WO2017185037A1 - Alk7 binding proteins and uses thereof - Google Patents

Alk7 binding proteins and uses thereof Download PDF

Info

Publication number
WO2017185037A1
WO2017185037A1 PCT/US2017/028952 US2017028952W WO2017185037A1 WO 2017185037 A1 WO2017185037 A1 WO 2017185037A1 US 2017028952 W US2017028952 W US 2017028952W WO 2017185037 A1 WO2017185037 A1 WO 2017185037A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
alk7
amino acid
acid sequence
sequence
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2017/028952
Other languages
English (en)
French (fr)
Inventor
John Knopf
Jonathan Belk
Nathan J. SHARKEY
Ravindra Kumar
Asya Grinberg
Dianne Sako
Roselyne CASTONGUAY
Yossi Dagon
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Acceleron Pharma Inc
Adimab LLC
Original Assignee
Acceleron Pharma Inc
Adimab LLC
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Acceleron Pharma Inc, Adimab LLC filed Critical Acceleron Pharma Inc
Priority to CN202310225072.5A priority Critical patent/CN116217731B/zh
Priority to EP17786759.5A priority patent/EP3445394A4/en
Priority to CA3018272A priority patent/CA3018272A1/en
Priority to AU2017252574A priority patent/AU2017252574B2/en
Priority to CN201780029770.0A priority patent/CN109219446B/zh
Priority to CN202511960418.1A priority patent/CN121851175A/zh
Priority to JP2018555460A priority patent/JP7103950B2/ja
Priority to KR1020187032416A priority patent/KR102405278B1/ko
Priority to KR1020227018313A priority patent/KR20220080015A/ko
Publication of WO2017185037A1 publication Critical patent/WO2017185037A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/40Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against enzymes
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2863Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/16Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/18Drugs for disorders of the alimentary tract or the digestive system for pancreatic disorders, e.g. pancreatic enzymes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • A61P13/12Drugs for disorders of the urinary system of the kidneys
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P15/00Drugs for genital or sexual disorders; Contraceptives
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/06Antigout agents, e.g. antihyperuricemic or uricosuric agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P27/00Drugs for disorders of the senses
    • A61P27/02Ophthalmic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/04Anorexiants; Antiobesity agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/06Antihyperlipidemics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/04Inotropic agents, i.e. stimulants of cardiac contraction; Drugs for heart failure
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/10Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/12Antihypertensives
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • Overweight and obesity have reached epidemic proportion in the United States and a number of countries throughout the world, increasing among all age, race and ethnic groups and in both men and women. Overweight and obesity are also associated with other diseases or conditions that disrupt life activities and lifestyles. Obesity is recognized as a serious risk factor for other diseases and conditions such as type 2 diabetes, inflammation, and cardiovascular, pulmonary, fatty liver disease, neurologic, and hepatic, and renal disease.
  • Type 2 diabetes is a chronic, progressive disease that has likewise reached epidemic proportion. There is no established cure for type II diabetes, but there are numerous recognized treatments that attempt to delay or mitigate the inevitable consequences of the disease. Type 2 diabetes is initially treated by adjustments in diet and exercise, and by weight loss, most especially in obese subjects. The amount of weight loss which improves the clinical picture is sometimes modest (e.g., 4.4 to 1 1 lbs.); this is likely due to poorly understood aspects of fat tissue activity, for instance chemical signaling (especially in visceral fat tissue in and around abdominal organs).
  • the disclosure provides ALK7-binding proteins and methods of using the ALK7- binding proteins.
  • the ALK7-binding proteins are capable of inhibiting or blocking the binding of ALK7 to one or more cognate ALK7 ligands and/or one or more cognate ActRI receptors.
  • the ALK7-binding proteins are capable of inhibiting or blocking the multimerization of ALK7, and ActRII receptor (ActRIIA or ActRIIB) and GDF 1, GDF3, GDF8, activin B, activin A/B, or Nodal.
  • the disclosure also provides methods of using ALK7-binding proteins for the diagnosis, or treatment, prevention and/or amelioration of a disease or condition associated with ALK7 expression and/or elevated ALK7-mediated signaling.
  • diseases or conditions include but are not limited to, overweight, obesity (e.g., abdominal obesity); insulin resistance; metabolic syndrome and other metabolic diseases or conditions; a lipid disorder such as, low HDL levels, high LDL levels, hyperlipidemia, hypertriglyceridemia or dyslipidemia; lipoprotein aberrations; decreased triglycerides; inflammation (e.g., liver inflammation and/or inflammation of adipose tissue), fatty liver disease; non-alcoholic fatty liver disease; hyperglycemia; impaired glucose tolerance (IGT); hyperinsulinemia; high cholesterol (e.g., high LDL levels and hypercholesterolemia); cardiovascular disease such as, heart disease including coronary heart disease, congestive heart failure, stroke, peripheral vascular disease, disordered fibrinolysis, atherosclerosis; arteriosclerosis, and hyper
  • the disclosure also provides without limitation, methods for reducing body weight (e.g., promoting weight loss), and methods for reducing weight gain (e.g., preventing weight gain), using antagonist ALK7-binding proteins, such as antibodies.
  • the ALK7-binding protein specifically binds ALK7.
  • the provided ALK7-binding protein specifically binds ALK7 and has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with ActRIIA or ActRIIB) for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDFl, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%), 10%) to 80%), or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics.
  • the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein cross-blocks or competes for binding to ALK7 with an antibody having an ALK7-binding VH and VL pair disclosed herein.
  • the ALK7-binding protein is an anti-ALK7 antibody or an ALK7-binding antibody fragment.
  • the ALK7-binding protein comprises a set of complementary determining regions (CDRs): heavy chain variable region (VH)-CDRl, VH-CDR2, VH-CDR3, light chain variable region (VL)-CDRl, VL-CDR2 and VL- CDR3, wherein the CDRs are present in a heavy chain variable region (VH) and a light chain variable region (VL) pair disclosed in Table 1 A.
  • CDRs complementary determining regions
  • the ALK7- binding protein comprises a set of CDRs present in a VH and a VL pair selected from the group consisting of: (a) a VH sequence of SEQ ID NO: 4, and a VL sequence of SEQ ID NO: 13; (b) a VH sequence of SEQ ID NO:22, and a VL sequence of SEQ ID NO:31; (c) a VH sequence of SEQ ID NO:40, and a VL sequence of SEQ ID NO:49; and (d) a VH sequence of SEQ ID NO:58 and a VL sequence of SEQ ID NO:67.
  • the ALK7-binding protein comprises a set of complementary determining regions (CDRs): heavy chain variable region (VH)-CDRl, VH-CDR2, VH-CDR3, light chain variable region (VL)-CDRl, VL-CDR2 and VL- CDR3, wherein the CDRs are present in a heavy chain variable region (VH) and a light chain variable region (VL) pair disclosed in Table IB or Table 3.
  • CDRs complementary determining regions
  • the ALK7-binding protein comprises a set of CDRs present in a VH and a VL pair selected from the group consisting of: (a) a VH sequence of SEQ ID NO: 152, and a VL sequence of SEQ ID NO:98; (b) a VH sequence of SEQ ID NO: 159, and a VL sequence of SEQ ID NO: 110; and (c) a VH sequence of SEQ ID NO: 165, and a VL sequence of SEQ ID NO: 171.
  • the ALK7-binding protein comprises a set of CDRs present in a VH and a VL pair selected from the group consisting of: (a) a VH sequence of SEQ ID NO:91, and a VL sequence of SEQ ID NO:98; (b) a VH sequence of SEQ ID NO: 105, and a VL sequence of SEQ ID NO: 110; (c) a VH sequence of SEQ ID NO: 117, and a VL sequence of SEQ ID NO: 124; (d) a VH sequence of SEQ ID NO: 128 and a VL sequence of SEQ ID NO: 135; and (e) a VH sequence of SEQ ID NO: 140 and a VL sequence of SEQ ID NO: 148.
