WO2018065563A1 - Immunogenic arginase peptides - Google Patents

Immunogenic arginase peptides Download PDF

Info

Publication number
WO2018065563A1
WO2018065563A1 PCT/EP2017/075443 EP2017075443W WO2018065563A1 WO 2018065563 A1 WO2018065563 A1 WO 2018065563A1 EP 2017075443 W EP2017075443 W EP 2017075443W WO 2018065563 A1 WO2018065563 A1 WO 2018065563A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
arginase
peptide
arg
cells
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2017/075443
Other languages
English (en)
French (fr)
Inventor
Mads Hald Andersen
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Herlev Hospital Region Hovedstaden
Original Assignee
Herlev Hospital Region Hovedstaden
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to ES17786870T priority Critical patent/ES2992031T3/es
Priority to CA3039510A priority patent/CA3039510A1/en
Priority to US16/339,606 priority patent/US10858642B2/en
Priority to EP17786870.0A priority patent/EP3522905B1/en
Priority to HRP20241486TT priority patent/HRP20241486T1/hr
Priority to SI201731553T priority patent/SI3522905T1/sl
Priority to CN201780066414.6A priority patent/CN109890399A/zh
Priority to MX2019003970A priority patent/MX2019003970A/es
Priority to JP2019518424A priority patent/JP7211938B2/ja
Priority to DK17786870.0T priority patent/DK3522905T3/da
Priority to PL17786870.0T priority patent/PL3522905T3/pl
Application filed by Herlev Hospital Region Hovedstaden filed Critical Herlev Hospital Region Hovedstaden
Priority to LTEPPCT/EP2017/075443T priority patent/LT3522905T/lt
Priority to IL265805A priority patent/IL265805B2/en
Priority to FIEP17786870.0T priority patent/FI3522905T3/fi
Priority to AU2017341112A priority patent/AU2017341112B2/en
Priority to KR1020197012953A priority patent/KR102674521B1/ko
Priority to EP24166247.7A priority patent/EP4406613A3/en
Publication of WO2018065563A1 publication Critical patent/WO2018065563A1/en
Anticipated expiration legal-status Critical
Priority to US17/076,680 priority patent/US11981944B2/en
Priority to US18/495,466 priority patent/US20240167013A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/78Hydrolases (3) acting on carbon to nitrogen bonds other than peptide bonds (3.5)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y305/00Hydrolases acting on carbon-nitrogen bonds, other than peptide bonds (3.5)
    • C12Y305/03Hydrolases acting on carbon-nitrogen bonds, other than peptide bonds (3.5) in linear amidines (3.5.3)
    • C12Y305/03001Arginase (3.5.3.1)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001154Enzymes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/96Stabilising an enzyme by forming an adduct or a composition; Forming enzyme conjugates

