 2016-10-28 2024-12-23 Combination of anti CD19 antibody with a BCL-2 inhibitor and uses thereof

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
EP16196184.2 2016-10-28
EP16196184 2016-10-28

Publications (1)

Publication Number Publication Date
WO2018078123A1 true WO2018078123A1 (en) 2018-05-03

Family

ID=57218739

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2017/077654 Ceased WO2018078123A1 (en) 2016-10-28 2017-10-27 Combination of anti cd19 antibody with a bcl-2 inhibitor and uses thereof

Country Status (26)

Country Link
US (1) US12358983B2 (enExample)
EP (2) EP3903821A1 (enExample)
JP (3) JP7094950B2 (enExample)
KR (2) KR20230028571A (enExample)
CN (2) CN118045175A (enExample)
AU (2) AU2017348624B2 (enExample)
BR (1) BR112019008244A2 (enExample)
CA (1) CA3037246A1 (enExample)
CY (1) CY1124648T1 (enExample)
DK (1) DK3532098T3 (enExample)
ES (1) ES2871574T3 (enExample)
HR (1) HRP20210838T1 (enExample)
HU (1) HUE054496T2 (enExample)
IL (3) IL266216B2 (enExample)
LT (1) LT3532098T (enExample)
MX (2) MX2019004942A (enExample)
NZ (1) NZ751414A (enExample)
PL (1) PL3532098T3 (enExample)
PT (1) PT3532098T (enExample)
RS (1) RS62036B1 (enExample)
RU (1) RU2756405C2 (enExample)
SG (1) SG10202104036QA (enExample)
SI (1) SI3532098T1 (enExample)
SM (1) SMT202100347T1 (enExample)
WO (1) WO2018078123A1 (enExample)
ZA (1) ZA201903302B (enExample)

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2018220040A1 (en) 2017-05-31 2018-12-06 Morphosys Ag Treatment paradigm for an anti-cd19 antibody and venetoclax combination treatment
WO2019238843A1 (en) * 2018-06-14 2019-12-19 Berlin-Chemie Ag Pharmaceutical combinations
WO2020043878A1 (en) * 2018-08-31 2020-03-05 Adc Therapeutics Sa Combination therapy
US20220389104A1 (en) * 2021-05-28 2022-12-08 Ose Immunotherapeutics Method for Treating CD127-Positive Cancers by Administering an Anti-CD127 Agent
US12194095B2 (en) 2015-08-21 2025-01-14 Incyte Corporation Combinations and uses thereof
US12491244B2 (en) 2018-09-12 2025-12-09 GC Cell Corporation Pharmaceutical combinations for treating tumor comprising anti-CD19 antibody and natural killer cell

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
IL266216B2 (en) 2016-10-28 2023-09-01 Morphosys Ag Combination of anti-cd19 antibody with bcl-2 inhibitor and uses thereof
AU2020375149A1 (en) * 2019-10-31 2022-05-12 Incyte Corporation Sequential anti-CD19 therapy