  • the ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VH-CDR1, VH-CDR2, VH-CDR3, VL-CDR1, VL-CDR2, and VL-CDR3, wherein the set of CDRs is identical to, or has a total of one, two, three, four, five, six, seven, eight, nine, ten, or fewer than ten, amino acid substitutions, deletions, and/or insertions from a reference set of CDRs in which: (a)(i) VH-CDRl comprises the amino acid sequence of SEQ ID NO: l; (ii) VH-CDR2 comprises the amino acid sequence of SEQ ID NO:2; (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO:3; (iv) VL-CDRl comprises the amino acid sequence of SEQ ID NO: 10; (v) VL-CDR2 comprises the amino acid sequence of SEQ ID NO:
  • the ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VH-CDRl, VH-CDR2, VH-CDR3, VL-CDRl, VL-CDR2, and VL-CDR3, wherein the set of CDRs is identical to, or has a total of one, two, three, four, five, six, seven, eight, nine, ten, or fewer than ten, amino acid substitutions, deletions, and/or insertions from a reference set of CDRs in which: (a)(i) VH-CDRl comprises the amino acid sequence of SEQ ID NO:88; (ii) VH-CDR2 comprises the amino acid sequence of SEQ ID NO:89; (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO:90; (iv) VL-CDRl comprises the amino acid sequence of SEQ ID NO:95; (v) VL-CDR2 comprises the amino acid sequence of SEQ ID NO:
  • the ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs in which: (a)(i) VH-CDR1 comprises the amino acid sequence of SEQ ID NO: l; (ii) VH-CDR2 comprises the amino acid sequence of SEQ ID NO:2; (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO:3; (iv) VL-CDRl comprises the amino acid sequence of SEQ ID NO: 10; (v) VL-CDR2 comprises the amino acid sequence of SEQ ID NO: 11; and (vi) VL-CDR3 comprises the amino acid sequence of SEQ ID NO: 12; (b)(i) VH-CDR1 comprises the amino acid sequence of SEQ ID NO: 19; (ii) VH-CDR2 comprises the amino acid sequence of SEQ ID NO:20; (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO:21; (iv) VL-CDRl
  • the ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs in which: (a)(i) VH-CDRl comprises the amino acid sequence of SEQ ID NO:88; (ii) VH-CDR2 comprises the amino acid sequence of SEQ ID NO:89; (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO:90; (iv) VL-CDR1 comprises the amino acid sequence of SEQ ID NO:95; (v) VL-CDR2 comprises the amino acid sequence of SEQ ID NO:96; and (vi) VL-CDR3 comprises the amino acid sequence of SEQ ID NO:97; (b)(i) VH-CDRl comprises the amino acid sequence of SEQ ID NO: 102; (ii) VH-CDR2 comprises the amino acid sequence of SEQ ID NO: 103; (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO: 104; (iv) VL-CDRs in which
  • the ALK7-binding protein specifically binds ALK7 and comprises a VH and a VL pair selected from the group consisting of: (a)(i) a VH having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:4, and (ii) a VL having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 13; (b)(i) a VH having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:22, or 132, and (ii) a VL having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:31; (c)(i) a VH having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 40,
  • the ALK7-binding protein specifically binds ALK7 and comprises a VH and a VL pair selected from the group consisting of: (a)(i) a VH having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:91, and (ii) a VL having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:98; (b)(i) a VH having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 105, or 132, and (ii) a VL having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 110; (c)(i) a VH having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:
  • the ALK7-binding protein comprises a VH and a VL containing a VH sequence of SEQ ID NO:40 or 58, and a VL sequence of SEQ ID NO:49 or 67; and the protein binds ALK7.
  • the ALK7-binding protein comprises a VH sequence of SEQ ID NO: 40 and a VL sequence of SEQ ID NO: 49, and the protein binds ALK7.
  • the ALK7-binding protein comprises a VH sequence of SEQ ID NO: 58 and a VL sequence of SEQ ID NO: 67, and the protein binds ALK7.
  • the ALK7-binding protein comprises a VH and a VL pair comprising a VH sequence of SEQ ID NO: 4 and a VL sequence of SEQ ID NO: 13, and the protein binds ALK7.
  • the ALK7-binding protein comprises a VH and a VL pair comprising a VH sequence of SEQ ID NO: 22 and a VL sequence of SEQ ID NO:31, and the protein binds ALK7.
  • the ALK7-binding protein comprises a VH and a VL pair comprising a VH sequence of SEQ ID NO: 40 and a VL sequence of SEQ ID NO: 49, and the protein binds ALK7.
  • the ALK7-binding protein comprises a VH and a VL pair comprising a VH sequence of SEQ ID NO: 58 and a VL sequence of SEQ ID NO: 67, and the protein binds ALK7.
  • the ALK7-binding protein comprises a VH and a VL pair comprising a VH sequence of SEQ ID NO:91 and a VL sequence of SEQ ID NO:98, and the protein binds ALK7.
  • the ALK7-binding protein comprises a VH and a VL pair comprising a VH sequence of SEQ ID NO: 105 and a VL sequence of SEQ ID NO: 110, and the protein binds ALK7.
  • the ALK7-binding protein comprises a VH and a VL pair comprising a VH sequence of SEQ ID NO: 117 and a VL sequence of SEQ ID NO: 124, and the protein binds ALK7.
  • the ALK7-binding protein comprises a VH and a VL pair comprising a VH sequence of SEQ ID NO: 128 and a VL sequence of SEQ ID NO: 135, and the protein binds ALK7.
  • the ALK7-binding protein comprises a VH and a VL pair comprising a VH sequence of SEQ ID NO: 140 and a VL sequence of SEQ ID NO: 148, and the protein binds ALK7.
  • the ALK7-binding protein comprises a VH and a VL pair selected from the group consisting of: (a)(i) a VH sequence having a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions from a reference VH sequence selected from the group consisting of SEQ ID NO:4, and (ii) a VL sequence having a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions from a reference VL sequence of SEQ ID NO: 13; (b)(i) a VH sequence having a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions from a reference VH sequence of SEQ ID NO: 13; (
  • the ALK7-binding protein comprises a VH and a VL pair selected from the group consisting of: (a)(i) a VH sequence having a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions from a reference VH sequence selected from the group consisting of SEQ ID NO:91, and (ii) a VL sequence having a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions from a reference VL sequence of SEQ ID NO:98; (b)(i) a VH sequence having a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions from a reference VH sequence
  • the ALK7-binding protein is an antibody that specifically binds ALK7.
  • the antibody is a monoclonal antibody, a recombinant antibody, a human antibody, a humanized antibody, a chimeric antibody, a bi-specific antibody, or a multi-specific antibody.
  • the ALK7- binding protein is an ALK7-binding antibody fragment.
  • the antibody is an antibody fragment selected from the group consisting of a Fab, Fab', F(ab') 2 , Fv, diabody, DART, and a single chain antibody molecule (e.g., a BiTE).
  • the ALK7-binding protein specifically binds to ALK7 between amino acids 20-1 13 of SEQ ID NO:85. In some embodiments, the ALK7- binding protein specifically binds to ALK7 between amino acids 20-1 13 of SEQ ID NO:85 and inhibits one or more ALK ligands (e.g., GDF 1, GDF3, GDF8, activin B, activin A/B, and/or Nodal) from binding to ALK7.