Definitions

  • the present invention relates to novel peptide compounds, such as fragments of Arginase 1 , as well as compositions, uses, and kit-of-parts comprising these peptide compounds.
  • the invention concerns nucleic acids, vectors, and host cells expressing said peptide compounds, for use in a method for treatment or prevention of a cancer, either alone or when administered simultaneously or sequentially with an additional cancer therapy.
  • Arginase is an enzyme that catalyses a reaction which converts the amino acid L-arginine into L-ornithine and urea. This depletes the microenvironment of arginine and leads to a suppression of tumor- specific cytotoxic T-cell responses. Increased Arginase activity has been detected in the cancer cells of patients with breast, lung, colon or prostate cancer [1 ]. It has been shown both in vitro and in vivo that mouse macrophages transfected with a rat Arginase gen promote the proliferation of co-cultured tumour cells [2]. Furthermore induction of Arginase expression by macrophages has been shown to increase tumour vascularization through polyamine synthesis.
  • the results of a murine lung carcinoma model showed that there existed a subpopulation of mature tumor-associated myeloid cells that expressed high levels of Arginase. These tumor-associated myeloid cells depleted the extracellular L- Arginine which inhibited antigen-specific proliferation of the tumor infiltrating lymphocytes (TILs). Injection of an Arginase inhibitor blocked the growth of the lung carcinoma in the mice. This shows how induction of Arginase expression in tumor cells and tumor associated myeoloid cells might promote tumor growth by suppression of the anti- tumor immune responses through negative effects on TILs.
  • MDSCs myeloid-derived suppressor cells
  • OS nitric-oxide synthase
  • iNOS inducible NOS
  • AML blasts show an arginase-dependent ability to inhibit T-cell proliferation and hematopoietic stem cells.
  • arginase and iNOS inhibitors reduce the suppressive activity of AML [2].
  • the present inventors have identified new immunogenic epitopes from Arginase 1.
  • PBMC peripheral blood mononuclear cells
  • Arginase specific immune responses could in addition to the killing of cancer cells support anti-cancer immune responses in general by suppressing the immune suppressive function of Arginase expressing cells especially MDSC and tumor-associated macrophages (TAMs).
  • TAMs tumor-associated macrophages
  • the fragment is typically up to 8, 9, 10, 15, 20, 25, 30, 45, 50 or 55 amino acids in length.
  • the fragment may comprise or consists of a sequence of at least 8, 9, 10, 20, 30, 40 or 50 consecutive amino acids of either of SEQ ID NO: 52 or SEQ ID NO: 58.
  • the polypeptide fragment may comprise or consist of the amino acid sequence of any one of SEQ ID NOs: 52, 50, 51, 34, 35, 36, 37, 9, 53, 54, 2 to 33, or 38 to 49.
  • the polypeptide fragment may have one or more of the following additional features: a. the C terminal amino acid is replaced with the corresponding amide; and/or b. the L at the position corresponding to position 190 of SEQ ID NO: 1 is replaced with I; and/or
  • At least one additional moiety is attached to the N and/or C terminus, optionally wherein said additional moiety is a hydrophilic amino acid such as R or K; and/or e. lacks or has reduced arginase activity relative to the corresponding full length arginase.
  • compositions comprising a said fragment, a pharmaceutically acceptable diluent or carrier, and optionally an adjuvant.
  • Said composition or said fragment may be for use in a method of treating or preventing a disease or condition such as cancer, or for use in the manufacture of a medicament for treating or preventing a disease or condition such as cancer.
  • Said composition may optionally be described as a vaccine.
  • a method of treating or preventing a disease or condition such as cancer the method comprising
  • polypeptide fragment may be interchangeably described herein as a peptide compound or a peptide.
  • the present disclosure concerns a peptide compound of Arginase 1 selected from:
  • the C-terminal amino acid of any one of a), b) or c) also comprises the amide; or a pharmaceutically acceptable salt thereof.
  • “functional” means “capable of stimulating an immune response to the Arginase of SEQ ID NO: 1".
  • the homologue b) and analogue c) preferably have reduced (or zero) arginase function.
  • the peptide compound is selected from a) a peptide fragment of SEQ ID NO 1 consisting of a consecutive sequence of from 8 to 321 amino acids, wherein the C- terminal amino acid also comprises the amide; or a pharmaceutically acceptable salt thereof.
  • the peptide fragment consists of a consecutive sequence in the range of from 8 to 300 amino acids, 8 to 250 amino acids, 8 to 200 amino acids, 8 to 150 amino acids, 8 to 120 amino acids, e.g. 10 to 100 amino acids, 20 to 80 ami-no acids, 30 to 60 amino acids, 40 to 50 amino acids.
  • the peptide fragment of SEQ ID NO 1 is selected from the group consisting of ARG(1 -310), ARG( 1-301), ARG( 1 -291), ARG( 11-322), ARG(21-322), ARG(30-322), ARG(40-322), ARG(11-310), ARG(11-301), ARG(11-291), ARG(21 -310), ARG(21-301), ARG(21-291), ARG(30-310), ARG(30-301), ARG(30-291), ARG(40-310), ARG(40-301), and ARG(40-291).
  • the arginase activity is reduced compared to Arginase 1 as measured by an arginase activity assay.
  • the arginase activity is reduced to inactivity.
  • the arginase activity assay is selected from the Arginase Activity Colorimetric Assay Kit ( BioVision Arginase assay # K755-100).
  • the consecutive sequence comprises one or more sequences selected from any one of SEQ ID NOs: 52, 50, 51 , 37, 36, 35, 34, 9, 53, 54, 2 to 33, or 38 to 39 .
  • the consecutive sequence comprises the sequence selected from SEQ ID NO 52, 50, 51 , 37, 36, 35, 34, 9, 53 or 54.
  • the peptide fragment under a), the functional homologue under b), or the functional analogue under c) is functional in the sense that it activates T cells that recognizes Arginase 1 expressing cells. In one embodiment the activation is determined by the ELISPOT assay described herein.
  • nucleic acid encoding the peptide compound of the present invention.
  • the peptide compound of the present invention is selected from any one of the above embodiments.
  • nucleic acid is selected from the group consisting of DNA and RNA.
  • a vector comprising the nucleic acid of the present invention.
  • the nucleic acid of the present invention is selected from any one of the above embodiments, and the peptide compound of the present invention is selected from any one of the above embodiments.
  • the vector is selected from a virus vector.
  • the present disclosure relates to a host cell comprising the vector of the present invention.
  • the vector is selected from any one of the above embodiments, the nucleic acid is selected from any one of the above embodiments, and the peptide compound is selected from any one of the above embodiments.
  • the host cell is selected from a mammalian cell.
  • the vector preferably comprises a nucleic acid encoding an inactive sequence of Arginase 1 , that is a sequence which lacks arginase function.
  • Any peptide, nucleic acid, vector, or host cell described herein may be provided in a composition, optionally together with a pharmaceutically acceptable additive, such as a carrier or diluent.
  • a pharmaceutically acceptable additive such as a carrier or diluent.
  • the composition may optionally also comprise an adjuvant.
  • the composition may be for use as a medicament.
  • the composition may be for use in the manufacture of a medicament for treating or preventing a disease.
  • the composition may be for use in a method for treatment or prevention of a disease, disorder or condition selected from cancer.
  • the cancer is a tumor forming cancer disease.
  • the adjuvant may be selected from the group consisting of bacterial DNA based adjuvants, oil/surfactant based adjuvants, viral dsRNA based adjuvants, imidazochinilines, and a Montanide ISA adjuvant.
  • composition comprising at least one second active ingredient, selected from an
  • an immunostimulating compound such as an interleukin, e.g. IL-2 and or IL-21
  • an anti-cancer agent such as a chemotherapeutic agent, e.g. Actimide, Azacitidine, Azathio-prine, Bleomycin, Carboplatin, Capecitabine, Cisplatin, Chlorambucil, Cyclophospha-mide, Cytarabine,
  • chemotherapeutic agent e.g. Actimide, Azacitidine, Azathio-prine, Bleomycin, Carboplatin, Capecitabine, Cisplatin, Chlorambucil, Cyclophospha-mide, Cytarabine,
  • compositions may be administered simultaneously or sequentially.
  • the compositions may be provided as components in a kit-of-parts.
  • the present disclosure relates to a method of treating a clinical condition characterized by expression of Arginase 1 of SEQ ID NO 1, the method comprising administering to an individual suffering from said clinical condition an effective amount of the peptide, the nucleic acid, the vector or the host cell described above.
  • the present disclosure relates to a method of stimulation of arginase 1 specific T-cells, such as CD4 and CD8 T-cells, in a cancer patient, the method comprising administering to the cancer patient an effective amount of the peptide compound, or the nucleic acid, or the vector, or the host cell as described above.
  • the present disclosure relates to a method of suppressing an immune suppressive function of Arginase 1 expressing cells, in a cancer patient, the method comprising administering to the cancer patient an effective amount of the peptide compound, or the nucleic acid, or the vector, or the host cell as described above.
  • the present disclosure relates to use of the peptide compound, or the nucleic acid, or the vector, or the host cell, as described above for the manufacture of a medicament, such as an immunotherapeutic composition or vaccine, for the treatment or prevention of a cancer, wherein said cancer is optionally characterized by expression of Arginase 1.
  • the present disclosure relates to the peptide compound, or the nucleic acid, or the vector, or the host cell, for use in a method for treatment or prevention of a cancer, optionally when administered simultaneously or sequentially with an additional cancer therapy.
  • the additional cancer therapy may be selected from the group consisting of a cytokine therapy, a T-cell therapy, an NK therapy, an immune system checkpoint inhibitor, chemotherapy, radiotherapy, immunostimulating substances, gene therapy, antibodies and dendritic cells.
  • the additional cancer therapy is selected from an immune system checkpoint inhibitor, such as a checkpoint blocking antibody (e.g. selected from nivolumab or
  • pemrbolizumab or is selected from the group consisting of Actimide, Azacitidine,
  • Cyclophosphamide Cytarabine, Dauno-rubicin, Docetaxel, Doxifluridine, Doxorubicin, Epirubicin, Etoposide, Fludarabine, Fluor-ouracil, Gemcitabine, Hydroxyurea, Idarubicin, Irinotecan, Lenalidomide, Leucovorin, Mechlorethamine, Melphalan, Mercaptopurine, Methotrexate, Mitoxantrone, , Oxaliplatin, Paclitaxel, , Pemetrexed, Revlimid, Temozolomide, Teniposide, Thioguanine, Valrubicin, Vinblastine, Vincristine, Vindesine and Vinorelbine.
  • Figure 1 shows T cell responses in samples from 6 cancer patients to the peptides consisting of each of the amino acids sequences of SEQ ID NOs: 2 to 16 (Argl to Argl5).
  • Figure 2 shows T cell responses in samples from 6 cancer patients against the peptide consisting of each of the amino acid sequence of SEQ ID NO: 9 (Arg8).
  • Figure 3 shows T cell responses in samples from 3 cancer patients to the peptides of consisting of each of the amino acid sequences of SEQ ID NOs: 18 to 48 (Argl-1 to Argl-31).
  • Figure 4 shows T cell responses in samples from 8 healthy individuals against the peptides consisting of the amino acid sequence of each of SEQ ID NO: 9 (Arg8), SEQ ID NO: 21 (Argl- 4), SEQ ID NO: 29 (Argl-12), SEQ ID NO: 34 (Argl-17), SEQ ID NO: 35 (Argl-18), SEQ ID NO: 36 (Argl -19), SEQ ID NO: 37 (Argl -20), SEQ ID NO: 40 (Argl -23), SEQ ID NO: 44 (Argl-17).
  • Figure 5 shows CD 8 positive culture can kill target cells loaded with the peptide consisting of each of the amino acid sequence of SEQ ID NO: 9 (Arg8).
  • Figure 6 shows killing of Arginase positive cancer (melanoma) cell lines FM3 and FM93 by Arginase specific T cells.
  • Figure 7 shows flow cytometric analysis of CD4 Tcells from a cancer patient, assessed by intracellular staining for IFN-g (PE-Cy7 A) and TNF-alpha (APC-A) following culture either without (top panel) or with (bottom panel) stimulation with the peptide consisting of each of the amino acid sequence of SEQ ID NO: 9 (Arg8). Similar results are shown in Figure 8.
  • Figure 9 shows that multiple arginase- 1 peptides are recognized by PBMCs from 3 melanoma patients (9 A) and 8 healthy donors (9B) when assessed by IFNy ELISPOT.
  • Peptides are described by reference to the start and end positions of their sequences within the sequence of human Arginase 1. Spot counts are given as a difference between averages of the wells stimulated with the peptide and control wells. Peptide and control stimulations were performed in duplicates or triplicates.
  • Figure 10 shows that the region corresponding to positions 161 to 210 of SEQ ID NO: 1 is widely recognized by cancer patient and healthy donor PBMCs
  • a - shows the proportion of CD4+ T cells in tumour infiltrating lymphocytes (TILs) from melanoma patient which release IFNy in response to the peptides consisting of the amino acid sequences of each of SEQ ID NO: 34 (Argl61-180), SEQ ID NO: 35 (Argl 71 -190) and SEQ ID NO: 36 (Argl81-200).
  • Peptide names refer to the start and end positions of their sequences within the sequence of human Arginase 1
  • Spot counts are given as a difference between averages of the wells stimulated with the peptide and control wells. Peptide and control stimulations were performed in triplicates.
  • Figure 1 1 shows further analysis of responses to the region corresponding to positions 161 to 210 of SEQ ID NO: 1
  • a - Top shows exemplary flow cytometry analysis of CD4 Tcells from a cancer patient, assessed by intracellular staining for IFN-g (PE-Cy7A) and TNF-alpha (APC-A) release following 8 hour stimulation with the peptide Arg(l 61-190) or unstimulated without peptide.
  • Bottom shows the proportion TNF-a releasing CD4+ T cells in this assay for 2 healthy donors (HD..) and 1 cancer patient (MM..).
  • IFNy ELISPOT responses from Arginase specific CD4 T cells produced by repeated stimulation with the peptide consisting of the amino acid sequence of SEQ ID NO: 9 (ArgShort)) when stimulated with ArgShort, the 30mer consisting of the sequence from positions 161 to 190 of Arginase 1 (Arg 161 -190), or the 50mer consisting of the sequence from positions 161 to 210 of Arginase 1 (Arg 161 -210), or when unstimulated (control).
  • FIG. 12 shows Arginase-specific T cells recognize arginase-expressing immune cells
  • Figure 13 is a sequence alignment of human Arginase 1 and murine Arginase 1.
  • Figure 14 shows that arginase specific immune responses are increased in C57BL/6 mice following vaccination with different peptides disclosed herein.