Citations (23)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4708871A (en) 1983-03-08 1987-11-24 Commonwealth Serum Laboratories Commission Antigenically active amino acid sequences
US5686072A (en) 1992-06-17 1997-11-11 Board Of Regents, The University Of Texas Epitope-specific monoclonal antibodies and immunotoxins and uses thereof
WO2002022212A2 (en) 2000-09-18 2002-03-21 Idec Pharmaceuticals Corporation Combination therapy for treatment of autoimmune diseases using b cell depleting/immunoregulatory antibody combination
WO2003048731A2 (en) 2001-12-03 2003-06-12 Abgenix, Inc. Antibody categorization based on binding characteristics
WO2005012493A2 (en) 2003-07-31 2005-02-10 Immunomedics, Inc. Anti-cd19 antibodies
WO2007002223A2 (en) 2005-06-20 2007-01-04 Medarex, Inc. Cd19 antibodies and their uses
US20070154473A1 (en) 2005-12-30 2007-07-05 Merck Patent Gmbh Anti-CD19 antibodies with reduced immunogenicity
WO2008022152A2 (en) 2006-08-14 2008-02-21 Xencor, Inc. Optimized antibodies that target cd19
WO2008031056A2 (en) 2006-09-08 2008-03-13 Medimmune, Llc Humanized anti-cd19 antibodies and their use in treatment of oncology, transplantation and autoimmune disease
WO2008150494A1 (en) 2007-05-30 2008-12-11 Xencor, Inc. Methods and compositions for inhibiting cd32b expressing cells
WO2009052431A2 (en) 2007-10-19 2009-04-23 Seattle Genetics, Inc. Cd19 binding agents and uses thereof
WO2010053716A1 (en) 2008-11-07 2010-05-14 Immunomedics, Inc. Improved anti-cd19 antibodies
WO2010095031A2 (en) 2009-02-23 2010-08-26 Glenmark Pharmaceuticals S.A. Humanized antibodies that bind to cd19 and their uses
WO2010151341A1 (en) 2009-06-24 2010-12-29 The Feinstein Institute For Medical Research Method for treating chronic lymphocytic leukemia
WO2011147834A1 (en) 2010-05-26 2011-12-01 Roche Glycart Ag Antibodies against cd19 and uses thereof
WO2012010562A1 (en) 2010-07-19 2012-01-26 International - Drug - Development - Biotech Anti-cd19 antibody having adcc and cdc functions and improved glycosylation profile
WO2012010561A1 (en) 2010-07-19 2012-01-26 International - Drug - Development - Biotech Anti-cd19 antibody having adcc function with improved glycosylation profile
WO2012156455A1 (en) 2011-05-17 2012-11-22 Sanofi Use of anti-cd19 maytansinoid immunoconjugate antibody for the treatment of b-cell malignancies symptoms
WO2013024095A1 (en) 2011-08-16 2013-02-21 Morphosys Ag Combination therapy with an anti - cd19 antibody and a purine analog
WO2013024097A1 (en) 2011-08-16 2013-02-21 Morphosys Ag Combination therapy with an anti - cd19 antibody and a nitrogen mustard
US8546399B2 (en) 2009-05-26 2013-10-01 Abbvie Inc. Apoptosis inducing agents for the treatment of cancer and immune and autoimmune diseases
WO2015130585A1 (en) * 2014-02-28 2015-09-03 Merck Sharp & Dohme Corp. Method for treating cancer
WO2016130902A1 (en) * 2015-02-12 2016-08-18 Seattle Genetics, Inc. Combination therapy using a cd19-adc and vincristine