  • ALK ligands e.g., GDF 1, GDF3, GDF8, activin B, activin A/B, and/or Nodal
  • the ALK7- binding protein specifically binds to ALK7 between amino acids 20-1 13 of SEQ ID NO: 85 and contacts one or more amino acids selected from the group consisting of: (a) a Glu at position 21 of SEQ ID NO:85; (b) a Leu at position 22 of SEQ ID NO:85; (c) a Ser at position 23 of SEQ ID NO:85; (d) a Pro at position 24 of SEQ ID NO:85; (e) a Gly at position 25 of SEQ ID NO:85; (f) a Leu at position 26 of SEQ ID NO:85; (g) a Lys at position 27 of SEQ ID NO:85; (h) a Cys at position 28 of SEQ ID NO:85; (i) a Val at position 29 of SEQ ID NO:85; (j) a Cys at position 30 of SEQ ID NO:85; (k) a Leu at position 31 of SEQ ID NO:85; (1) a Leu at position 32 of SEQ ID NO:85;
  • the ALK7- binding protein specifically binds to ALK7 between amino acids 20-113 of SEQ ID NO: 85 and contacts one or more amino acids selected from the group consisting of: (a) a Glu at position 21 of SEQ ID NO:85; (b) a Leu at position 22 of SEQ ID NO:85; (c) a Ser at position 23 of SEQ ID NO:85; (d) a Pro at position 24 of SEQ ID NO:85; (e) a Gly at position 25 of SEQ ID NO:85; (f) a Leu at position 26 of SEQ ID NO:85; (g) a Lys at position 27 of SEQ ID NO:85; (h) a Cys at position 28 of SEQ ID NO:85; (i) a Val at position 29 of SEQ ID NO:85; (j) a Cys at position 30 of SEQ ID NO:85; (k) a Leu at position 31 of SEQ ID NO:85; (1) a Leu at position 32 of SEQ ID NO:85;
  • the ALK7-binding protein specifically binds to ALK7 between amino acids 20-1 13 of SEQ ID NO:85 and increases lipolysis (e.g., lipolysis of white adipocytes and/or brown adipocytes). In some embodiments, the ALK7-binding protein specifically binds to ALK7 between amino acids 20-1 13 of SEQ ID NO: 85 and contacts one or more amino acids selected from the group consisting of: (a) a Glu at position 21 of
  • SEQ ID NO: 85 (ah) a Asn at position 54 of SEQ ID NO:85; (ai) a Gly at position 55 of SEQ ID NO:85; (aj) a Lys at position 56 of SEQ ID NO:85; (ak) a Glu at position 57 of SEQ ID NO:85; (al) a Gin at position 58 of SEQ ID NO:85; (am) a Val at position 59 of SEQ ID NO:85; (an) a He at position 60 of SEQ ID NO:85; (ao) a Lys at position 61 of SEQ ID NO:85; (ap) a Ser at position 62 of SEQ ID NO:85; (aq) a Cys at position 63 of SEQ ID NO:85; (ar) a Val at position 64 of SEQ ID NO:85; (as) a Ser at position 65 of SEQ ID NO:85; (at) a Leu at position 66 of SEQ ID NO:85; (au) a Pro
  • the ALK7-binding protein specifically binds to ALK7 between amino acids 28-92 of SEQ ID NO:85. In some embodiments, the ALK7-binding protein specifically binds to ALK7 between amino acids 28-92 of SEQ ID NO:85 and inhibits one or more ALK7 ligands (e.g., GDF1, GDF3, GDF8, activin B, activin A/B, and/or Nodal) from binding to ALK7.
  • ALK7 ligands e.g., GDF1, GDF3, GDF8, activin B, activin A/B, and/or Nodal
  • the ALK7-binding protein specifically binds to ALK7 between amino acids 28-92 of SEQ ID NO:85 and contacts one or more amino acids selected from the group consisting of: (a) a Cys at position 28 of SEQ ID NO:85; (b) a Val at position 29 of SEQ ID NO:85; (c) a Cys at position 30 of SEQ ID NO:85; (d) a Leu at position 31 of SEQ ID NO:85; (e) a Leu at position 32 of SEQ ID NO:85; (f) a Cys at position 33 of SEQ ID NO:85; (g) a Asp at position 34 of SEQ ID NO:85; (h) a Ser at position 35 of SEQ ID NO:85; (i) a Ser at position 36 of SEQ ID NO:85; (j) a Asn at position 37 of SEQ ID NO:85; (k) a Phe at position 38 of SEQ ID NO:85; (1) a Thr at position 39 of SEQ
  • the ALK7-binding protein specifically binds to ALK7 between amino acids 28-92 of SEQ ID NO: 85 and contacts one or more amino acids selected from the group consisting of: (a) a Cys at position 28 of SEQ ID NO:85; (b) a Val at position 29 of SEQ ID NO:85; (c) a Cys at position 30 of SEQ ID NO:85; (d) a Leu at position 31 of SEQ ID NO:85; (e) a Leu at position 32 of SEQ ID NO:85; (f) a Cys at position 33 of SEQ ID NO:85; (g) a Asp at position 34 of SEQ ID NO:85; (h) a Ser at position 35 of SEQ ID NO:85; (i) a Ser at position 36 of SEQ ID NO:85; (j) a Asn at position 37 of SEQ ID NO:85; (k) a Phe at position 38 of SEQ ID NO:85; (1) a Thr at position 39 of SEQ
  • the ALK7-binding protein specifically binds to ALK7 between amino acids 28-92 of SEQ ID NO:85 and increases lipolysis (e.g., lipolysis of white adipocytes and/or brown adipocytes).
  • the ALK7-binding protein specifically binds to ALK7 between amino acids 28-92 of SEQ ID NO:85 and contacts one or more amino acids selected from the group consisting of: (a) a Cys at position 28 of SEQ ID NO:85; (b) a Val at position 29 of SEQ ID NO:85; (c) a Cys at position 30 of SEQ ID NO:85; (d) a Leu at position 31 of SEQ ID NO:85; (e) a Leu at position 32 of SEQ ID NO:85; (f) a Cys at position 33 of SEQ ID NO:85; (g) a Asp at position 34 of SEQ ID NO:85; (h) a Ser at position 35 of SEQ ID NO:85; (i) a Ser at position 36 of SEQ ID NO:85; (j) a Asn at position 37 of SEQ ID NO:85; (k) a Phe at position 38 of SEQ ID NO:85; (1) a Thr at position 39 of SEQ
  • Nucleic acids and sets of nucleic acids encoding ALK7-binding proteins are also provided.
  • Vectors and sets of vectors containing the nucleic acids and sets of nucleic acids, and host cells transformed with the nucleic acids and vectors are further provided.
  • the host cell is a hybridoma or mammalian host cell such as, a NS0 murine myeloma cell, a PER.C6® human cell, or a Chinese hamster ovary (CHO) cell.
  • Host cells including mammalian host cells and hybridomas that produce ALK7- binding proteins are also provided
  • Methods for making an ALK7-binding protein are also provided.
  • the method comprises culturing a host cell capable of expressing the ALK7-binding protein under suitable conditions for expressing the protein and optionally isolating the expressed ALK7-binding protein.
  • ALK7-binding proteins prepared and/or isolated using methods disclosed herein or otherwise known in the art are also provided.
  • compositions comprising an ALK7-binding protein and a pharmaceutically acceptable carrier are further provided.
  • the disclosure provides methods for treating and/or ameliorating a condition in a subject associated with elevated ALK7 expression or ALK7-mediated signaling, or that can be treated and/or ameliorated by decreased ALK7 signaling. In some embodiments, the methods decrease ALK7-mediated signaling in the subject.
  • Conditions that may be treated and/or ameliorated in a subject using the provided methods include, but are not limited to: obesity (e.g., abdominal obesity); overweight; insulin resistance; metabolic syndrome and other metabolic diseases or conditions; a lipid disorder such as, low HDL levels, high LDL levels, hyperlipidemia, hypertriglyceridemia or dyslipidemia; lipoprotein aberrations; decreased triglycerides; inflammation (e.g., liver inflammation and/or inflammation of adipose tissue), fatty liver disease; non-alcoholic fatty liver disease; hyperglycemia; impaired glucose tolerance (IGT); hyperinsulinemia; high cholesterol (e.g., high LDL levels and hypercholesterolemia); cardiovascular disease such as, heart disease including coronary heart disease, congestive heart failure, stroke, peripheral vascular disease, disordered fibrinolysis, atherosclerosis; arteriosclerosis, and hypertension; Syndrome X; vascular restenosis; neuropathy; retinopathy; neurodegenerative disease; endothelial dysfunction, respiratory dysfunction
  • the disclosed methods include administering a pharmaceutical composition comprising an effective amount of an ALK7-binding protein (e.g., an antagonist ALK7 binding protein such as an antagonist anti-ALK7 antibody) to a subject in need thereof.
  • an ALK7-binding protein e.g., an antagonist ALK7 binding protein such as an antagonist anti-ALK7 antibody
  • the ALK7-binding protein is administered alone.
  • the ALK7-binding protein is administered as a combination therapy.
  • the ALK7-binding protein is administered as a combination therapy to the standard of care treatment/therapy.