  • Figure 15 shows that arginase specific immune responses are increased in Balb/c mice following vaccination with different peptides disclosed herein.
  • Figure 16 shows reduction in tumour volumes in a mouse model of cancer vaccination with different peptides disclosed herein.
  • SEQ ID NO: 1 is the wild type amino acid sequence of human Arginase 1
  • SEQ ID NOS: 2 to 54 are the amino acid sequences of peptide fragments of human Arginase 1
  • SEQ ID NOs: 55 to 57 are the amino acid sequences of peptide fragments of murine Arginase 1
  • SEQ ID NOs: 58 is the amino acid sequence of a peptide fragment of human Arginase 2
  • SEQ ID NO: 59 is the wild type amino acid sequence of murine Arginase 1
  • 60 is the wild type amino acid sequence of human Arginase 2
  • SEQ ID NO: 61 is an alternative sequence of human Arginase 1
  • the present invention is concerned with immunogenic polypeptide fragments of Arginase proteins. Such fragments may be useful as vaccines.
  • immunogenic it is meant that a polypeptide fragment is capable of eliciting an immune response, preferably a T-cell response, in at least one individual after administration to said individual.
  • a polypeptide may be identified as immunogenic using any suitable method, including in vitro methods. For example, a peptide may be identified as immunogenic if it has at least one of the following characteristics:
  • SEQ ID NO: 52 corresponds to the region of Arginasel from position 161 to 210 of SEQ ID NO: 1. This region may be described as a hotspot for immunogenicity because it comprises sequences against which T cell responses are detected most frequently amongst cancer patients and healthy subjects.
  • the immunogenic polypeptide may be upto 50 or 55 amino acids in length and/or comprise at least 8, 9, 10, 15, 20, 25, 30, 35, 40, 45 or all 50 consecutive amino acids of SEQ ID NO: 52.
  • Said consecutive amino acids may preferably comprise or consist of any one of SEQ ID NOs: 50, 51 , 34, 35, 36, 37, 9, 53 and 54.
  • Each of SEQ ID NOs: 50, 51 , 34, 35, 36, 37, 9, 53 and 54 comprises sequences from within the sequence of SEQ ID NO: 52.
  • each of SEQ ID NOs: 50, 51, 34, 35, 36, 37, 9, 53 and 54 corresponds to the regions of SEQ ID NO: 1 defined by positions 161-190, 181-210, 161-180, 171-190, 181 -200, 191 -210, 174-182, 172-179 and 193-200, respectively.
  • the immunogenic polypeptide fragment may be upto 30, 35, 40, 45, 50 or 55 amino acids in length and comprise at least 8, 9, 10, 15, 20, 25 or all 30 consecutive amino acids of SEQ ID NO: 50 or 51.
  • the immunogenic polypeptide fragment may be upto 20, 25, 30, 35, 40, 45, 50 or 55 amino acids in length and comprise at least 8, 9, 10, 15 or all 20 consecutive amino acids of any one of SEQ ID NOs: 37, 36, 35, 34.
  • the polypeptide fragment preferably comprises at least 8, 9, 10, 15 or all 20 consecutive amino acids from the region defined by positions 181-200 of SEQ ID NO: 1 (that is SEQ ID NO: 36) or most preferably at least 8, 9, 10, 15 or all 20 consecutive amino acids from the region defined by positions 191-200 of SEQ ID NO: 1 (that is SEQ ID NO: 37).
  • the polypeptide fragment may comprise at least 8, 9, 10, 15 or all 20 consecutive amino acids from the region defined by positions 161-180 of SEQ ID NO: 1 (that is SEQ ID NO: 34) or positions 171-190 of SEQ ID NO: 1 (that is SEQ ID NO: 35).
  • the cysteine corresponding to position 168 may optionally be replaced by conservative substitution, e.g. to improve solubility or stability.
  • the immunogenic polypeptide fragment may be upto 8 or 9 amino acids in length and may comprise at least 8 or 9 consecutive amino acids of any one of SEQ ID NOs: 9, 53 or 54.
  • the immunogenic polypeptide fragment may comprise or consist of the amino acid sequence of any one of SEQ ID NOs: 52, 50, 51, 34, 35, 36, 37, 9, 53, 54, 2 to 33, or 38 to 49.
  • the inventors also identified responses in sequences which correspond to other regions of SEQ ID NO: 1 , including the regions defined by (or at least partially overlapping with) positions 221-240 (see SEQ ID NOs: 40, 7, 14); 271-290 (see SEQ ID NOs: 45, 8, 10, 11 , 12); 111-130 (see SEQ ID NOs: 29); 1 -20 (see SEQ ID NOs: 18); 61-80 (see SEQ ID NOs: 24); 131 -150 (see SEQ ID NOs: 31, 4); 141-160 (see SEQ ID NOs: 32, 4); 51-70 (see SEQ ID NOs: 23); 151-170 (see SEQ ID NOs: 33, 4); 211-240 (see SEQ ID NOs: 39, 6); and 281-300 (see SEQ ID NOs: 46).
  • the immunogenic polypeptide fragment may thus comprise at least 8, 9 or more consecutive amino acids from any one of these regions or sequences.
  • the immunogenic polypeptide fragment may comprise or consist of the amino acid sequence
  • Human Arginase 2 is related to Arginase 1 and there are some similarities in sequence (see SEQ ID NO: 60 versus SEQ ID NO: 1, respectively).
  • the regions of interest in Arginase 1 are thus also likely to be of interest in Arginase 2.
  • any one of the sequences described in the preceding section may have any one or more amino acids replaced with the one or more amino acids in the corresponding positions in Arginase 2.
  • the entirety of the said sequence may be replaced with the corresponding sequence in Arginase 2.
  • the immunogenic polypeptide may comprise or consist of a sequence of SEQ ID NO: 60 which is defined by the positions in SEQ ID NO: 60 that correspond to the positions in SEQ ID NO: 1 of any one of SEQ ID NOs: 52, 50, 51, 34, 35, 36, 37, 9, 53, 54, 2 to 33, or 38 to 49.
  • the hotspot region defined by positions 161-210 of SEQ ID NO: 1 corresponds to positions 180-229 of SEQ ID NO: 60 which are represented herein as SEQ ID NO: 58.
  • references to SEQ ID NO: 52 may be replaced by references to SEQ ID NO: 58.
  • the immunogenic polypeptide may comprise at least 8, 9, or preferably at least 20 or 30 consecutive amino acids of SEQ ID NO: 58.
  • Human Arginase 1 is also highly similar to murine Arginase 1 (see SEQ ID NO: 59 versus SEQ ID NO: 1, respectively, plus Figure 13). Accordingly, any one of the sequences described in the preceding section for human Arginase 1 may have any one or more amino acids replaced with the one or more amino acids in the corresponding positions in murine Arginase 1. The entirety of the said sequence may be replaced with the corresponding sequence in murine Arginase 1.
  • the immunogenic polypeptide may comprise or consist of a sequence of SEQ ID NO: 59 which is defined by the positions in SEQ ID NO: 59 that correspond to the positions in SEQ ID NO: 1 of any one of SEQ ID NOs: 52, 50, 51, 34, 35, 36, 37, 9, 53, 54, 2 to 33, or 38 to 49.
  • the hotspot region defined by positions 161-210 of SEQ ID NO: 1 corresponds to positions 161 -210 of SEQ ID NO: 59, which are represented herein as SEQ ID NO: 57.
  • references to SEQ ID NO: 52 may be replaced by references to SEQ ID NO: 57.
  • the immunogenic polypeptide may comprise at least 8, 9, or preferably at least 20 or 30 consecutive amino acids of SEQ ID NO: 57.
  • the C terminal amino acid may optionally be replaced with the corresponding amide, to improve solubility and/or to aid with manufacture / isolation.
  • the polypeptide may have attached at the N and/or C terminus at least one additional moiety to improve solubility and/or to aid with manufacture / isolation.
  • Suitable moieties include hydrophilic amino acids.
  • the amino acids KR may be added at the N terminus and/or the amino acids RK may be added in order at the C terminus.
  • Any polypeptide fragment described herein preferably has reduced arginase activity relative to the corresponding full-length arginase.
  • a reduction in arginase activity may include the reduction to inactivity.
  • a suitable assay for arginase activity is the Arginase Activity Colorimetric Assay Kit (Bio Vision Arginase assay # K755-100).
  • the present disclosure concerns a peptide compound of Arginase 1 selected from:
  • the C-terminal amino acid of any one of a), b) or c) also comprises the amide; or a pharmaceutically acceptable salt thereof.
  • the peptide compound is selected from b) a functional homologue having at least 70%, 80%, 90%, or 95% identity to SEQ ID NO 1 or the peptide fragment of a), wherein the C-terminal amino acid also comprises the amide; or a pharmaceutically acceptable salt thereof.
  • the functional homologue has at least 80% identity to SEQ ID NO 1.
  • the functional homologue has at least 90% identity to SEQ ID NO 1.
  • the functional homologue has at least 95% identity to SEQ ID NO 1.
  • the functional homologue has at least 70% identity to the peptide fragment of a).
  • the functional homologue has at least 80% identity to the peptide fragment of a).
  • the functional homologue has at least 90% identity to the peptide fragment of a).
  • the functional homologue has at least 95% identity to the peptide fragment of a).
  • the peptide compound is selected from c) a functional analogue wherein at least one amino acid has been deleted, inserted and/or substituted in SEQ ID NO 1 or the peptide fragment of a), wherein the C-terminal amino acid also comprises the amide; or a pharmaceutically acceptable salt thereof.
  • the peptide compound is selected from a) a peptide fragment of SEQ ID NO 1 consisting of a consecutive sequence of from 8 to 321 amino acids, wherein the C- terminal amino acid also comprises the amide; or a pharmaceutically acceptable salt thereof.
  • the peptide fragment consists of a consecutive sequence in the range of from 8 to 300 amino acids.
  • the peptide fragment consists of a consecutive sequence in the range of from 8 to 250 amino acids. In a further embodiment the peptide fragment consists of a consecutive sequence in the range of from 8 to 200 amino acids. In a further embodiment the peptide fragment consists of a consecutive sequence in the range of from 8 to 150 amino acids. In a further embodiment the peptide fragment consists of a consecutive sequence in the range of from 8 to 120 amino acids. In a further embodiment the peptide fragment consists of a consecutive sequence in the range of from 10 to 100 amino acids. In a further embodiment the peptide fragment consists of a consecutive sequence in the range of from 20 to 80 amino acids.
  • the peptide fragment consists of a consecutive sequence in the range of from 30 to 60 amino acids. In a further embodiment the peptide fragment consists of a consecutive sequence in the range of from 40 to 50 amino acids. In a still further embodiment the peptide fragment of SEQ ID NO 1 is selected from the group consisting of ARG(1 -310), ARG(1-301), ARG(1 -291), ARG(11 -322), ARG(21-322), ARG(30-322), ARG(40-322), ARG(11-310), ARG(11-301), ARG(11-291), ARG(21-310), ARG(21 -301), ARG(21-291), ARG(30-310), ARG(30-301), ARG(30-291), ARG(40-310), ARG(40-301), and ARG(40-291).
  • the peptide fragment of SEQ ID NO 1 is selected from ARG(1 -310). In a still further embodiment the peptide fragment of SEQ ID NO 1 is selected from ARG(1 -301). In a still further embodiment the peptide fragment of SEQ ID NO 1 is selected from ARG( 1-291). In a still further embodiment the peptide fragment of SEQ ID NO 1 is selected from ARG(11 -322). In a still further embodiment the peptide fragment of SEQ ID NO 1 is selected from ARG(21-322). In a still further embodiment the peptide fragment of SEQ ID NO 1 is selected from ARG(30-322). In a still further embodiment the peptide fragment of SEQ ID NO 1 is selected from ARG(40-322).
  • the peptide fragment of SEQ ID NO 1 is selected from ARG(11-310). In a still further embodiment the peptide fragment of SEQ ID NO 1 is selected from ARG(11-301). In a still further embodiment the peptide fragment of SEQ ID NO 1 is selected from ARG(1 1-291). In a still further embodiment the peptide fragment of SEQ ID NO 1 is selected from ARG(21-310). In a still further embodiment the peptide fragment of SEQ ID NO 1 is selected from ARG(21-301). In a still further embodiment the peptide fragment of SEQ ID NO 1 is selected from ARG(21 -291 ). In a still further embodiment the peptide fragment of SEQ ID NO 1 is selected from ARG(30-310).
  • the peptide fragment of SEQ ID NO 1 is selected from ARG(30-301). In a still further embodiment the peptide fragment of SEQ ID NO 1 is selected from ARG(30- 291). In a still further embodiment the peptide fragment of SEQ ID NO 1 is selected from ARG(40-310). In a still further embodiment the peptide fragment of SEQ ID NO 1 is selected from ARG(40-301). In a still further embodiment the peptide fragment of SEQ ID NO 1 is selected from ARG(40-291). In a still further embodiment the peptide fragment of SEQ ID NO 1 is selected from ARG(161-190). In a still further embodiment the peptide fragment of SEQ ID NO 1 is selected from ARG(181 -210). In a still further embodiment the peptide fragment of SEQ ID NO 1 is selected from ARG(161-210).
  • the peptide fragment consists of a consecutive sequence in the range of from 8 to 120, it may at the same time be selected within the sequence of for instance ARG(40-291), whereas a peptide fragment consisting of a consecutive sequence in the range of from 8 to 321, cannot be at the same time be selected within the sequence of for instance ARG(40-291), this is known to the person skilled in the art. Otherwise all combinations are contemplated within the present invention.
  • ARG(x-y), wherein x and y are integers selected from 1- 322 as used herein means a peptide fragment of Arginase 1 having the SEQ ID NO 1 as defined herein, wherein x is the N-terminal amino acid and y is the C-terminal amino acid, for instance ARG(174-182) indicates the peptide fragment from amino acid 174 of SEQ ID NO 1 to amino acid 182 of SEQ ID NO 1 wherein amino acid 174 is I and amino acid 182 is V.
  • identity refers to a relationship between the sequences of two or more peptides, such as polypeptides, as determined by comparing the sequences.
  • identity also means the degree of sequence relatedness between proteins or polypeptides, as determined by the number of matches between strings of two or more amino acid residues.
  • Identity measures the percent of identical matches between the smaller of two or more sequences with gap alignments (if any) addressed by a particular mathematical model or computer program (i.e., "algorithms”). Identity of related proteins or peptides can be readily calculated by known methods. Such methods include, but are not limited to, those described in Computational Molecular Biology, Lesk, A.
  • Preferred methods to determine identity are designed to give the largest match between the sequences tested. Methods to determine identity are described in publicly available computer programs. Preferred computer program methods to determine identity between two sequences include the GCG program package, including GAP (Devereux et al., Nucl. Acid. Res., 12, 387, (1984); Genetics Computer Group, University of Wisconsin, Madison, Wis.), BLASTP,
  • GAP Genetics Computer Group, University of Wisconsin, Madison, Wis.
  • two proteins for which the percent sequence identity is to be determined are aligned for optimal matching of their respective amino acids (the "matched span", as determined by the algorithm).
  • a gap opening penalty (which is calculated as 3 times the average diagonal; the "average diagonal” is the average of the diagonal of the comparison matrix being used; the “diagonal” is the score or number assigned to each perfect amino acid match by the particular comparison matrix) and a gap extension penalty (which is usually ⁇ fraction (1/10) ⁇ times the gap opening penalty), as well as a comparison matrix such as PAM 250 or BLOSUM 62 are used in conjunction with the algorithm.