Family Cites Families (26)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
BRPI0716661B1 (pt) 2006-08-15 2019-05-21 Hydralift Amclyde, Inc. Aparelho e método para prover compensação de levantamento para uma carga suspensa de uma extremidade de um cabo em um ambiente marinho, com a outra extremidade do cabo.
EA018573B1 (ru) 2006-09-22 2013-09-30 Фармасайкликс, Инк. Ингибиторы тирозинкиназы брутона
US20100128586A1 (en) 2008-11-25 2010-05-27 Mediatek Inc. Method and apparatus for accessing data from disc with linking area
CA3007787C (en) 2010-06-03 2020-03-10 Pharmacyclics Llc The use of inhibitors of bruton's tyrosine kinase (btk)
US8543911B2 (en) 2011-01-18 2013-09-24 Apple Inc. Ordering document content based on reading flow
EP3077384B1 (en) * 2013-12-05 2017-09-06 F. Hoffmann-La Roche AG Heteroaryl pyridone and aza-pyridone compounds with electrophilic functionality
SI3888674T1 (sl) * 2014-04-07 2024-08-30 Novartis Ag Zdravljenje raka z uporabo antigenskega himernega receptorja proti-CD19
AU2015277516A1 (en) 2014-06-16 2016-12-22 Xencor, Inc. Treatment for chronic lymphocytic leukemia (CLL)
EP3209690B1 (en) 2014-10-20 2021-05-05 Juno Therapeutics, Inc. Methods and compositions for dosing in adoptive cell therapy
MX389342B (es) 2015-05-26 2025-03-20 Hoffmann La Roche Un anticuerpo anti-cd20 en combinación con un inhibidor de bcl-2 y un inhibidor de mdm2 para usarse en el tratamiento de cáncer.
PL3302550T3 (pl) 2015-05-26 2020-02-28 Morphosys Ag Kombinacja przeciwciała anty-cd19 i inhibitora kinazy tyrozynowej brutona i jej zastosowania
EP3316888A1 (en) 2015-07-02 2018-05-09 Celgene Corporation Combination therapy for treatment of hematological cancers and solid tumors
SI3337506T1 (sl) 2015-08-21 2021-12-31 Morphosys Ag Kombinacije in njihove uporabe
SG11201810159TA (en) 2016-05-30 2018-12-28 Morphosys Ag Methods for predicting therapeutic benefit of anti-cd19 therapy in patients
CN109415440B (zh) 2016-06-27 2022-12-06 莫佛塞斯公司 抗-cd19抗体制剂
IL266216B2 (en) 2016-10-28 2023-09-01 Morphosys Ag Combination of anti-cd19 antibody with bcl-2 inhibitor and uses thereof
IL270855B2 (en) 2017-05-31 2023-03-01 Morphosys Ag A therapeutic paradigm for anti-cd19 anti-CD19 antibody combination therapy and Ventoclax
US20210292410A1 (en) 2017-12-07 2021-09-23 Morphosys Ag Treatment paradigm for an anti-cd19 antibody and venetoclax combination treatment
KR20200030337A (ko) 2018-09-12 2020-03-20 주식회사 녹십자랩셀 종양 치료를 위한 항-cd 19 항체 및 자연살해세포를 포함하는 약학적 조합물
JP2022532519A (ja) 2019-05-03 2022-07-15 モルフォシス・アーゲー 限られた数のnk細胞を有する患者における抗cd19療法
AU2020375149A1 (en) 2019-10-31 2022-05-12 Incyte Corporation Sequential anti-CD19 therapy
TWI883067B (zh) 2019-10-31 2025-05-11 美商英塞特公司 包含抗CD19抗體及γδ T細胞之抗腫瘤組合療法
JP7813225B2 (ja) 2019-10-31 2026-02-12 インサイト・コーポレイション 白血病またはリンパ腫の治療のためのレナリドミドと組み合わせた抗cd19療法
CA3181827A1 (en) 2020-06-22 2021-12-30 Morphosys Ag Anti-tumor combination therapy comprising anti-cd19 antibody and polypeptides blocking the sirp?-cd47 innate immune checkpoint
CA3204063A1 (en) 2020-12-04 2022-06-09 Morphosys Ag Anti-cd19 combination therapy
IL313736A (en) 2021-12-22 2024-08-01 Incyte Corp Treatment paradigm for CD19 antibody therapy