  • Methods of blocking or reducing ALK7 activity are also provided.
  • the method comprises contacting an ALK7-binding protein and a cell that expresses ALK7, (e.g., a differentiated white or brown adipocyte).
  • the method comprises contacting an ALK7-binding protein and a cell that expresses ALK7, in the presence of GDF l, GDF3, GDF8, activin B, activin A/B, and/or Nodal.
  • the method is performed in vivo. In other embodiments, the method is performed in vitro.
  • the blocked or reduced ALK7 activity is the phosphorylation of ALK7.
  • the blocked or reduced ALK7 activity is the phosphorylation of Smads (e.g., Smad2 and/or Smad3).
  • the disclosure provides a method of blocking or reducing ALK7 activity in a subject that comprises administering an effective amount of an ALK7- binding protein to a subject in need thereof.
  • the method comprises administering an ALK7-binding protein to a subject having increased expression of ALK7 or an ALK7- ligand.
  • the pathological condition is obesity, diabetes, metabolic disease, dyslipidemia; cardiovascular disease, type 2 diabetes, inflammation, or a pulmonary, fatty liver disease, neurologic, and hepatic, or renal disease.
  • the disclosure provides a method of treating or ameliorating overweight or a condition associated with being overweight, comprising administering to an overweight subject an effective amount of an ALK7-binding protein (e.g., an antagonist ALK7 binding protein such as an antagonist anti-ALK7 antibody).
  • an ALK7-binding protein e.g., an antagonist ALK7 binding protein such as an antagonist anti-ALK7 antibody.
  • the he treated or ameliorated condition is obesity.
  • the treated or ameliorated condition is a member selected from the group consisting of dyslipidemia, hyperlipidemia, hypercholesterolemia, low HDL serum level, high LDL serum level (e.g., LDL-C > 100 mg/dL, > 130 mg/dL, > 160 mg/dL), and hypertriglyceridemia (e.g., TG > 150 mg/dL, > 160 mg/dL, > 170 mg/dL).
  • the treated or ameliorated condition is hypertension.
  • the treated or ameliorated condition is diabetes.
  • the administered ALK7-binding protein is an ALK7 antagonist.
  • the administered antagonist ALK7-binding protein is an anti-ALK7 antibody or an ALK7- binding antibody fragment. In another embodiment the administered antagonist ALK7- binding protein is an anti-ALK7 antibody or an ALK7-binding antibody fragment disclosed herein. In one embodiment, the administered ALK7-binding protein comprises a VH and VL pair disclosed in Table 1A. In another embodiment, the administered ALK7-binding protein cross-blocks or competes for binding to ALK7 with an antibody comprising a VH and a VL sequence pair disclosed in Table 1 A. In one embodiment, the administered ALK7-binding protein comprises a VH and VL pair disclosed in Table IB or Table 3.
  • the administered ALK7-binding protein cross-blocks or competes for binding to ALK7 with an antibody comprising a VH and a VL sequence pair disclosed in Table IB or Table 3.
  • the administered ALK7- binding protein comprises a VH and VL pair disclosed in Table 1A, Table IB, or Table 3.
  • the administered ALK7-binding protein cross-blocks or competes for binding to ALK7 with an antibody comprising a VH and a VL sequence pair disclosed in Table 1A, Table IB, or Table 3.
  • the disclosure provides a method of treating or ameliorating obesity or a condition associated with obesity, comprising administering to an obese subject an effective amount of an ALK7-binding protein (e.g., an antagonist ALK7 binding protein such as an antagonist anti-ALK7 antibody).
  • an ALK7-binding protein e.g., an antagonist ALK7 binding protein such as an antagonist anti-ALK7 antibody.
  • the treated or ameliorated condition is hypertension, dyslipidemia (for example, high total cholesterol or high levels of triglycerides), type 2 diabetes, coronary heart disease, stroke, gallbladder disease, osteoarthritis, sleep disorders, respiratory problems, cancer (e.g., myeloma (multiple myeloma, plasmacytoma, localized myeloma, or extramedullary myeloma), or an ovarian, breast, colon, endometrial, liver, kidney, pancreatic, gastric, uterine and/or colon cancer), obesity linked gallbladder disease, obesity linked inflammation, obesity induced sleep apnea, steatosis (fatty liver), glucagonomas, arteriosclerosis or heart failure.
  • dyslipidemia for example, high total cholesterol or high levels of triglycerides
  • type 2 diabetes for example, high total cholesterol or high levels of triglycerides
  • coronary heart disease for example, type 2 diabetes, coronary heart disease, stroke,
  • the subject to which the ALK7 binding protein is administered is at risk of developing hypertension, dyslipidemia (for example, high total cholesterol or high levels of triglycerides), type 2 diabetes, coronary heart disease, stroke, gallbladder disease, osteoarthritis, sleep disorders, respiratory problems, cancer (e.g., a myeloma (multiple myeloma, plasmacytoma, localized myeloma, or extramedullary myeloma), or an ovarian, breast, colon, endometrial, liver, kidney, pancreatic, gastric, uterine or colon cancer), obesity linked gallbladder disease, obesity linked inflammation, obesity induced sleep apnea, steatosis, glucagonomas, arteriosclerosis or heart failure.
  • dyslipidemia for example, high total cholesterol or high levels of triglycerides
  • type 2 diabetes for example, type 2 diabetes, coronary heart disease, stroke, gallbladder disease, osteoarthritis, sleep disorders, respiratory
  • the administered ALK7-binding protein is an ALK7 antagonist. In one embodiment, the administered antagonist ALK7- binding protein is an anti-ALK7 antibody or an ALK7-binding antibody fragment. In another embodiment the administered antagonist ALK7-binding protein is an anti-ALK7 antibody or an ALK7-binding antibody fragment disclosed herein. In one embodiment, the administered ALK7-binding protein comprises a VH and VL pair disclosed in Table 1A. In another embodiment, the administered ALK7-binding protein cross-blocks or competes for binding to ALK7 with an antibody comprising a VH and a VL sequence pair disclosed in Table 1A. In one embodiment, the administered ALK7-binding protein comprises a VH and VL pair disclosed in Table 3.
  • the administered ALK7-binding protein cross-blocks or competes for binding to ALK7 with an antibody comprising a VH and a VL sequence pair disclosed in Table 3.
  • the administered ALK7-binding protein comprises a VH and VL pair disclosed in Table 1A, Table IB, or Table 3.
  • the administered ALK7-binding protein cross-blocks or competes for binding to ALK7 with an antibody comprising a VH and a VL sequence pair disclosed in Table 1A, Table IB, or Table 3.
  • the disclosure provides a method of treating or ameliorating type II diabetes or a condition associated with type II diabetes, comprising administering to a diabetic subject an effective amount of an ALK7-binding protein (e.g., an antagonist ALK7 binding protein such as an antagonist anti-ALK7 antibody).
  • an ALK7-binding protein e.g., an antagonist ALK7 binding protein such as an antagonist anti-ALK7 antibody.
  • the disclosure provides a method of treating or ameliorating a condition associated with type II diabetes.
  • the condition is a member selected from: an eye condition (e.g., glaucoma, cataracts, and retinopathy), cardiovascular disease (e.g., hypertension, atherosclerosis, myocardial infarction, and stroke), hyperglycemia, peripheral neuropathy, and kidney disease (e.g., nephropathy).
  • the subject is at risk of developing type II diabetes or a condition associated with type II diabetes.
  • the subject is at risk of developing an eye condition (e.g., glaucoma, cataracts, and retinopathy), cardiovascular disease (e.g., hypertension, atherosclerosis, myocardial infarction, disordered fibrinolysis, and stroke), hyperglycemia, peripheral neuropathy, or kidney disease (e.g., nephropathy).
  • the administered ALK7-binding protein is an ALK7 antagonist.
  • the administered antagonist ALK7-binding protein is an anti-ALK7 antibody or an ALK7-binding antibody fragment.
  • the administered antagonist ALK7-binding protein is an anti-ALK7 antibody or an ALK7- binding antibody fragment disclosed herein.
  • the administered ALK7-binding protein comprises a VH and VL pair disclosed in Table 1A.