  • a standard comparison matrix see Dayhoff et al., Atlas of Protein Sequence and Structure, vol.
  • the arginase activity is reduced compared to Arginase 1 as measured by an arginase activity assay. In one embodiment the arginase activity is reduced to inactivity. In another embodiment the arginase activity assay is selected from the Arginase Activity Colorimetric Assay Kit ( Bio Vision Arginase assay # K755-100). In a further embodiment the arginase activity is reduced to inactivity compared to Arginase 1 as measured by the arginase activity assay is selected from the Arginase Activity Colorimetric Assay Kit.
  • the consecutive sequence comprises one or more sequences selected from any one of SEQ ID NO 2-17. In one embodiment the consecutive sequence comprises the sequence selected from SEQ ID NO 9. In another embodiment the consecutive sequence comprises only the sequence selected from SEQ ID NO 9, but not any one of the SEQ ID NO 2-8 or 10-17.
  • consecutive sequence comprises the sequence having SEQ ID NO 51. In a further embodiment the consecutive sequence comprises the sequence having SEQ ID NO 52.
  • the peptide fragment under a), the functional homologue under b), or the functional analogue under c) activates T cells that recognizes Arginase 1 expressing cells.
  • the activation is determined by the ELISPOT assay described herein.
  • the peptide fragment under a) activates T cells that recognizes Arginase 1 expressing cells as determined by the ELISPOT assay described herein.
  • the disclosure concerns a peptide compound of Arginase 1 selected from:
  • SEQ ID NO 52 or a peptide fragment of SEQ ID NO 52 consisting of a consecutive sequence having from 8 to 49 amino acids
  • a functional analogue wherein at least one amino acid has been deleted, inserted and/or substituted in SEQ ID NO 52 or the peptide fragment of a), and wherein the C-terminal amino acid of any one of a), b) or c) also comprises the amide; or a pharmaceutically acceptable salt thereof. It is intended that any one of the peptide compounds of a), b) or c) can be the subject of individual embodiments.
  • the peptide fragment consists of a consecutive sequence in the range of from 9 to 49 amino acids, such as from 10 to 40 amino acids, such as from 20 to 30 amino acids.
  • the peptide fragment of SEQ ID NO 52 consisting of a consecutive sequence having from 8 to 49 amino acids comprises the SEQ ID NO 51. In a further embodiment the peptide fragment of SEQ ID NO 52 consisting of a consecutive sequence having from 8 to 49 amino acids, comprises the SEQ ID NO 50. In a further embodiment the peptide fragment of SEQ ID NO 52 consisting of a consecutive sequence having from 8 to 49 amino acids, comprises the SEQ ID NO 9.
  • the peptide fragment comprises at least one CD4+ and at least one CD8+ T cell epitope. In a still further embodiment the peptide fragment comprises at least one CD4+ or at least one CD8+ T cell epitope. In a further embodiment the peptide fragment comprises at least one CD4+ T cell epitope. In a still further embodiment the peptide fragment comprises at least one CD8+ T cell epitope. In a further embodiment the peptide fragment comprises all T cell epitopes, in particular all CD4+ and CD8+ epitopes, located in a hot-spot region in ARG(161 -210). In a still further embodiment the peptide fragment comprises all T cell epitopes except one, in particular all CD4+ and CD8+ epitopes, located in a hot-spot region in ARG(161 -210).
  • the disclosure relates to a nucleic acid encoding the peptide compound of the present invention.
  • the peptide compound is selected from any one of the above embodiments.
  • the nucleic acid is selected from the group consisting of DNA and RNA.
  • the disclosure relates to a vector comprising the nucleic acid of the present invention.
  • the nucleic acid is selected from any one of the above embodiments, and the peptide compound of the present invention is selected from any one of the above embodiments.
  • the vector is selected from a virus vector.
  • the present disclosure relates to a host cell comprising the vector of the present invention.
  • the vector is selected from any one of the above embodiments
  • the nucleic acid is selected from any one of the above embodiments
  • the peptide compound is selected from any one of the above embodiments.
  • the host cell is selected from a mammalian cell.
  • the disclosure relates to a vector comprising a nucleic acid encoding an inactive sequence of Arginase 1 selected from:
  • the C-terminal amino acid of any one of a), b) or c) also comprises the amide, wherein the nucleic acid expresses the inactive sequence, and wherein the inactive sequence comprises at least 1 immunogenic epitope.
  • the epitope is selected from the group consisting of SEQ ID NO 2-17, typically the epitope is selected from SEQ ID NO 9.
  • the epitope may comprise any sequence of at least 8 consecutive amino acids comprised within any one of SEQ ID NOs: 50 - 52.
  • the disclosure relates to a composition
  • a composition comprising the peptide compound or the nucleic acid or the vector or the host cell of the present disclosure, optionally together with a pharmaceutically acceptable additive, such as carrier or adjuvants.
  • an immunotherapeutic composition comprising
  • the immunotherapeutic composition is for use in a method for treatment or prevention of a disease, disorder or condition selected from cancer.
  • the cancer is a tumor forming cancer disease.
  • the adjuvant is selected from the group consisting of bacterial DNA based adjuvants, oil/surfactant based adjuvants, viral dsRNA based adjuvants, imidazochinilines, and a Montanide ISA adjuvant.
  • the present disclosure relates to a kit-of-parts comprising;
  • composition comprising at least one second active ingredient, selected from an im- munostimulating compound, such as an interleukin, e.g. IL-2 and or IL-21, an anti-cancer agent, such as Actimide, Azacitidine, Azathio-prine, Bleomycin, Carboplatin, Capecitabine, Cisplatin, Chlorambucil, Cyclophospha-mide, Cytarabine, Daunorubicin, Docetaxel, Doxifluridine, Doxorubicin, Epirubicin, Etoposide, Fludarabine, Fluorouracil, Gemcitabine, Hydroxyurea, Idarubicin, Irinotec-an, Lenalidomide, Leucovorin, Mechlorethamine, Melphalan,
  • an im- munostimulating compound such as an interleukin, e.g. IL-2 and or IL-21
  • an anti-cancer agent such as Actimide, Azacitidine, Azathi
  • pembrolizumab Pemetrexed, Revlimid, Temozolomide, Teniposide, Thioguanine, Valrubicin, Vinblastine, Vincristine, Vindesine and Vinorelbine.
  • kits-of-parts the provided compositions are to be administered simultaneously or sequentially.
  • the disclsoure relates to a method of treating a clinical condition characterized by expression of Arginase 1 of SEQ ID NO 1, the method comprising
  • the disclosure relates to a method of stimulation of arginase 1 specific T-cells, such as CD4 and CD8 T-cells, in a cancer patient, the method comprising administering to the cancer patient an effective amount of the peptide compound of, or the nucleic, or the vector, or the host cell of the disclosure.
  • the present disclosure relates to a method of suppressing an immune suppressive function of Arginase 1 expressing cells, in a cancer patient, the method comprising administering to the cancer patient an effective amount of the peptide compound, or the nucleic acid, or the vector, or the host cell of the disclosure.
  • the disclosure relates to use of the peptide compound, or the nucleic acid, or the vector, or the host cell of the disclosure, for the manufacture of a medicament, such as an immunotherapeutic composition or vaccine, for the treatment or prevention of a cancer characterized by expression of Arginase 1.
  • the disclosure relates to the peptide compound, or the nucleic acid, or the vector, or the host cell of the disclosure, for use in a method for treatment or prevention of a cancer, when administered simultaneously or sequentially with an additional cancer therapy.
  • the additional cancer therapy is selected from the group consisting of a cytokine therapy, a T-cell therapy, an NK therapy, an immune system checkpoint inhibitor, chemotherapy, radiotherapy, immuno stimulating substances, gene therapy, anti-bodies and dendritic cells.
  • the additional cancer therapy is selected from an immune system checkpoint inhibitor, such as a checkpoint blocking antibody (e.g nivolumab, pembrolizumab), or is selected from the group consisting of Actimide, Azacitidine, Azathioprine, Bleomycin, Carboplatin, Capecitabine, Cisplatin, Chlorambucil, Cyclophosphamide, Cytarabine, Dauno-rubicin,
  • an immune system checkpoint inhibitor such as a checkpoint blocking antibody (e.g nivolumab, pembrolizumab)
  • Actimide Azacitidine, Azathioprine, Bleomycin, Carboplatin, Capecitabine, Cisplatin, Chlorambucil
  • Docetaxel Doxifluridine, Doxorubicin, Epirubicin, Etoposide, Fludarabine, Fluor-ouracil, Gemcitabine, Hydroxyurea, Idarubicin, Irinotecan, Lenalidomide, Leucovorin,
  • Arginase activity may be measured for instance by using the Arginase Activity
  • BioVision Arginase assay # K755-100 BioVision's Arginase Activity Assay kit is simple, sensitive and rapid. In this assay, Arginase reacts with arginine & undergoes a series of reactions to form an intermediate that reacts stoichiometrically with OxiRedTM Probe to generate the colored product (OD 570 nm).
  • the kit can detect Arginase activity less than 0.2 U/L in 96-well assay format.
  • any amino acid sequence shown may be modified at the C-terminal amino acid to be in amide form (-CONH2) or may be in acid form (-COOH), thus any one of these are preferred embodiments, and it is intended that any C-terminal amino acid, such as I, F, R, L, K, G, M, D, V, S, T, N, Y, P comprises both amide and acid forms unless specified by -NH2 or - OH.
  • the arginase peptide fragments disclosed herein are made by standard peptide synthesis, such as solid-phase peptide synthesis (SPPS).
  • SPPS is a standard method for synthesizing peptides in the lab. SPPS allows for the synthesis of natural peptides which are difficult to express in bacteria, the incorporation of unnatural amino acids, peptide/protein backbone modification, and the synthesis of D-proteins, which consist of D-amino acids. Small porous beads are treated with functional units (linkers') on which peptide chains can be built. The peptide will remain covalently attached to the bead until cleaved from it by a reagent such as anhydrous hydrogen fluoride or trifiuoroacetic acid.
  • a reagent such as anhydrous hydrogen fluoride or trifiuoroacetic acid.
  • the peptide is thus 'immobilized' on the solid-phase and can be retained during a filtration process while liquid-phase reagents and by- products of synthesis are flushed away.
  • the general principle of SPPS is one of repeated cycles of deprotection-wash-coupling-wash.
  • the free N-terminal amine of a solid-phase attached peptide is coupled to a single N-protected amino acid unit. This unit is then deprotected, revealing a new N-terminal amine to which a further amino acid may be attached.
  • the superiority of this technique partially lies in the ability to perform wash cycles after each reaction, removing excess reagent with all of the growing peptide of interest remaining covalently attached to the insoluble resin.
  • a therapeutically effective amount of at least one compound is administered to a mammal in need of said treatment.
  • amino acids are identified by the one or three letter code known to the person skilled in the art and shown in the table below for convenience:
  • treatment means the management and care of a patient for the purpose of combating a condition, such as a disease or a disorder.
  • the term is intended to include the full spectrum of treatments for a given condition from which the patient is suffering, such as administration of the active compound to alleviate the symptoms or complications, to delay the progression of the disease, disorder or condition, to alleviate or relief the symptoms and complications, and/or to cure or eliminate the disease, disorder or condition as well as to prevent the condition, wherein prevention is to be understood as the management and care of a patient for the purpose of combating the disease, condition, or disorder and includes the administration of the active compounds to prevent the onset of the symptoms or complications.
  • the treatment may either be performed in an acute or in a chronic way.
  • the patient to be treated is preferably a mammal; in particular a human being, but it may also include animals, such as dogs, cats, cows, monkeys, apes, sheep and pigs.
  • a therapeutically effective amount of a peptide compound of the present invention or a peptide fragment disclosed herein, as used herein means an amount sufficient to cure, alleviate or partially arrest the clinical manifestations of a given disease and its
  • a pharmaceutical composition comprising the peptide compound, such as peptide fragment, of the present invention and optionally a pharmaceutically acceptable additive, such as a carrier or an excipient.
  • pharmaceutically acceptable additive is intended without limitation to include carriers, excipients, diluents, adjuvant, colorings, aroma, preservatives etc. that the skilled person would consider using when formulating a compound of the present invention in order to make a pharmaceutical composition.
  • the adjuvants, diluents, excipients and/or carriers that may be used in the composition of the invention must be pharmaceutically acceptable in the sense of being compatible with the peptide compound, peptide fragment, nucleic acid, vector, or host cell and the other ingredients of the pharmaceutical composition, and not deleterious to the recipient thereof. It is preferred that the compositions shall not contain any material that may cause an adverse reaction, such as an allergic reaction.
  • the adjuvants, diluents, excipients and carriers that may be used in the pharmaceutical composition of the invention are well known to a person within the art.
  • Adjuvants are any substance whose admixture into the composition increases or otherwise modifies the immune response elicited by the composition.
  • Adjuvants broadly defined, are substances which promote immune responses. Adjuvants may also preferably have a depot effect, in that they also result in a slow and sustained release of an active agent from the administration site. A general discussion of adjuvants is provided in Goding, Monoclonal Antibodies: Principles & Practice (2nd edition, 1986) at pages 61-63.
  • Adjuvants may be selected from the group consisting of: A1K(S04)2, AlNa(S04)2, A1NH4 (S04), silica, alum, Al(OH)3, Ca3 (P04)2, kaolin, carbon, aluminum hydroxide, muramyl dipeptides, N-acetyl-muramyl-L-threonyl-D-isoglutamine (thr-DMP), N-acetyl- nornuramyl-L-alanyl-D-isoglutamine (CGP 1 1687, also referred to as nor-MDP), N- acetylmuramyul-L-alanyl-D-isoglutaminyl-L-alanine-2-(r2'-dipalmitoyl-sn -glycero-3- hydroxphosphoryloxy)-ethylamine (CGP 19835A, also referred to as MTP-PE), RIBI