Patent Citations (28)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4708871A (en) 1983-03-08 1987-11-24 Commonwealth Serum Laboratories Commission Antigenically active amino acid sequences
US5686072A (en) 1992-06-17 1997-11-11 Board Of Regents, The University Of Texas Epitope-specific monoclonal antibodies and immunotoxins and uses thereof
WO2002022212A2 (en) 2000-09-18 2002-03-21 Idec Pharmaceuticals Corporation Combination therapy for treatment of autoimmune diseases using b cell depleting/immunoregulatory antibody combination
WO2003048731A2 (en) 2001-12-03 2003-06-12 Abgenix, Inc. Antibody categorization based on binding characteristics
WO2005012493A2 (en) 2003-07-31 2005-02-10 Immunomedics, Inc. Anti-cd19 antibodies
US7109304B2 (en) 2003-07-31 2006-09-19 Immunomedics, Inc. Humanized anti-CD19 antibodies
WO2007002223A2 (en) 2005-06-20 2007-01-04 Medarex, Inc. Cd19 antibodies and their uses
US8097703B2 (en) 2005-06-20 2012-01-17 Medarex, Inc. CD19 antibodies and their uses
WO2007076950A1 (en) 2005-12-30 2007-07-12 Merck Patent Gmbh Anti-cd19 antibodies with reduced immunogenicity
US20070154473A1 (en) 2005-12-30 2007-07-05 Merck Patent Gmbh Anti-CD19 antibodies with reduced immunogenicity
WO2008022152A2 (en) 2006-08-14 2008-02-21 Xencor, Inc. Optimized antibodies that target cd19
WO2008031056A2 (en) 2006-09-08 2008-03-13 Medimmune, Llc Humanized anti-cd19 antibodies and their use in treatment of oncology, transplantation and autoimmune disease
WO2008150494A1 (en) 2007-05-30 2008-12-11 Xencor, Inc. Methods and compositions for inhibiting cd32b expressing cells
WO2009052431A2 (en) 2007-10-19 2009-04-23 Seattle Genetics, Inc. Cd19 binding agents and uses thereof
US7968687B2 (en) 2007-10-19 2011-06-28 Seattle Genetics, Inc. CD19 binding agents and uses thereof
WO2010053716A1 (en) 2008-11-07 2010-05-14 Immunomedics, Inc. Improved anti-cd19 antibodies
WO2010095031A2 (en) 2009-02-23 2010-08-26 Glenmark Pharmaceuticals S.A. Humanized antibodies that bind to cd19 and their uses
US8546399B2 (en) 2009-05-26 2013-10-01 Abbvie Inc. Apoptosis inducing agents for the treatment of cancer and immune and autoimmune diseases
US9174982B2 (en) 2009-05-26 2015-11-03 Abbvie Inc. Apoptosis-inducing agents for the treatment of cancer and immune and autoimmune diseases
WO2010151341A1 (en) 2009-06-24 2010-12-29 The Feinstein Institute For Medical Research Method for treating chronic lymphocytic leukemia
WO2011147834A1 (en) 2010-05-26 2011-12-01 Roche Glycart Ag Antibodies against cd19 and uses thereof
WO2012010562A1 (en) 2010-07-19 2012-01-26 International - Drug - Development - Biotech Anti-cd19 antibody having adcc and cdc functions and improved glycosylation profile
WO2012010561A1 (en) 2010-07-19 2012-01-26 International - Drug - Development - Biotech Anti-cd19 antibody having adcc function with improved glycosylation profile
WO2012156455A1 (en) 2011-05-17 2012-11-22 Sanofi Use of anti-cd19 maytansinoid immunoconjugate antibody for the treatment of b-cell malignancies symptoms
WO2013024095A1 (en) 2011-08-16 2013-02-21 Morphosys Ag Combination therapy with an anti - cd19 antibody and a purine analog
WO2013024097A1 (en) 2011-08-16 2013-02-21 Morphosys Ag Combination therapy with an anti - cd19 antibody and a nitrogen mustard
WO2015130585A1 (en) * 2014-02-28 2015-09-03 Merck Sharp & Dohme Corp. Method for treating cancer
WO2016130902A1 (en) * 2015-02-12 2016-08-18 Seattle Genetics, Inc. Combination therapy using a cd19-adc and vincristine

Non-Patent Citations (21)

* Cited by examiner, † Cited by third party
Title
ANDERSON ET AL., BLOOD, vol. 63, 1984, pages 1424 - 1433
CHOU TC; TALALAY P: "Quantitative analysis of dose-effect relationships: the combined effects of multiple drugs or enzyme inhibitors", ADV ENZYME REGUL, vol. 22, 1984, pages 27 - 55, XP023796270, DOI: doi:10.1016/0065-2571(84)90007-4
CLARKE ET AL.: "Issues in experimental design and endpoint analysis in the study of experimental cytotoxic agents in vivo in breast cancer and other models", BREAST CANCER RESEARCH AND TREATMENT, vol. 46, 1997, pages 255 - 278
GEYSEN ET AL., MOL. IMMUNOL., vol. 23, 1986, pages 709 - 715
GEYSEN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 8, 1984, pages 3998 - 4002
GEYSEN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 78 - 182
GLENN E.MORRIS,: "Epitope Mapping Protocols in Methods in Molecular Biology", vol. 66, 1996, HUMANA PRESS
GROSSBARD ET AL., BR. J. HAEMATOL, vol. 102, 1998, pages 509 - 15
HOPP ET AL., PROC. NATL. ACAD. SCI USA, vol. 78, 1981, pages 3824 - 3828
KALOS ET AL.: "T cells with Chimeric Antigen Receptors Have Potent Antitumor Effects and Can Establish Memory in Patients with Advanced Leukemia", SCIENCE TRANSLATIONAL MEDICINE, vol. 3, no. 95, 10 August 2011 (2011-08-10), XP002667262, DOI: doi:10.1126/scitranslmed.3002842
KYTE ET AL., J.MOL. BIOL., vol. 157, 1982, pages 105 - 132
LOKEN ET AL., BLOOD, vol. 70, 1987, pages 1316 - 1324
NADLER ET AL., J. IMMUNOL., vol. 131, 1983, pages 244 - 250
S C H KARLSSON ET AL: "Combining CAR T cells and the Bcl-2 family apoptosis inhibitor ABT-737 for treating B-cell malignancy", CANCER GENE THERAPY, vol. 20, no. 7, 21 June 2013 (2013-06-21), GB, pages 386 - 393, XP055403655, ISSN: 0929-1903, DOI: 10.1038/cgt.2013.35 *
SADELAIN ET AL.: "Current Opinion in Immunology", vol. 21, 2 April 2009, ELSEVIER, article "The promise and potential pitfalls of chimeric antigen receptors"
SCHEUERMANN ET AL.: "CD19 Antigen in Leukemia and Lymphoma Diagnosis and Immunotherapy", LEUKEMIA AND LYMPHOMA, vol. 18, 1995, pages 385 - 397, XP009155469, DOI: doi:10.3109/10428199509059636
SCHEUERMANN, LEUK. LYMPHOMA, vol. 18, 1995, pages 385 - 397
TING-CHAO CHOU: "Theoretical Basis, Experimental Design, and Computerized Simulation of Synergism and Antagonism in Drug Combination Studies", PHARMACOL REV, vol. 58, 2006, pages 621 - 681, XP055151376, DOI: doi:10.1124/pr.58.3.10
TREON ET AL., SEMIN. ONCOL, vol. 30, 2003, pages 248 - 52
UCKUN ET AL., BLOOD, vol. 71, 1988, pages 13 - 29
WEBB, J. L.: "Enzyme and Metabolic Inhibitors", 1963, ACADEMIC PRESS