  • the administered ALK7-binding protein comprises a VH and VL pair disclosed in Table 3.
  • the administered ALK7-binding protein cross-blocks or competes for binding to ALK7 with an antibody comprising a VH and a VL sequence pair disclosed in Table IB or Table 3.
  • the disclosure provides a method of treating or ameliorating a metabolic disease or disorder or a condition associated with a metabolic disease or disorder, comprising administering to an effective amount of an ALK7-binding protein (e.g., an antagonist ALK7 binding protein such as an antagonist anti-ALK7 antibody) to a subject in need thereof.
  • an ALK7-binding protein e.g., an antagonist ALK7 binding protein such as an antagonist anti-ALK7 antibody
  • the treated or ameliorated condition is an alteration of lipid, lipoprotein or apolipoprotein metabolism.
  • the metabolic condition is high plasma triglyceride levels, hypertension, dyslipidemia high fasting blood sugar, low HDL cholesterol levels.
  • the treated or ameliorated condition is atherosclerosis, arteriosclerosis, or endothelial dysfunction.
  • the treated or ameliorated condition is chronic inflammation.
  • the treated or ameliorated condition is non-alcoholic fatty liver disease (e.g., fatty liver and/or NASH).
  • the administered ALK7-binding protein is an ALK7 antagonist.
  • the administered antagonist ALK7-binding protein is an anti-ALK7 antibody or an ALK7- binding antibody fragment.
  • the administered antagonist ALK7- binding protein is an anti-ALK7 antibody or an ALK7-binding antibody fragment disclosed herein.
  • the administered ALK7-binding protein comprises a VH and VL pair disclosed in Table 1A.
  • the administered ALK7-binding protein cross-blocks or competes for binding to ALK7 with an antibody comprising a VH and a VL sequence pair disclosed in Table 1 A.
  • the administered ALK7-binding protein comprises a VH and VL pair disclosed in Table IB or Table 3.
  • the administered ALK7-binding protein cross-blocks or competes for binding to ALK7 with an antibody comprising a VH and a VL sequence pair disclosed in Table IB or Table 3.
  • the disclosure provides a method of treating or ameliorating insulin resistance or a condition associated with insulin resistance, comprising administering an effective amount of an ALK7-binding protein (e.g., an antagonist ALK7 binding protein such as an antagonist anti-ALK7 antibody) to a subject in need thereof.
  • an ALK7-binding protein e.g., an antagonist ALK7 binding protein such as an antagonist anti-ALK7 antibody
  • the he treated or ameliorated condition is associated with impaired glucose tolerance or hyperglycemia.
  • the treated or ameliorated condition is associated with hypertension or atherosclerosis.
  • the treated or ameliorated condition is a member selected from the group consisting of: dyslipidemia, hyperlipidemia, hypercholesterolemia, low HDL serum level, high LDL serum level (e.g., LDL-C > 100 mg/dL, > 130 mg/dL, > 160 mg/dL), and hypertriglyceridemia (e.g., TG > 150 mg/dL, > 160 mg/dL, > 170 mg/dL).
  • the administered ALK7-binding protein is an ALK7 antagonist.
  • the administered antagonist ALK7-binding protein is an anti-ALK7 antibody or an ALK7-binding antibody fragment.
  • the administered antagonist ALK7-binding protein is an anti-ALK7 antibody or an ALK7- binding antibody fragment disclosed herein.
  • the administered ALK7-binding protein comprises a VH and VL pair disclosed in Table 1A.
  • the administered ALK7-binding protein cross-blocks or competes for binding to ALK7 with an antibody comprising a VH and a VL sequence pair disclosed in Table 1A.
  • the administered ALK7-binding protein comprises a VH and VL pair disclosed in Table IB or Table 3.
  • the administered ALK7-binding protein crossblocks or competes for binding to ALK7 with an antibody comprising a VH and a VL sequence pair disclosed in Table IB or Table 3.
  • the disclosure provides a method of treating or ameliorating a disease or disorder of the eyes, nervous system, kidney, lungs, and/or liver, or associated condition, comprising administering to an effective amount of an ALK7-binding protein (e.g., an antagonist ALK7 binding protein such as an antagonist anti-ALK7 antibody) to a subject in need thereof.
  • an ALK7-binding protein e.g., an antagonist ALK7 binding protein such as an antagonist anti-ALK7 antibody
  • the treated or ameliorated condition is inflammation.
  • the treated or ameliorated condition is nephropathy (e.g., diabetic nephropathy), arteriosclerosis of the renal artery), or kidney failure.
  • the treated or ameliorated condition is chronic inflammation.
  • the treated or ameliorated condition inflammation of adipose tissue is chronic inflammation.
  • the treated or ameliorated condition is inflammation of the liver.
  • the treated or ameliorated condition is NAFLD (e.g., fatty liver and/or NASH).
  • the subject to which the ALK7 binding protein is administered is at risk of developing a disease or disorder of the kidney, lungs, or liver.
  • the subject to which the ALK7 binding protein is administered is at risk of developing nephropathy.
  • the subject to which the ALK7 binding protein is administered is at risk of developing nephropathy.
  • the subject is at risk of developing chronic inflammation.
  • the subject is at risk of developing inflammation of adipose tissue.
  • the subject is at risk of developing inflammation of the liver.
  • the administered ALK7-binding protein is an ALK7 antagonist. In one embodiment, the administered antagonist ALK7-binding protein is an anti-ALK7 antibody or an ALK7- binding antibody fragment. In another embodiment the administered antagonist ALK7- binding protein is an anti-ALK7 antibody or an ALK7-binding antibody fragment disclosed herein. In one embodiment, the administered ALK7-binding protein comprises a VH and VL pair disclosed in Table 1A. In another embodiment, the administered ALK7-binding protein cross-blocks or competes for binding to ALK7 with an antibody comprising a VH and a VL sequence pair disclosed in Table 1 A. In one embodiment, the administered ALK7-binding protein comprises a VH and VL pair disclosed in Table IB or Table 3. In another embodiment, the administered ALK7-binding protein cross-blocks or competes for binding to ALK7 with an antibody comprising a VH and a VL sequence pair disclosed in Table IB or Table 3.
  • the disclosure provides a method of treating or ameliorating a cardiovascular disease or disorder or a condition associated with a cardiovascular disease or disorder, comprising administering to an effective amount of an ALK7-binding protein (e.g., an antagonist ALK7 binding protein such as an antagonist anti-ALK7 antibody) to a subject in need thereof.
  • an ALK7-binding protein e.g., an antagonist ALK7 binding protein such as an antagonist anti-ALK7 antibody
  • the treated or ameliorated condition is coronary heart disease, congestive heart failure, vascular restenosis, stroke, peripheral vascular disease, microvascular disease, disordered fibrinolysis, or arteriosclerosis.
  • the subject to which the ALK7 binding protein is administered is at risk of developing coronary heart disease, congestive heart failure, vascular restenosis, stroke, peripheral vascular disease, microvascular disease, or arteriosclerosis.
  • the treated or ameliorated condition is hypertension (e.g., blood pressure >130/80 mmHg in a resting state).
  • the subject to which the ALK7 binding protein is administered is at risk of developing hypertension.
  • the treated or ameliorated condition is atherosclerosis.
  • the subject to which the ALK7 binding protein is administered is at risk of developing atherosclerosis.
  • the administered ALK7-binding protein is an ALK7 antagonist.
  • the administered antagonist ALK7-binding protein is an anti-ALK7 antibody or an ALK7-binding antibody fragment.
  • the administered antagonist ALK7-binding protein is an anti-ALK7 antibody or an ALK7- binding antibody fragment disclosed herein.
  • the administered ALK7-binding protein comprises a VH and VL pair disclosed in Table 1A. In another embodiment, the administered ALK7-binding protein cross-blocks or competes for binding to ALK7 with an antibody comprising a VH and a VL sequence pair disclosed in Table 1A. In one embodiment, the administered ALK7-binding protein comprises a VH and VL pair disclosed in Table IB. In another embodiment, the administered ALK7- binding protein cross-blocks or competes for binding to ALK7 with an antibody comprising a VH and a VL sequence pair disclosed in Table IB. In one embodiment, the administered ALK7-binding protein comprises a VH and VL pair disclosed in Table 3. In another embodiment, the administered ALK7-binding protein cross-blocks or competes for binding to ALK7 with an antibody comprising a VH and a VL sequence pair disclosed in Table 3.