  • Preferred adjuvants to be used with the invention include oil/surfactant based adjuvants such as Montanide adjuvants (available from Seppic, Belgium), preferably Montanide ISA-51.
  • Other preferred adjuvants are bacterial DNA based adjuvants, such as adjuvants including CpG oligonucleotide sequences.
  • Yet other preferred adjuvants are viral dsRNA based adjuvants, such as poly I:C. GM-CSF and Imidazochinilines are also examples of preferred adjuvants.
  • the adjuvant is most preferably a Montanide ISA adjuvant.
  • the Montanide ISA adjuvant is preferably Montanide ISA 51 or Montanide ISA 720.
  • a peptide compound, peptide fragment, nucleic acid, vector, or host cell of an immunotherapeutic composition of the invention may be coupled to a carrier.
  • a carrier may be present independently of an adjuvant.
  • the function of a carrier can be, for example, to increase the molecular weight of the peptide compound, peptide fragment, nucleic acid, vector, or host cell in order to increase activity or immunogenicity, to confer stability, to increase the biological activity, or to increase serum half- life.
  • a carrier may aid in presenting the polypeptide or fragment thereof to T-cells.
  • the polypeptide or fragment thereof may be associated with a carrier such as those set out below.
  • the carrier may be any suitable carrier known to a person skilled in the art, for example a protein or an antigen presenting cell, such as a dendritic cell (DC).
  • Carrier proteins include keyhole limpet hemocyanin, serum proteins such as transferrin, bovine serum albumin, human serum albumin, thyroglobulin or ovalbumin, immunoglobulins, or hormones, such as insulin or palmitic acid.
  • the carrier protein may be tetanus toxoid or diphtheria toxoid.
  • the carrier may be a dextran such as sepharose.
  • the carrier must be a dextran such as sepharose.
  • the immunotherapeutic composition may optionally comprise a pharmaceutically acceptable excipient.
  • the excipient must be 'acceptable' in the sense of being compatible with the other ingredients of the composition and not deleterious to the recipient thereof.
  • Auxiliary substances such as wetting or emulsifying agents, pH buffering substances and the like, may be present in the excipient.
  • These excipients and auxiliary substances are generally pharmaceutical agents that do not induce an immune response in the individual receiving the composition, and which may be administered without undue toxicity.
  • Pharmaceutically acceptable excipients include, but are not limited to, liquids such as water, saline, polyethyleneglycol, hyaluronic acid, glycerol and ethanol.
  • Pharmaceutically acceptable salts can also be included therein, for example, mineral acid salts such as hydrochlorides, hydrobromides, phosphates, sulfates, and the like; and the salts of organic acids such as acetates, propionates, malonates, benzoates, and the like.
  • mineral acid salts such as hydrochlorides, hydrobromides, phosphates, sulfates, and the like
  • organic acids such as acetates, propionates, malonates, benzoates, and the like.
  • the immunotherapeutic composition may be prepared, packaged, or sold in a form suitable for bolus administration or for continuous administration.
  • injectable compositions may be prepared, packaged, or sold in unit dosage form, such as in ampoules or in multi-dose containers containing a preservative.
  • Compositions include, but are not limited to, suspensions, solutions, emulsions in oily or aqueous vehicles, pastes, and implantable sustained-release or biodegradable formulations.
  • the active ingredient is provided in dry (for e.g., a powder or granules) form for reconstitution with a suitable vehicle (e. g., sterile pyrogen-free water) prior to administration of the reconstituted composition.
  • a suitable vehicle e. g., sterile pyrogen-free water
  • the composition may be prepared, packaged, or sold in the form of a sterile injectable aqueous or oily suspension or solution.
  • This suspension or solution may be formulated according to the known art, and may comprise, in addition to the active ingredient, additional ingredients such as the adjuvants, excipients and auxiliary substances described herein.
  • Such sterile injectable formulations may be prepared using a non-toxic parenterally-acceptable diluent or solvent, such as water or 1,3-butane diol, for example.
  • Other acceptable diluents and solvents include, but are not limited to, Ringer's solution, isotonic sodium chloride solution, and fixed oils such as synthetic mono-or di-glycerides.
  • compositions which are useful include those which comprise the active ingredient in microcrystalline form, in a liposomal preparation, or as a component of a biodegradable polymer systems.
  • Compositions for sustained release or implantation may comprise pharmaceutically acceptable polymeric or hydrophobic materials such as an emulsion, an ion exchange resin, a sparingly soluble polymer, or a sparingly soluble salt.
  • the active ingredients of the composition may be encapsulated, adsorbed to, or associated with, particulate carriers. Suitable particulate carriers include those derived from polymethyl methacrylate polymers, as well as PLG microparticles derived from poly(lactides) and poly(lactide-co- glycolides).
  • particulate systems and polymers can also be used, for example, polymers such as polylysine, polyarginine, poly ornithine, spermine, spermidine, as well as conjugates of these molecules.
  • compositions and particularly immunotherapetic compositions as herein disclosed may, in addition to the compounds herein disclosed, further comprise at least one pharmaceutically acceptable adjuvant, diluent, excipient and/or carrier.
  • the pharmaceutical compositions comprise from 1 to 99 weight % of said at least one pharmaceutically acceptable adjuvant, diluent, excipient and/or carrier and from 1 to 99 weight % of a compound as herein disclosed.
  • the combined amount of the active ingredient and of the pharmaceutically acceptable adjuvant, diluent, excipient and/or carrier may not constitute more than 100% by weight of the composition, particularly the pharmaceutical composition.
  • two or more of the compound as herein disclosed are used in combination for the purposes discussed above.
  • composition particularly immunotherapetic composition comprising a compound set forth herein may be adapted for oral, intravenous, topical, intraperitoneal, nasal, buccal, sublingual, or subcutaneous administration, or for administration via the respiratory tract in the form of, for example, an aerosol or an air-suspended fine powder. Therefore, the pharmaceutical composition may be in the form of, for example, tablets, capsules, powders, nanoparticles, crystals, amorphous substances, solutions, transdermal patches or suppositories.
  • polypeptide is used herein in its broadest sense to refer to a compound of two or more subunit amino acids, amino acid analogs, or other peptidomimetics.
  • polypeptide thus includes short peptide sequences and also longer polypeptides and proteins.
  • amino acid refers to either natural and/or unnatural or synthetic amino acids, including both D or L optical isomers, amino acid analogs and peptidomimetics, and any pharmaceutically acceptable salts thereof.
  • a "subject” as used herein includes any mammal, preferably a human.
  • a peptide compound of Arginase 1 selected from:
  • the C-terminal amino acid of any one of a), b) or c) also comprises the amide; or a pharmaceutically acceptable salt thereof.
  • peptide compound of aspectl selected from a) a peptide fragment of SEQ ID NO 1 consisting of a consecutive sequence of from 8 to 321 amino acids, wherein the C-terminal amino acid also comprises the amide;
  • the peptide compound of aspect2 wherein the peptide fragment consists of a consecutive sequence in the range of from 8 to 300 amino acids, 8 to 250 amino acids, 8 to 200 amino acids, 8 to 150 amino acids, 8 to 120 amino acids, e.g. 10 to 100 amino acids, 20 to 80 amino acids, 30 to 60 amino acids, 40 to 50 amino acids.
  • peptide compound of any one of aspects 2-3 wherein the peptide fragment of SEQ ID NO 1 is selected from the group consisting of ARG(1-310), ARG(1-301), ARG(1 -291), ARG(11-322), ARG(21-322), ARG(30-322), ARG(40-322), ARG(11-310), ARG(11 -301),
  • the peptide compound of aspect7 wherein the activation is determined by the ELISPOT assay described herein.
  • a nucleic acid such as DNA or RNA, encoding the peptide compound of any one of the preceding aspects.
  • a vector such virus vector, comprising the nucleic acid of aspect9. 1 1.
  • a host cell such as mammalian cell, comprising the vector of aspectl 0.
  • a vector comprising a nucleic acid encoding an inactive sequence of Arginase 1 selected from:
  • the C-terminal amino acid of any one of a), b) or c) also comprises the amide, wherein the nucleic acid expresses the inactive sequence, and wherein the inactive sequence comprises at least 1 immunogenic epitope, such as an epitope selected from the group consisting of SEQ ID NO 2-17, typically the epitope is selected from SEQ ID NO 9.
  • a composition comprising the peptide compound of any one of aspects 1-8 or the nucleic acid of aspect 9 or vector of aspectl 0 or 12 or host cell of aspectl 1 , optionally together with a pharmaceutically acceptable additive, such as carrier or adjuvans.
  • An immunotherapeutic composition comprising
  • the immunotherapeutic composition of aspect 14 for use in a method for treatment or prevention of a disease, disorder or condition selected from cancer, such as a tumor forming cancer disease.
  • a kit-of-parts comprising;
  • compositions comprising at least one second active ingredient, selected from an immuno stimulating compound, such as an interleukin, e.g. IL-2 and or IL-21 , an anticancer agent, such as a chemo therapeutic agent, e.g. Actimide, Azacitidine, Azathioprine, Bleomycin, Carboplatin, Capecitabine, Cisplatin, Chlorambucil, Cyclophosphamide, Cytarabine, Daunorubicin, Docetaxel, Doxifiuridine, Doxorubicin, Epirubicin, Etoposide, Fludarabine, Fluorouracil, Gemcitabine, Hydroxyurea, Idarubicin, Irinotecan,
  • an immuno stimulating compound such as an interleukin, e.g. IL-2 and or IL-21
  • an anticancer agent such as a chemo therapeutic agent, e.g. Actimide, Azacitidine, Azathioprine, Bleomycin,
  • Lenalidomide Leucovorin, Mechlorethamine, Melphalan, Mercaptopurine, Methotrexate, Mitoxantrone, nivolumab, Oxaliplatin, Paclitaxel, pembrolizumab, Pemetrexed,
  • kits-of-parts according to aspectl7, where the provided compositions are to be administered simultaneously or sequentially.
  • a method of treating a clinical condition characterized by expression of Arginase 1 of SEQ ID NO 1 the method comprising administering to an individual suffering from said clinical condition an effective amount of the peptide compound of any one of aspects 1-8 or the nucleic acid of aspect9 or vector of aspect 10 or 12 or host cell of aspect 11.
  • a method of stimulation of arginase 1 specific T-cells, such as CD4 and CD8 T-cells, in a cancer patient comprising administering to the cancer patient an effective amount of the peptide compound of any one of aspects 1 -8 or the nucleic acid of aspect9 or vector of aspect 10 or 12 or host cell of aspect 11.
  • a method of suppressing an immune suppressive function of Arginase 1 expressing cells, in a cancer patient comprising administering to the cancer patient an effective amount of the peptide compound of any one of aspects 1 -8 or the nucleic acid of aspect9 or vector of aspect 10 or 12 or host cell of aspect 11.
  • a peptide compound of any one of aspects 1-8 or the nucleic acid of aspect9 or vector of aspectlO or 12 or host cell of aspectl 1 for use in a method for treatment or prevention of a cancer, when administered simultaneously or sequentially with an additional cancer therapy, such as a cytokine therapy, a T-cell therapy, an NK therapy, an immune system checkpoint inhibitor, chemotherapy, radiotherapy, immunostimulating substances, gene therapy, antibodies and dendritic cells.
  • an additional cancer therapy such as a cytokine therapy, a T-cell therapy, an NK therapy, an immune system checkpoint inhibitor, chemotherapy, radiotherapy, immunostimulating substances, gene therapy, antibodies and dendritic cells.
  • checkpoint blocking antibodies are selected from Actimide, Azacitidine, Azathioprine, Bleomycin, Carboplatin, Capecitabine, Cisplatin, Chlorambucil, Cyclophosphamide, Cytarabine, Daunorubicin, Docetaxel, Doxifluridine, Doxorubicin, Epirubicin, Etoposide, Fludarabine, Fluorouracil, Gemcitabine, Hydroxyurea, Idarubicin, Irinotecan, Lenalidomide, Leucovorin, Mechlorethamine, Melphalan, Mercaptopurine, Methotrexate, Mitoxantrone, Nivolumab, Oxaliplatin, Paclitaxel, Pembrolizumab, Pemetrexed, Revlimid, Temozolomide, Teniposide, Thioguanine, Valrubicin, Vinblastine, Vin
  • the present inventor also will identify if T cells likewise recognize Arginase. Furthermore, immunogenic epitopes from Arginase will be identified. Using the reverse immunology approach, potential MHC class I binding motifs will be identified followed by the synthesis of candidate peptides. Subsequently, the actual binding to the corresponding MHC alleles will be established.
  • class I binding peptide compounds Following the identification of class I binding peptide compounds, such peptides will be examined in an ELISPOT assay for cytokine release by peptide specific T cells in order to examine whether specific T cells are present among peripheral PBMC of cancer patients as well as healthy donors.
  • tetrameric MHC/-peptide-complexes will be used as additional means of investigating T-cell reactivity in peripheral blood by flow cytometry.
  • tetrameric MHC/peptide complexes will be used to isolate specific T cells directly from patient blood or tumor infiltrated lymph nodes. This will be used determine the functional capacity of specific T cells.
  • CD4+ T cells play a critical role in generating and maintaining antigen-specific cellular and humoral immune responses.
  • CD4+ T cells are presented with 18-mer overlapping synthetic peptides spanning the entire protein sequence in ELISPOT assays. Peptide-specific
  • CD4+ T-cell clones are generated by repetitive stimulation with peptide. Furthermore, using a set of partially histocompatible EBV-B cell lines and MHC class II-specific antibodies, the HLA class II restriction elements will be identified. Finally, tumor infiltrating lymphocytes (TIL) cultures will be analyzed for reactivity against CD4 and CD8 peptide epitopes revealing important information regarding pivotal in vivo targets.
  • TIL tumor infiltrating lymphocytes
  • Arginase is a major player in the immune system and is, it could be speculated that such T cells are involved in general immune regulation.
  • An additional part of these studies aim at analysing the role of Arginase specific T cells may therefore also have a role in immune regulation.
  • Arginase-specific T cells can effect immunity by eliminating arginase-expressing regulatory cells thereby suppressing and/or delaying local immune suppression.
  • Argiasese T cells it will be examined if tThe presence of Arginase-specific T cells or the activation of such T cells by Arginase- derived peptides may boost additional T- and/or B-cell responses against other antigens.