Cited By (22)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12194095B2 (en) 2015-08-21 2025-01-14 Incyte Corporation Combinations and uses thereof
EP4268900A2 (en) 2017-05-31 2023-11-01 MorphoSys AG Treatment paradigm for an anti-cd19 antibody and venetoclax combination treatment
EP4268900A3 (en) * 2017-05-31 2024-03-06 MorphoSys AG Treatment paradigm for an anti-cd19 antibody and venetoclax combination treatment
WO2018220040A1 (en) 2017-05-31 2018-12-06 Morphosys Ag Treatment paradigm for an anti-cd19 antibody and venetoclax combination treatment
US12194092B2 (en) 2018-06-14 2025-01-14 Berlin-Chemie Ag Pharmaceutical combinations
WO2019238843A1 (en) * 2018-06-14 2019-12-19 Berlin-Chemie Ag Pharmaceutical combinations
IL279334B2 (en) * 2018-06-14 2026-02-01 Berlin Chemie Ag Pharmaceutical combinations
CN112236143A (zh) * 2018-06-14 2021-01-15 柏林化学股份公司 医药组合
KR20210021489A (ko) * 2018-06-14 2021-02-26 베를린-케미 악티엔 게젤샤프트 약학적 배합물
KR102912346B1 (ko) 2018-06-14 2026-01-14 옥스포드 바이오테라퓨틱스 리미티드 약학적 배합물
IL279334B1 (en) * 2018-06-14 2025-10-01 Berlin Chemie Ag Pharmaceutical combinations
AU2019287262B2 (en) * 2018-06-14 2025-08-28 Oxford Biotherapeutics Ltd Pharmaceutical combinations
CN112638392B (zh) * 2018-08-31 2024-09-10 Adc治疗有限公司 组合疗法
JP7590083B2 (ja) 2018-08-31 2024-11-26 アーデーセー セラピューティクス ソシエテ アノニム 併用療法
IL280968B1 (en) * 2018-08-31 2025-06-01 Adc Therapeutics Sa An anti-CD19 ADC for use in treating a proliferative disorder in combination with Venetoclax and a pharmaceutical composition comprising the anti-CD19 ADC and the Venetoclax.
AU2019332979B2 (en) * 2018-08-31 2025-06-12 Adc Therapeutics Sa Combination therapy
JP2021535110A (ja) * 2018-08-31 2021-12-16 アーデーセー セラピューティクス ソシエテ アノニム 併用療法
IL280968B2 (en) * 2018-08-31 2025-10-01 Adc Therapeutics Sa An anti-CD19 conjugated antibody for use in the treatment of a proliferative disorder in combination with Ventocalx and a pharmaceutical preparation containing the anti-CD19 conjugated antibody and Ventocalx.
CN112638392A (zh) * 2018-08-31 2021-04-09 Adc治疗有限公司 组合疗法
WO2020043878A1 (en) * 2018-08-31 2020-03-05 Adc Therapeutics Sa Combination therapy
US12491244B2 (en) 2018-09-12 2025-12-09 GC Cell Corporation Pharmaceutical combinations for treating tumor comprising anti-CD19 antibody and natural killer cell
US20220389104A1 (en) * 2021-05-28 2022-12-08 Ose Immunotherapeutics Method for Treating CD127-Positive Cancers by Administering an Anti-CD127 Agent