  • FIG. 1 shows the amount of adipose change in TBS and ALK7 mAb treated high- fat diet (HFD) mice. Changes in the amount of adipose are relative to baseline prior to ALK7 Ab or TBS treatment. Treatment with ALK7 mAbs (i.e., J02, K02, G05, C03, and L02) significantly reduced fat mass in HFD mice. * designates p>0.001 vs. HFD+TBS.
  • FIG. 2 shows the amount of lean body mass change in TBS and ALK7 mAb treated high-fat diet (HFD) mice. Changes in the amount of lean mass are relative to baseline prior to ALK7 Ab or TBS treatment. Treatment with ALK7 mAbs (i.e., J02, K02, G05, C03, and L02) did not change lean body mass in HFD mice. DETAILED DESCRIPTION
  • the disclosure provides isolated and/or recombinant ALK7-binding proteins.
  • the ALK7-binding proteins specifically bind ALK7.
  • the ALK7-binding proteins are anti-ALK7 antibodies.
  • Nucleic acids encoding the ALK7-binding proteins, vectors and host cells containing the nucleic acids, and methods of making and using the ALK7-binding proteins are also provided.
  • the provided ALK7-binding proteins have uses in diagnosing, treating, and/or ameliorating diseases and conditions associated with increased ALK7 expression and/or signaling.
  • Such uses include but are not limited to, preventing, and/or ameliorating obesity (e.g., abdominal obesity); overweight; insulin resistance; metabolic syndrome and other metabolic diseases or conditions; a lipid disorder such as, low HDL levels, high LDL levels, hyperlipidemia, hypertriglyceridemia or dyslipidemia; lipoprotein aberrations; decreased triglycerides; inflammation (e.g., liver inflammation and/or inflammation of adipose tissue), fatty liver disease; non-alcoholic fatty liver disease; hyperglycemia; impaired glucose tolerance (IGT); hyperinsulinemia; high cholesterol (e.g., high LDL levels and hypercholesterolemia); cardiovascular disease such as, heart disease including coronary heart disease, congestive heart failure, stroke, peripheral vascular disease, atherosclerosis; arteriosclerosis, and hypertension; Syndrome X; vascular restenosis; neuropathy; retinopathy; neurodegenerative disease; endothelial dysfunction, respiratory dysfunction, renal disease (e.g., nephropathy); pancreatitis
  • An ALK7-binding protein refers to a protein that specifically binds to ALK7, preferably binding to the extracellular domain of ALK7.
  • ALK7 and “ALK7 receptor” are used interchangeably and refer to
  • ALK7 (also referred to as ACVRLK7, Activin A Receptor, Type IC, ACVR-1C, Activin Receptor-Like kinase 7, and EC 2.7.11 in the literature).
  • Reference sequence for human ALK7 is provided in NCBI Reference Sequences NP 001104501.1.
  • the provided ALK7- binding proteins bind the extracellular domain of human ALK7 corresponding to the amino acid sequence of SEQ ID NO:86.
  • Reference sequence for rat ALK7 is provided in NCBI Reference Sequences P70539.
  • the provided ALK7-binding proteins bind the extracellular domain of rat ALK7 corresponding to the amino acid sequence of SEQ ID NO:87.
  • Compet or “competes” when used in the context of ALK7-binding proteins (e.g., neutralizing antibodies) means competition between antigen binding proteins as determined by an assay in which the antigen binding protein (e.g., an anti- ALK7 antibody or an ALK7-binding fragment thereof) under test prevents or inhibits specific binding of a reference antigen binding protein (e.g., a ligand, or a reference antibody) to a common antigen (e.g., an ALK7 extracellular domain or a fragment thereof).
  • a reference antigen binding protein e.g., a ligand, or a reference antibody
  • RIA solid phase direct or indirect radioimmunoassay
  • EIA solid phase direct or indirect enzyme immunoassay
  • biotin-avidin EIA see, e.g., Cheung, et al, Virology 176:546-552 (1990) and Kirkland et al, J. Immunol.
  • such an assay involves the use of purified antigen bound to a solid surface or cells bearing either of these, an unlabeled test antigen binding protein and a labeled reference antigen binding protein.
  • Binding inhibition can be measured by determining the amount of label bound to the solid surface or cells in the presence of the test antigen binding protein. Usually the test antigen binding protein is present in excess.
  • Antigen binding proteins identified by competition assay include ALK7-binding proteins that bind to the same epitope as the reference ALK7-binding protein as well as ALK7- binding proteins that bind to an adjacent epitope sufficiently proximal to the epitope bound by the reference ALK7-binding protein for steric hindrance to occur.
  • a competing ALK7 binding protein when used in context of an ALK7 protein refers to an ALK7
  • ALK7-binding protein e.g., an antibody
  • Epitopes usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three-dimensional structural characteristics, as well as specific charge characteristics. Conformational and non-conformational epitopes are distinguished in that the binding to the former but not the latter is lost in the presence of denaturing solvents.
  • the ALK7 epitope bound by an ALK7-binding protein can readily be determined using techniques known in the art.
  • Antigen binding proteins such as the anti-ALK7-binding antibodies and ALK7- binding fragments, variants, or derivatives thereof disclosed herein, can be described or specified in terms of the epitope(s) or portion(s) of an antigen, e.g., a target polypeptide that they recognize or specifically bind.
  • an antigen e.g., a target polypeptide that they recognize or specifically bind.
  • the portion of ALK7 that specifically interacts with the antigen binding domain of an ALK7-binding protein disclosed herein is an "epitope.
  • Epitopes can be formed both from contiguous amino acids or noncontiguous amino acids juxtaposed by tertiary folding of a protein.
  • Epitopes formed from contiguous amino acids are typically retained on exposure to denaturing solvents, whereas epitopes formed by tertiary folding are typically lost on treatment with denaturing solvents.
  • Epitope determinants may include chemically active surface groupings of molecules such as amino acids, sugar side chains, phosphoryl or sulfonyl groups, and may have specific three dimensional structural characteristics, and/or specific charge characteristics.
  • An epitope typically includes at least 3, 4, 5, 6, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35 amino acids in a unique spatial conformation. Epitopes can routinely be determined using methods known in the art.
  • neutralize are used interchangeably and refer to any statistically significant decrease in activity (e.g., ALK7 ligand binding and/or ALK7 signaling), including full blocking of the activity.
  • inhibittion can refer to a decrease of about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 100% in activity compared to a control.
  • the term “decrease, " "inhibit,” or “antagonize” may refer to the ability of an ALK7-binding protein such as an antibody or ALK7-binding fragment thereof, to statistically significantly (e.g., with a p value less than or equal to 0.05) decrease the phosphorylation of one or more Smads (e.g., Smad2 and/or Smad3) induced by contacting a cell expressing ALK7 and ActrIIA/B with an ALK7 ligand such as, GDF l, GDF3, GDF8, activin B, activin A/B, and/or Nodal, relative to the extent of Smad phosphorylation in the cell when not contacted with the ALK7-binding protein.
  • Smads e.g., Smad2 and/or Smad3
  • an ALK7 ligand such as, GDF l, GDF3, GDF8, activin B, activin A/B, and/or Nodal
  • the cell which expresses ALK7 can be a naturally occurring cell or a cell line, or can be recombinantly produced by introducing a nucleic acid encoding ALK7 into a host cell.
  • the ALK7-binding protein e.g., an ALK7 antibody or ALK7-binding fragment thereof, antagonizes (decreases) ALK7 ligand mediated phosphorylation of one or more Smads (e.g., Smad2 and/or Smad3) by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 95%, or by about 100%, as determined, for example, by Western blotting followed by probing with an anti-phosphotyrosine antibody or by ELISA (e.g., P- Smad ELISA) or a Smad dependent reporter gene assay using techniques described herein or otherwise known in the art.
  • Smads e.g., Smad2 and/or Smad3
  • the ALK7-binding protein antagonizes (decreases) ALK7-mediated inhibition of lipolysis in adipose cells.