  • any "supportive" effect of Arginase-specific T cells on other immune cells may well be mediated in several direct and indirect manners.
  • the level of essential amino acids will be examined, the frequency of Tregs as well as the frequency of IL-17 producing cells.
  • the effect of Arginase-specific T cells on the overall production of different cytokines including INF- ⁇ , IL-6, TNF-a as well as IL-10 and TGF- ⁇ , will be examined.
  • Another possible effect of Arginase-specific T cells could be mediated through the metabolites of arginin.
  • sequences of the peptides used in these experiments are shown in full in Table A below (see the section entitled "Sequences”).
  • Peptides are described in Table A by SEQ ID NO, by name, or by reference to the start and end positions of each peptide sequence within the full length sequence of Arginase 1.
  • SEQ ID NO: 34 may alternatively be referred to by the name Argl-17 or may alternatively be referred to as Arg 161-190 (given a start position of 161 and end position of 190).
  • the intended reference in each case will be clear from the context.
  • the peptide of SEQ ID NO: 9 may additionally be referred to as ArgShort.
  • the present project is based on analyses of blood and tumor lesions from melanoma, renal cell carcinoma and ovarian cancer patients. Collection of blood and tumor samples was conducted at Herlev Hospital. Blood samples were drawn a minimum of four weeks after termination of any kind of anti-cancer therapy. PBMC were isolated using LymphoprepTM (Alere AS, cat. 11 14547) separation, HLA-typed and frozen in FCS with 10% DMSO (Sigma- Aldrich, cat. D5879- 100ML). The immediate processing of the material was handled at the CCIT (Centre for Cancer Immunotherapy) in accordance with local ethical requirements. All patients only participate upon written informed consent, and that the ethical committee have approved the projects.
  • ELISPOT Enzyme -Linked Immunospot
  • the "ELISPOT” technique takes advantage of the fact that T-cells synthesize cytokines e.g. IFN- ⁇ upon TCR engagement and subsequent signaling.
  • the method may be used to analyze for secretion of any cytokine of choice - in our laboratory we routinely use IFN- ⁇ , TNF-a, IL-10, Granzyme-B as well as perforin - ELISPOT analyses. Standardized quantitation is accomplished by the use of an ELISPOT reader (IMMUNOSPOT, CTLanalyzers LLC http://www.immunospot.com/).
  • Target cells were T2-cells (ATCC), HLA-A2 + melanoma cell lines (FM3 and FM93)
  • T-cells can be isolated and expanded in vitro.
  • cells were stimulated with Arginase derived peptide and for surface markers we employed 4 ⁇ R, 10 ⁇ CD4 PerCP, 2 ⁇ CD8 Pacific Blue, and 10 ⁇ CD3 FUC and for intracellular staining we used 2 ⁇ anti-TNF-a and anti-IFN-g antibodies conjugated with either PE-Cy7 or APC. Washing, permeabilization and staining procedures followed previously described methods [4]. Flow cytometry analysis was performed on a FACSCANTO II (BD Biosciences, San Jose CA, USA)
  • Arg 1 to Arg 16 16 peptides derived from Arginase 1 were designed. These peptides are referred to herein as Arg 1 to Arg 16 (SEQ ID NOs: 12 to 17). The sequences ofthese peptides are shown in full in Table A below (see the section entitled “Sequences”). 15 of the peptides (Argl to Argl5) were examined in ELISPOT.
  • PBMC peripheral blood mononuclear cells
  • FIG. 1 exemplifies Arg- specific T cell responses. Especially Arg8 (SEQ ID NO 9) was examined in more detail.
  • Arginase positive cancer (melanoma) cell lines FM3 and FM93 by Arginase specific T cells was also demonstrated using standard chromium release assays as seen in figure 6.
  • Arginase specific T cells were incubated 4 h with either Cr-labeled melanoma cell lines FM3 or FM93 at different effectontarget ratios. Both cell lines express intracellular Arginase.
  • Both CD8 and CD4 T cells can recognize Arginase derived peptides on the surface of target cells.
  • the region spanning positions 161 to 190 of Arginase 1 appears to be particularly immunogenic. This region may be referred to herein as a hotspot.
  • PBMCs from healthy donors or cancer patients were stimulated with 80 ⁇ g of arginase-derived peptides and 120 U/ml IL-2 (Peprotech, London, UK, cat. 200-02) for a week.
  • 4-6x105 PBMCs were then placed in the bottom of ELISPOT plate (nitrocellulose bottomed 96-well plates by MultiScreen MAIP N45; Millipore, cat. MSIPN4W50) pre-coated with IFN- ⁇ capture Ab (Mabtech, cat. 3420-3-1000) and l-10 ⁇ g of arginase derived peptides were added.
  • PBMCs from each patient and donors were set up in duplicates or triplicates for peptide and control stimulations.
  • PBMCs were pre-incubated with 2 ⁇ g/ml of the blocking antibodies: anti -human HLA-DR, DP, DQ antibody CloneTu39 (Biolegend, cat. 361702) or anti- human HLA-ABC antibody Clone w6/32 (Dako, Agilent) for 20 min at RT before the addition of the peptide.
  • Arginase-specific T cell culture were established by stimulation of cancer patient PBMC with irradiated ArgShort (SEQ ID NO 9) peptide-loaded autologous DC or PBMCs. The following day IL-7 and IL-12 (PeproTech, London, UK, cat. 200-07-10 and 200-12) were added.
  • DCs were generated from PBMC by adherence on culture dishes at 37 °C for 1-2 hr. in RPMI- 1640.
  • Adherent monocytes were cultured in RPMI-1640 supplemented with 10% FCS in the presence of IL-4 (250 U/ml) and GM-CSF (1000 U/ml) (Peprotech, London, UK, cat. 200-04 and 300-03-100) for 6 days.
  • DCs were matured by addition of IL- ⁇ (lOOOU/ml), IL-6 (lOOOU/ml) TNF- ⁇ (lOOOU/ml) (Peprotech, London, UK, cat. 200-01B, 200-06 and 300-01A) and PGE2 (lug/ml) (Sigma Aldrich, cat. P6532).
  • PBMCs from cancer patients were thawed and rested overnight.
  • B cells were isolated from patient PBMCs using Pan B Cell Isolation Kit (Miltenyi Biotec Inc., cat. 130-101 -638) according to manufacturer's instructions.
  • the cDNA encoding Arginase (accession nr. NM_000045 ) was synthesized and cloned into either pSP73-SphA64 (kindly provided by Dr. E. Gilboa, Duke University Medical Center, Durham, NC) using 5'XhoI/3'PacI restriction sites (Geneart/Life Technologies) or into the HLA class II targeting plasmidpGEM-sig-DC.LAMP (kindly by provided by Dr. K. Thielemans, Medical School of the Vrije Universiteit Brussel) using 5'BamHI/3'BamHI restriction sites. Both plasmids were linearized with Spel before serving as DNA template for in vitro transcription.
  • dendritic cells and B cells were transfected with Arginase mRNA or control mRNA encoding GFP or nerve growth factor receptor (NGFR) using electroporation parameters as previously described. Briefly, cells were washed twice, suspended in Opti-MEM medium (Invitrogen, cat. 11058021) and adjusted to a final cell density of 4-7x106 cells/ml. The cell suspension (200-300 ul) was pre-incubated on ice for 5min and 5-10 ⁇ g of mRNA was added. Cell suspension was then transferred into a 4-mm gap electroporation cuvette and electroporated. Electroporated cells were further incubated in humidified atmosphere with 5% C02 and used for experimental analysis as specified. Electroporation efficiency was determined 24 hours later by FACS analysis of the GFP or NGFR transfected cells.
  • Flow cytometry analysis was performed on a FACSCantoTM II (BD Biosciences, San Jose CA, USA). Intracellular staining of cell cultures was performed after the cells were stimulated with 20-mere peptides for 5 hours or 30-mere peptides for 8h (BD GolgiPlugTM cat. 555029, was added after the first hour). The cells were then stained for surface markers, then washed and permeabilized by using Fixation/Permeabilization and Permeabilization Buffer (eBioscience, cat. 00-5123-43), according to manufacturer's instructions. Antibodies used: IFNy-APC
  • Arg(161-180), Arg(171-190), Arg(181-200), and Arg(191-210) spanned a 50-amino-acid-long region that was deemed a hot-spot region since nearly all patients harbored a response against one or more of these peptides (Fig. 9A).
  • the selected eight peptides were further used to screen for spontaneous immune responses against arginase- 1 in PBMCs from eight healthy donors using IFNy ELISPOT .
  • the PBMCs from cancer patients showed the highest IFNy responses against the four arginase peptides in the hot-spot region (Fig. 9B).
  • TILs from eight melanoma patients for responses against arginase-1 derived peptides.
  • TILs were thawed and rested overnight without IL-2, and then stimulated for 5 h with three hot-spot immunogenic region 20-mer peptides (peptides labelled by reference to start and end position): Arg(161-180), Arg(171-190), Arg(181-200).
  • IFNy was released from CD4+ T cells in response to stimulation with all three arginase peptides (Fig. 10A), suggesting that the arginase-1 hot-spot region likely contained a number of CD4+ T-cell epitopes.
  • the percentage of IFNy -producing cells was higher for Arg(171-190) and Arg( 181-200) compared to Arg(161-180), and the response against Arg(181-200) was almost twice that against Arg(161-180). No IFNy or TNFa release was observed from CD 8+ T cells.
  • Arginase-1 hot-spot region is recognized by CD4+ and CD8+ T cells
  • PBMCs were stimulated for one week with either Arg(161-190) or Arg(181-210) in the presence of IL-2, and were then used in IFNy ELISPOT.
  • PBMCs from both cancer patients and healthy donors showed high responses against Arg(161-190) (Fig. 10B), comparable to the responses against 20-mer peptides.
  • Some PBMCs also showed responses against the 30-mer Arg( 181-210) peptide (Fig. IOC); however, these responses were lower than those against the overlapping 20-mer peptides covering the same protein region (Fig. 9B).
  • Arg(161 -190) contained CD4+ and CD8+ T cell epitopes (Fig. 1 1B).
  • PBMCs from a melanoma patient with DCs and PBMCs that were loaded with a minimal arginase peptide (ArgShort) located in the hot-spot region The T-cell culture specific against the minimal arginase epitope also recognized the 30-mer Arg(161-190) peptide in IFNy ELISPOT (Fig. l lC, left) and intracellular staining (Fig. 1 1C, right). However, the 50-mer peptide covering the entire hot-spot region was not recognized. After 8 hours of Arg(161-190) peptide stimulation, intracellular staining revealed TNFa release from CD4+ T cells.
  • ArgShort minimal arginase peptide
  • the region spanning positions 161 to 190 of Arginase 1 is particularly immunogenic in both cancer patients and healthy donors, giving rise to both CD4 and CD8 positive T cell responses.
  • the region may contain multiple HLA Class I and Class II restricted. Peptides derived from this region may be particularly effective in a vaccine against Arginasel . Such a vaccine would be expected to have treatment benefits in cancer.
  • hArgl GFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGK (SEQ ID NO: 52)
  • mArgl GFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGK (SEQ ID NO: 57)
  • ARG17 is the sequence of positions 161 -180 of human Arginase 1 (SEQ ID NO: 1). The corresponding region in murine Arginase 1 is identical. (Also referred to interchangeably as ARGl-17 and ARG(161-180) in previous Examples).
  • DVDPGEHYILKTLGIKYFSM (SEQ ID NO: 36)
  • ARG1 -19 is the sequence of positions 181-200 human Arginase 1 (SEQ ID NO: 1)..
  • the corresponding region in murine Arginase 1 differs in a single position (the bold underlined L is replaced with I in the murine sequence).
  • mARGl is the sequence of positions 172-179 of human Arginase 1 (SEQ ID NO: 1). The corresponding region in murine Arginase 1 is identical.
  • mARG2 is the sequence of positions 193-200 of human Arginase 1 (SEQ ID NO: 1). The corresponding region in murine Arginase 1 is identical.
  • mARG20 is the sequence of positions 191-210 of murine Arginase 1 (SEQ ID NO: 59). The corresponding region in human Arginase 1 is SEQ ID NO: 37 and differs in a single position
  • Murine immune cells were subjected to ELISPOT analysis. Single cell suspension was prepared from spleen or dLNs by passage through a cell strainer. After lysis of red blood cells, 0.9x10E6 cells/well were seeded into ELISPOT plates coated with anti-IFNgamma antibody. Peptide of interest was added to designated wells and cells were incubated o/n with peptide. The next day, cells were removed, plates washed and incubated with biotinylated detection antibody. Finally, after addition of Streptavidin-ALP and substrate visible spots appear. Each spot corresponds to an individual IFNgamma producing cell.
  • CT26.WT colon cancer cells in ⁇ ⁇ PBS.
  • animals received the first vaccination of peptide or control vaccine (as described above for peptide vaccination).
  • ARG17, ARG1 -19 and mARG20 were all found to be immunogenic in both C57BL/6 and Balb/c mice. Peptide specific responses were detected in both C57BL/6 and Balb/c mice vaccinated with each of ARG17, ARG1 -19 and mARG20 (see Figures 14-15). Of the shorter peptides, mARGl was immunogenic in C57BL/6 mice and mARG2 was not immunogenic in either strain (data not shown).
  • the lower responses to ARG17 may reflect a lack of stability of that peptide, e.g. due to the presence of a cysteine residue. Replacement of that amino acid by conservative substitution could solve this problem without altering other properties of the sequence of Argl defined by positions 161 -180. However, these results also suggest that the sequence of Argl defined by positions 181 -200 and particularly 191 -210 may be preferred in that they are easy to
  • Region identified as a hotspot for immunogenicity shown bold and underlined
  • isoform2 of human Arginase 1 which has the most widespread distribution of expression.
  • An alternative, longer isoforml is expressed predominantly in the liver.
  • the sequence for this form is provide as NP_001231367.1. It includes an additional 8 amino acid sequence (VTQ FLIL, SEQ ID NO: 62) inserted between positions corresponding to positions 43 and 44 of isoform 2 as shown in SEQ ID NO: 1.
  • Any polypeptide of the invention which spans those positions of isoform2 may optionally include the insertion of the said additional 8 amino acids of isoforml .
  • Region identified as a hotspot for immunogenicity shown bold and underlined
  • Region identified as a hotspot for immunogenicity shown bold and underlined TABLE A
  • * indicates a sequence from murine Arginase 1 which includes at least one difference relative to the corresponding region of human Arginasel. Residues which are non-identical with the corresponding human sequence are bold and underlined. Murine and human Arginase 1 are the same length so start and end positions are the same.
  • # indicates a sequence from human Arginase 2. Start and end positions are the corresponding positions in human Arginase 1.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Medicinal Chemistry (AREA)
  • Zoology (AREA)
  • Genetics & Genomics (AREA)
  • Wood Science & Technology (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Biochemistry (AREA)
  • General Engineering & Computer Science (AREA)
  • Microbiology (AREA)
  • Immunology (AREA)
  • Epidemiology (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • Molecular Biology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Oncology (AREA)
  • Mycology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
PCT/EP2017/075443 2016-10-07 2017-10-06 Immunogenic arginase peptides Ceased WO2018065563A1 (en)