Also Published As

Publication number Publication date
CY1124648T1 (el) 2022-07-22
RU2019113370A (ru) 2020-11-30
IL301786B2 (en) 2025-09-01
EP3903821A1 (en) 2021-11-03
AU2017348624B2 (en) 2024-09-26
CN109890418B (zh) 2024-03-08
BR112019008244A2 (pt) 2019-07-16
JP2024167208A (ja) 2024-12-03
RS62036B1 (sr) 2021-07-30
PL3532098T3 (pl) 2022-01-31
ZA201903302B (en) 2021-04-28
MX2019004942A (es) 2019-08-12
LT3532098T (lt) 2021-06-25
SG10202104036QA (en) 2021-05-28
CN109890418A (zh) 2019-06-14
AU2017348624A1 (en) 2019-03-28
IL301786A (en) 2023-05-01
IL266216B1 (en) 2023-05-01
IL301786B1 (en) 2025-05-01
ES2871574T3 (es) 2021-10-29
HRP20210838T1 (hr) 2021-08-06
KR102500868B1 (ko) 2023-02-16
DK3532098T3 (da) 2021-05-25
AU2024287178A1 (en) 2025-01-23
IL266216B2 (en) 2023-09-01
HUE054496T2 (hu) 2021-09-28
RU2756405C2 (ru) 2021-09-30
IL266216A (en) 2019-06-30
EP3532098B1 (en) 2021-04-07
NZ751414A (en) 2025-10-31
US12358983B2 (en) 2025-07-15
KR20190075942A (ko) 2019-07-01
RU2019113370A3 (enExample) 2021-03-01
EP3532098A1 (en) 2019-09-04
CN118045175A (zh) 2024-05-17
MX2022016270A (es) 2023-02-15
IL320372A (en) 2025-06-01
PT3532098T (pt) 2021-06-17
SMT202100347T1 (it) 2021-07-12
CA3037246A1 (en) 2018-05-03
JP7094950B2 (ja) 2022-07-04
SI3532098T1 (sl) 2021-12-31
KR20230028571A (ko) 2023-02-28
JP2019533682A (ja) 2019-11-21
US20190241656A1 (en) 2019-08-08
JP2022137089A (ja) 2022-09-21

Similar Documents

Publication Publication Date Title
EP3532098B1 (en) Combination of anti cd19 antibody with a bcl-2 inhibitor and uses thereof
US12194095B2 (en) Combinations and uses thereof
CA2986175A1 (en) Combination of an anti-cd19 antibody and a bruton's tyrosine kinase inhibitor and uses thereof
CA2841875A1 (en) Combination therapy with an anti - cd19 antibody and a nitrogen mustard
HK40064491A (en) Combination of anti cd19 antibody with a bcl-2 inhibitor and uses thereof
HK40014532A (en) Combination of anti cd19 antibody with a bcl-2 inhibitor and uses thereof
HK40014532B (en) Combination of anti cd19 antibody with a bcl-2 inhibitor and uses thereof
HK40081594A (en) Combination therapy with an anti-cd19 antibody and a nitrogen mustard
HK40069168A (en) Combinations and uses thereof
NZ793707A (en) Combination of anti CD19 antibody with a BCL-2 inhibitor and uses thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17797564

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3037246

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2017348624

Country of ref document: AU

Date of ref document: 20171027

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2019522273

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20197012532

Country of ref document: KR

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112019008244

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2017797564

Country of ref document: EP

Effective date: 20190528

ENP Entry into the national phase

Ref document number: 112019008244

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20190424

WWD Wipo information: divisional of initial pct application

Ref document number: 320372

Country of ref document: IL

WWG Wipo information: grant in national office

Ref document number: 16342645

Country of ref document: US