  • an ALK7-binding protein is an ALK7 antagonist and antagonizes ALK7- mediated inhibition of lipolysis in white adipose cell by 5% to 100%, 10% to 95%, 10 to 90%, 10 to 85%, 10 to 80%, 10 to 75%, 10 to 70%, 10 to 75%, 10 to 70%, 10 to 60%, 10 to 55%), 10 to 50%), or 10 to 45%, as determined in a lipolysis assay.
  • an ALK7-binding protein reduces or decreases ALK7-mediated inhibition of lipolysis in white adipose cells by at least 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%), 90%), or 95%), or by about 100%), as determined in a lipolysis assay.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal).
  • an ALK7-binding protein is an ALK7 antagonist and antagonizes ALK7-mediated inhibition of lipolysis in white and/or brown adipose cells by 5% to 100%, 10% to 95%, 10 to 90%, 10 to 85%, 10 to 80%, 10 to 75%, 10 to 70%, 10 to 75%, 10 to 70%, 10 to 60%, 10 to 55%, 10 to 50%, or 10 to 45%, as determined in a lipolysis assay.
  • an ALK7-binding protein reduces or decreases ALK7-mediated inhibition of lipolysis in white and/or brown adipose cells by at least 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 95%, or by about 100%, as determined in a lipolysis assay.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of GDF1, GDF3, GDF8, activin B, activin A/B, and Nodal).
  • increase refers to any statistically significant increase in activity (e.g., ALK7 ligand binding and/or ALK7 signaling).
  • increase can refer to an increase of about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 100% in activity compared to a control.
  • the ALK7-binding protein increases lipolysis in cells. In some embodiments, the ALK7-binding protein increases lipolysis in cells by at least 5% to 100%, 10% to 95%, 10 to 90%, 10 to 85%, 10 to 80%, 10 to 75%, 10 to 70%, 10 to 75%, 10 to 70%, 10 to 60%, 10 to 55%, 10 to 50%, or 10 to 45%, as determined in a lipolysis assay. In some embodiments, the ALK7-binding protein increases lipolysis in adipose cells.
  • the ALK7-binding protein increases lipolysis in adipose cells by at least 5% to 100%, 10% to 95%, 10 to 90%, 10 to 85%, 10 to 80%, 10 to 75%, 10 to 70%, 10 to 75%, 10 to 70%, 10 to 60%, 10 to 55%, 10 to 50%, or 10 to 45%), as determined in a lipolysis assay.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of GDF1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein increases lipolysis in white adipose cells or brown adipose cells.
  • the ALK7-binding protein increases lipolysis in white adipose cells. In some embodiments, the ALK7-binding protein increases lipolysis in white adipose cells by at least 5% to 100%, 10% to 95%, 10 to 90%, 10 to 85%, 10 to 80%, 10 to 75%, 10 to 70%, 10 to 75%, 10 to 70%, 10 to 60%, 10 to 55%, 10 to 50%, or 10 to 45%), as determined in a lipolysis assay. In some embodiments the lipolysis assay is performed in the presence of one or more ALK7 ligands.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of GDF1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein increases lipolysis in brown adipose cells.
  • the ALK7-binding protein increases lipolysis in brown adipose cells by at least 5% to 100%, 10% to 95%, 10 to 90%, 10 to 85%, 10 to 80%, 10 to 75%, 10 to 70%, 10 to 75%, 10 to 70%, 10 to 60%, 10 to 55%, 10 to 50%, or 10 to 45%), as determined in a lipolysis assay.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands. In further embodiments, the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of GDF1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein increases lipolysis in white and brown adipose cells. In some embodiments, the ALK7-binding protein increases lipolysis in white and brown adipose cells by at least 5% to 100%, 10% to 95%, 10 to 90%, 10 to 85%, 10 to 80%, 10 to 75%, 10 to 70%, 10 to 75%, 10 to 70%, 10 to 60%, 10 to 55%, 10 to 50%), or 10 to 45%), as determined in a lipolysis assay. In some embodiments the lipolysis assay is performed in the presence of one or more ALK7 ligands. In further embodiments, the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • an ALK7-binding protein increases lipolysis in white adipose cells by at least 5% to 100%, 10% to 95%, 10 to 90%, 10 to 85%, 10 to 80%, 10 to 75%, 10 to 70%, 10 to 75%, 10 to 70%, 10 to 60%, 10 to 55%, 10 to 50%, or 10 to 45%), as determined using standard techniques and conditions in a lipolysis assay performed in the presence of activin B (50 ng/ml) (e.g., as described in the examples herein).
  • an ALK7-binding protein reduces or decreases ALK7- mediated inhibition of lipolysis in white adipose cells by at least 5%, 10%>, 20%, 30%>, 40%, 50%, 60%, 70%, 80%, 90%, or 95%, or by about 100%, as determined, using standard techniques and conditions in a lipolysis inhibition assay, the lipolysis assay is performed in the presence of activin B (50 ng/ml) (e.g., as described in the examples herein).
  • activin B 50 ng/ml
  • an ALK7-binding protein increases lipolysis in white and/or brown adipose cells by at least 5% to 100%, 10% to 95%, 10 to 90%, 10 to 85%, 10 to 80%, 10 to 75%, 10 to 70%, 10 to 75%, 10 to 70%, 10 to 60%, 10 to 55%, 10 to 50%), or 10 to 45%), as determined using standard techniques and conditions in a lipolysis assay performed in the presence of activin B (50 ng/ml) (e.g., as described in the examples herein).
  • an ALK7-binding protein reduces or decreases ALK7-mediated inhibition of lipolysis in white adipose cells by at least 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 95%, or by about 100%, as determined, using standard techniques and conditions in a lipolysis inhibition assay, the lipolysis assay is performed in the presence of activin B (50 ng/ml) (e.g., as described in the examples herein).
  • activin B 50 ng/ml
  • the ALK7-binding protein increases glycerol production in adipose cells. In some embodiments, the ALK7-binding protein increases glycerol production in adipose cells by at least 5% to 100%, 10% to 95%, 10 to 90%, 10 to 85%, 10 to 80%, 10 to 75%, 10 to 70%, 10 to 75%, 10 to 70%, 10 to 60%, 10 to 55%, 10 to 50%), or 10 to 45%), as determined in a lipolysis assay. In some embodiments the lipolysis assay is performed in the presence of one or more ALK7 ligands.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein increases glycerol production in white adipose cells or brown adipose cells.
  • antibody and “immunoglobulin,” are used interchangeably herein, and include whole (full-length) antibodies and antigen binding fragment or single chains thereof.
  • a typical antibody comprises at least two heavy (H) chains and two light (L) chains interconnected by disulfide bonds.
  • Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant region.
  • the heavy chain constant region is comprised of three domains, CHI, CH2, and CH3.
  • Each light chain is comprised of a light chain variable region (abbreviated herein as VL) and a light chain constant region.
  • the light chain constant region is comprised of one domain, CL.
  • VH and VL regions can be further subdivided into regions of hypervariability, termed Complementarity Determining Regions (CDR), interspersed with regions that are more conserved, termed framework regions (FW).
  • CDR Complementarity Determining Regions
  • FW framework regions
  • Each VH and VL is composed of three CDRs and four FWs, arranged from amino-terminus to carboxy -terminus in the following order: FW1, CDR1, FW2, CDR2, FW3, CDR3, FW4.
  • the variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
  • the constant regions of the antibodies can mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq) of the classical complement system.
  • Exemplary antibodies include typical antibodies, scFvs, and combinations thereof where, for example, an scFv is covalently linked (for example, via peptidic bonds or via a chemical linker) to the N or C- terminus of either the heavy chain and/or the light chain of a typical antibody, or intercalated in the heavy chain and/or the light chain of a typical antibody.
  • an scFv is covalently linked (for example, via peptidic bonds or via a chemical linker) to the N or C- terminus of either the heavy chain and/or the light chain of a typical antibody, or intercalated in the heavy chain and/or the light chain of a typical antibody.