Priority Applications (19)

Application Number Priority Date Filing Date Title
PL17786870.0T PL3522905T3 (pl) 2016-10-07 2017-10-06 Immunogenne peptydy arginazowe
US16/339,606 US10858642B2 (en) 2016-10-07 2017-10-06 Immunogenic arginase peptides
EP17786870.0A EP3522905B1 (en) 2016-10-07 2017-10-06 Immunogenic arginase peptides
HRP20241486TT HRP20241486T1 (hr) 2016-10-07 2017-10-06 Imunogeni peptidi arginaze
SI201731553T SI3522905T1 (sl) 2016-10-07 2017-10-06 Imunogeni peptidi arginaze
CN201780066414.6A CN109890399A (zh) 2016-10-07 2017-10-06 免疫原性精氨酸酶肽
LTEPPCT/EP2017/075443T LT3522905T (lt) 2016-10-07 2017-10-06 Imunogeniniai arginazės peptidai
CA3039510A CA3039510A1 (en) 2016-10-07 2017-10-06 Immunogenic arginase peptides
DK17786870.0T DK3522905T3 (da) 2016-10-07 2017-10-06 Immunogene arginasepeptider
ES17786870T ES2992031T3 (es) 2016-10-07 2017-10-06 Péptidos de arginasa inmunógenos
JP2019518424A JP7211938B2 (ja) 2016-10-07 2017-10-06 免疫原性アルギナーゼペプチド
MX2019003970A MX2019003970A (es) 2016-10-07 2017-10-06 Péptidos de arginasa inmunogénicos.
IL265805A IL265805B2 (en) 2016-10-07 2017-10-06 Immunogenic arginase peptides
FIEP17786870.0T FI3522905T3 (fi) 2016-10-07 2017-10-06 Immunogeenisiä arginaasipeptidejä
AU2017341112A AU2017341112B2 (en) 2016-10-07 2017-10-06 Immunogenic arginase peptides
KR1020197012953A KR102674521B1 (ko) 2016-10-07 2017-10-06 면역원성 아르기나제 펩타이드
EP24166247.7A EP4406613A3 (en) 2016-10-07 2017-10-06 Immunogenic arginase peptides
US17/076,680 US11981944B2 (en) 2016-10-07 2020-10-21 Immunogenic arginase peptides
US18/495,466 US20240167013A1 (en) 2016-10-07 2023-10-26 Immunogenic arginase peptides

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
EP16192794.2 2016-10-07
EP16192794 2016-10-07

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US16/339,606 A-371-Of-International US10858642B2 (en) 2016-10-07 2017-10-06 Immunogenic arginase peptides
US17/076,680 Continuation US11981944B2 (en) 2016-10-07 2020-10-21 Immunogenic arginase peptides

Publications (1)

Publication Number Publication Date
WO2018065563A1 true WO2018065563A1 (en) 2018-04-12

Family

ID=57123856

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2017/075443 Ceased WO2018065563A1 (en) 2016-10-07 2017-10-06 Immunogenic arginase peptides

Country Status (19)

Country Link
US (3) US10858642B2 (https=)
EP (2) EP4406613A3 (https=)
JP (1) JP7211938B2 (https=)
KR (1) KR102674521B1 (https=)
CN (1) CN109890399A (https=)
AU (1) AU2017341112B2 (https=)
CA (1) CA3039510A1 (https=)
DK (1) DK3522905T3 (https=)
ES (1) ES2992031T3 (https=)
FI (1) FI3522905T3 (https=)
HR (1) HRP20241486T1 (https=)
HU (1) HUE069077T2 (https=)
IL (1) IL265805B2 (https=)
LT (1) LT3522905T (https=)
MX (1) MX2019003970A (https=)
PL (1) PL3522905T3 (https=)
PT (1) PT3522905T (https=)
SI (1) SI3522905T1 (https=)
WO (1) WO2018065563A1 (https=)

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2020064744A1 (en) 2018-09-24 2020-04-02 Io Biotech Aps Arginase1 polypeptides
WO2020099582A1 (en) 2018-11-14 2020-05-22 Io Biotech Aps Immunogenic arginase 2 polypeptides
WO2021032891A1 (en) * 2019-08-21 2021-02-25 Cancer Research Technology Limited Binding molecules to arginase ii (arg2)
WO2023161350A1 (en) 2022-02-24 2023-08-31 Io Biotech Aps Nucleotide delivery of cancer therapy
WO2023161346A1 (en) 2022-02-24 2023-08-31 Io Biotech Aps Arginase 2 vaccine
US11981944B2 (en) 2016-10-07 2024-05-14 Io Biotech Aps Immunogenic arginase peptides

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5554372A (en) 1986-09-22 1996-09-10 Emory University Methods and vaccines comprising surface-active copolymers
EP0825260A2 (en) * 1996-08-20 1998-02-25 Smithkline Beecham Corporation Arginase II
WO2006050313A2 (en) * 2004-10-29 2006-05-11 The Board Of Trustees Operating Michigan State University Protection against herbivores
WO2016102272A1 (en) * 2014-12-23 2016-06-30 Immatics Biotechnologies Gmbh Novel peptides and combination of peptides for use in immunotherapy against hepatocellular carcinoma (hcc) and other cancers

Family Cites Families (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US58767A (en) 1866-10-16 John brougjbton
US20110111424A1 (en) 2001-06-21 2011-05-12 Cell Signaling Technology, Inc. Analysis of ubiquitinated polypeptides
WO2003038444A2 (en) 2001-10-31 2003-05-08 Pfizer Products Inc. Biomarkers of liver function
CA2742497C (en) 2008-10-31 2024-01-23 George Georgiou Compositions of engineered human arginases and methods for treating cancer
WO2011008495A2 (en) * 2009-06-29 2011-01-20 The Board Of Regents Of The University Of Texas System Arginase formulations and methods
CN106456723B (zh) 2014-04-29 2021-03-09 康达医药科技有限公司 采用精氨酸酶i调节免疫系统的方法和组合物
AU2017341112B2 (en) * 2016-10-07 2024-06-27 Io Biotech Aps Immunogenic arginase peptides
JP7312106B2 (ja) * 2016-10-27 2023-07-20 アイオー バイオテック エーピーエス 新しいpdl2化合物

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5554372A (en) 1986-09-22 1996-09-10 Emory University Methods and vaccines comprising surface-active copolymers
EP0825260A2 (en) * 1996-08-20 1998-02-25 Smithkline Beecham Corporation Arginase II
WO2006050313A2 (en) * 2004-10-29 2006-05-11 The Board Of Trustees Operating Michigan State University Protection against herbivores
WO2016102272A1 (en) * 2014-12-23 2016-06-30 Immatics Biotechnologies Gmbh Novel peptides and combination of peptides for use in immunotherapy against hepatocellular carcinoma (hcc) and other cancers

Non-Patent Citations (22)

* Cited by examiner, † Cited by third party
Title
"Biocomputing: Informatics and Genome Pro-jects", 1993, ACADEMIC PRESS
"Computational Molecular Biology", 1988, OXFORD UNIVERSITY PRESS
"Computer Analysis of Sequence Data", 1994, HUMANA PRESS
"Genetics Computer Group", UNIVERSITY OF WISCONSIN
"Remington's Pharmaceutical Sciences", 1991, MACK PUB. CO.
"Sequence Analysis Primer", 1991, STOCKTON PRESS
AHMAD SM; MARTINENAITE E; HANSEN M; JUNKER N; BORCH TH; MET O ET AL.: "PD-L1 peptide co-stimulation increases immunogenicity of a dendritic cell-based cancer vaccine", 2016
ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410
ALTSCHUL ET AL.: "BLAST Manual", NCB/NLM/NIH, pages: 20894
ANDERSEN MH; BONFILL JE; NEISIG A; ARSEQUELL G; SONDERGAARD I; VALENCIA G ET AL.: "Phosphorylated Peptides Can Be Transported by TAP Molecules, Presented by Class I MHC Molecules, and Recognized by Phosphopeptide-Specific CTL", J IMMUNOL, vol. 163, 1999, pages 3812 - 3818
BRONTE V; ZANOVELLO P: "Regulation of immune responses by L-arginine metabolism", NAT REV IMMUNOL, vol. 5, 2005, pages 641 - 654, XP002471069, DOI: doi:10.1038/nri1668
CARILLO ET AL., SIAM J. APPLIED MATH., vol. 48, 1988, pages 1073
DAYHOFF ET AL., ATLAS OF PROTEIN SEQUENCE AND STRUCTURE, vol. 5, no. 3, 1978
DEVEREUX ET AL., NUCL. ACID. RES., vol. 12, 1984, pages 387
GODING: "Monoclonal Antibodies: Principles & Practice", 1986, pages: 61 - 63
HEINJE, G.: "Sequence Analysis in Molecular Biology", 1987, ACADEMIC PRESS
HENIKOFF ET AL., PROC. NATL. ACAD. SCI USA, vol. 89, 1992, pages 10915 - 10919
HENIKOFF ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 10915 - 10919
JEFFERY ET AL., PHARM. RES., vol. 10, 1993, pages 362 - 368
MARKUS MUNDER: "Arginase: an emerging key player in the mammalian immune system : Arginase in the immune system", BRITISH JOURNAL OF PHARMACOLOGY, vol. 158, no. 3, 17 September 2009 (2009-09-17), UK, pages 638 - 651, XP055428071, ISSN: 0007-1188, DOI: 10.1111/j.1476-5381.2009.00291.x *
MUSSAI F; DE SC; ABU-DAYYEH I; BOOTH S; QUEK L; MCEWEN-SMITH RM ET AL.: "Acute myeloid leukemia creates an arginase-dependent immunosuppressive microenvironment", BLOOD, vol. 122, 2013, pages 749 - 758
NEEDLEMAN ET AL., J. MOL. BIOL, vol. 48, 1970, pages 443 - 453

Cited By (18)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11981944B2 (en) 2016-10-07 2024-05-14 Io Biotech Aps Immunogenic arginase peptides
AU2019350356B9 (en) * 2018-09-24 2026-01-29 Io Biotech Aps Arginase1 polypeptides
AU2019350356B2 (en) * 2018-09-24 2025-11-27 Io Biotech Aps Arginase1 polypeptides
CN112771159A (zh) * 2018-09-24 2021-05-07 Io生物技术公司 精氨酸酶1多肽
WO2020064744A1 (en) 2018-09-24 2020-04-02 Io Biotech Aps Arginase1 polypeptides
JP2022501046A (ja) * 2018-09-24 2022-01-06 アイオー バイオテック エーピーエスIO Biotech ApS アルギナーゼ1ポリペプチド
JP7624388B2 (ja) 2018-09-24 2025-01-30 アイオー バイオテック エーピーエス アルギナーゼ1ポリペプチド
US20220031818A1 (en) * 2018-09-24 2022-02-03 Io Biotech Aps Arginase1 polypeptides
US12194081B2 (en) 2018-09-24 2025-01-14 Io Biotech Aps ARGINASE1 polypeptides
CN113164545A (zh) * 2018-11-14 2021-07-23 Io生物技术公司 免疫原性精氨酸酶2多肽
JP7611137B2 (ja) 2018-11-14 2025-01-09 アイオー バイオテック エーピーエス 免疫原性アルギナーゼ2ポリペプチド
JP2022507373A (ja) * 2018-11-14 2022-01-18 アイオー バイオテック エーピーエス 免疫原性アルギナーゼ2ポリペプチド
US12234288B2 (en) 2018-11-14 2025-02-25 Io Biotech Aps Immunogenic arginase 2 polypeptides
WO2020099582A1 (en) 2018-11-14 2020-05-22 Io Biotech Aps Immunogenic arginase 2 polypeptides
IL283133B1 (en) * 2018-11-14 2026-03-01 Io Biotech Aps Immunogenic Arginase 2 proteins
WO2021032891A1 (en) * 2019-08-21 2021-02-25 Cancer Research Technology Limited Binding molecules to arginase ii (arg2)
WO2023161346A1 (en) 2022-02-24 2023-08-31 Io Biotech Aps Arginase 2 vaccine
WO2023161350A1 (en) 2022-02-24 2023-08-31 Io Biotech Aps Nucleotide delivery of cancer therapy

Also Published As

Publication number Publication date
MX2019003970A (es) 2019-12-05
KR20190077381A (ko) 2019-07-03
IL265805B1 (en) 2024-04-01
PT3522905T (pt) 2024-10-02
AU2017341112A1 (en) 2019-05-02
IL265805A (en) 2019-06-30
DK3522905T3 (da) 2024-10-21
JP2019537562A (ja) 2019-12-26
IL265805B2 (en) 2024-08-01
KR102674521B1 (ko) 2024-06-11
CN109890399A (zh) 2019-06-14
EP3522905A1 (en) 2019-08-14
US10858642B2 (en) 2020-12-08
EP4406613A2 (en) 2024-07-31
SI3522905T1 (sl) 2025-02-28
HUE069077T2 (hu) 2025-02-28
CA3039510A1 (en) 2018-04-12
LT3522905T (lt) 2024-11-11
FI3522905T3 (fi) 2024-10-31
EP3522905B1 (en) 2024-09-25
ES2992031T3 (es) 2024-12-05
EP4406613A3 (en) 2024-10-23
HRP20241486T1 (hr) 2025-01-03
US11981944B2 (en) 2024-05-14
US20190338270A1 (en) 2019-11-07
US20240167013A1 (en) 2024-05-23
PL3522905T3 (pl) 2025-01-07
JP7211938B2 (ja) 2023-01-24
AU2017341112B2 (en) 2024-06-27
US20210139877A1 (en) 2021-05-13

Similar Documents

Publication Publication Date Title
US20240167013A1 (en) Immunogenic arginase peptides
RU2721574C2 (ru) Вакцинная композиция против злокачественной опухоли
EP3112378B1 (en) Wt1 antigenic polypeptide, and anti-tumor agent containing said polypeptide
US8168191B2 (en) Cytotoxic T lymphocyte
US20250236658A1 (en) Pdl2 compounds
JP6602377B2 (ja) 樹状細胞の製造方法、これにより製造された樹状細胞及びその用途
CN113906046A (zh) 具有包含经修饰半胱氨酸的氧化还原酶基序的免疫原性肽
HK40012895B (en) Immunogenic arginase peptides
HK40012895A (en) Immunogenic arginase peptides
WO2019038235A1 (en) NOVEL CCL2 PEPTIDES FOR USE IN ANTICANCER THERAPY

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17786870

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3039510

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2019518424

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2017341112

Country of ref document: AU

Date of ref document: 20171006

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20197012953

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2017786870

Country of ref document: EP

Effective date: 20190507