  • antibody and "immunoglobulin,” encompass intact polyclonal antibodies, intact monoclonal antibodies, antibody fragments (such as Fab, Fab', F(ab')2, and Fv fragments), single chain Fv (scFv) derivatives and mutants, multispecific antibodies such as bispecific antibodies, chimeric antibodies, humanized antibodies, human antibodies, fusion proteins comprising an antigen determination portion of an antibody, and any other modified immunoglobulin molecule comprising an antigen recognition site so long as the antibodies exhibit the desired binding activity.
  • antibody fragments such as Fab, Fab', F(ab')2, and Fv fragments
  • scFv single chain Fv derivatives and mutants
  • multispecific antibodies such as bispecific antibodies, chimeric antibodies, humanized antibodies, human antibodies, fusion proteins comprising an antigen determination portion of an antibody, and any other modified immunoglobulin molecule comprising an antigen recognition site so long as the antibodies exhibit the desired binding activity.
  • An antibody can be of any the five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, or subclasses (isotypes) thereof (e.g., IgGl, IgG2, IgG3, IgG4, IgAl and IgA2), based on the identity of their heavy-chain constant domains referred to as alpha, delta, epsilon, gamma, and mu, respectively.
  • the different classes of immunoglobulins have different and well known subunit structures and three-dimensional configurations.
  • Antibodies can be naked or conjugated to other molecules such as toxins, radioisotopes, etc.
  • IgG refers to a polypeptide belonging to the class of antibodies that are substantially encoded by a recognized immunoglobulin gamma gene. In humans this class comprises IgGl, IgG2, IgG3, and IgG4. In mice this class comprises IgGl, IgG2a, IgG2b, and IgG3.
  • ALK7 antibody an antibody that binds to ALK7
  • anti-ALK7 antibody refers to an antibody that is capable of binding ALK7 with sufficient affinity such that the antibody is useful as a therapeutic agent or diagnostic reagent in targeting ALK7, respectively.
  • binding protein such as an antibody
  • ALK7 e.g., human ALK7, preferably an extracellular domain of ALK7
  • the control protein is hen egg white lysozyme.
  • the binding protein binds ALK7 with an affinity that is at least, 100, 500, or 1000 times greater than the affinity for a control protein.
  • the binding protein has a binding affinity for human ALK7 of ⁇ 1 X 10 "7 M or ⁇ 1 X 10 "8 as measured using a binding assay known in the art.
  • the binding affinity is measured using a radioimmunoassay (RIA) or BIACORE® (e.g., using ALK7 as the analyte and ALK7-binding protein as the ligand, or vice versa).
  • RIA radioimmunoassay
  • BIACORE® e.g., using ALK7 as the analyte and ALK7-binding protein as the ligand, or vice versa.
  • the extent of binding of an ALK7-binding protein is less than about 10% of the binding of the ALK7-binding protein to ALK7 as measured, for example, by a radioimmunoassay (RIA), BIACORE® (using recombinant ALK7 as the analyte and ALK7-binding protein as the ligand, or vice versa), kinetic exclusion assay (KINEXA®), or other binding assays known in the art.
  • RIA radioimmunoassay
  • BIACORE® using recombinant ALK7 as the analyte and ALK7-binding protein as the ligand, or vice versa
  • KINEXA® kinetic exclusion assay
  • the ALK7-binding protein is a full-length antibody or an ALK7-binding antibody fragment that has a dissociation constant (K D ) of ⁇ 1 ⁇ , ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM, ⁇ 0.1 nM, ⁇ 10 pM, ⁇ 1 pM, or ⁇ 0.1 pM.
  • K D dissociation constant
  • antigen binding antibody fragment refers to a fragment containing all or a portion of an antigen binding variable region (e.g., CDR3) of an intact antibody. It is known that the antigen binding function of an antibody can be performed by fragments of a full-length antibody. Examples of antibody fragments include, but are not limited to Fab, Fab', F(ab')2, and Fv fragments, linear antibodies, single chain antibodies, and multispecific antibodies formed from one or more antibody fragments.
  • the disclosure provides ALK7- binding antibody fragments wherein the antibody fragment is a Fab fragment, a Fab' fragment, a F(ab') 2 fragment, a Fv fragment, a diabody, or a single chain antibody molecule.
  • the Fc region includes polypeptides comprising the constant region of an antibody excluding the first constant region immunoglobulin domain.
  • Fc refers to the last two constant region immunoglobulin domains of IgA, IgD, and IgG, and the last three constant region immunoglobulin domains of IgE and IgM, and the flexible hinge N- terminal to these domains.
  • IgA and IgM Fc may include the J chain.
  • Fc comprises immunoglobulin domains Cy2 and Cy3 and the hinge between Cyl and Cy2.
  • the human IgG heavy chain Fc region is usually defined to comprise residues C226 or P230 to its carboxyl-terminus, wherein the numbering is according to the EU index as set forth in Kabat (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, NIH, Bethesda, Md. (1991)).
  • Fc may refer to this region in isolation, or this region in the context of a whole antibody, antibody fragment, or Fc fusion protein.
  • Polymorphisms have been observed at a number of different Fc positions, including but not limited to positions 270, 272, 312, 315, 356, and 358 as numbered by the EU index, and thus slight differences between the presented sequence and sequences in the prior art may exist.
  • a “monoclonal antibody” refers to a homogeneous antibody population involved in the highly specific recognition and binding of a single antigenic determinant or epitope. This is in contrast to polyclonal antibodies that typically include different antibodies directed against different antigenic determinants.
  • the term “monoclonal antibody” encompasses both intact and full-length monoclonal antibodies as well as antibody fragments (such as Fab, Fab', F(ab')2, and Fv), single chain (scFv) mutants, and fusion proteins) comprising an antibody portion, and any other modified immunoglobulin molecule comprising an antigen recognition site.
  • a monoclonal antibody may be made in any number of ways including, but not limited to, by hybridoma, phage selection, recombinant expression, and transgenic animals.
  • chimeric antibody refers to an antibody wherein the amino acid sequence of the immunoglobulin molecule is derived from two or more species.
  • the variable region of both light and heavy chains corresponds to the variable region of antibodies derived from one species of mammal ⁇ e.g., mouse, rat, rabbit, etc.) with the desired antigen-binding specificity, affinity, and/or capability while the constant regions are homologous to the sequences in antibodies derived from another species (usually human) to avoid eliciting an immune response in that species.
  • humanized antibody refers to an antibody derived from a non-human
  • humanized antibodies are human immunoglobulins in which residues from the CDR are replaced by residues from the CDR of a non-human species ⁇ e.g., mouse, rat, rabbit, or hamster) that have the desired antigen-binding specificity, affinity, and/or capability (Jones, Nature 321 :522-525 (1986); Riechmann, Nature 332:323-327 (1988); Verhoeyen, Science 239: 1534-1536 (1988)).
  • the Fv framework region (FW) residues of a human immunoglobulin are replaced with the corresponding residues in an antibody from a non- human species that has the desired antigen-binding specificity, affinity, and/or capability.
  • the humanized antibody can be further modified by the substitution of additional residues either in the Fv framework region and/or within the replaced non-human residues to refine and optimize antibody specificity, affinity, and/or capability.
  • the humanized antibody will comprise substantially all of at least one, and typically two or three, variable domains containing all or substantially all of the CDR regions that correspond to the non-human immunoglobulin whereas all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence.
  • the humanized antibody can also comprise at least a portion of an immunoglobulin constant region or domain (Fc), typically that of a human immunoglobulin.
  • Fc immunoglobulin constant region or domain
  • human antibody refers to an antibody produced by a human or an antibody having an amino acid sequence corresponding to an antibody produced by a human made using any technique known in the art.
  • human antibody includes intact (full-length) antibodies, fragments thereof, and/or antibodies comprising at least one human heavy and/or light chain polypeptide such as, an antibody comprising murine light chain and human heavy chain polypeptides.
  • an "antagonist,” “blocking,” or “neutralizing” binding protein is one that inhibits or reduces activity of the antigen it binds, such as ALK7.
  • the antagonist ALK7-binding protein reduces or inhibits the multimerization of ALK7, and ActRII receptor (e.g., ActRIIA or ActRIIB) an GDF 1, GDF3, GDF8, activin B, activin A/B, and/or Nodal.
  • the antagonist ALK7-binding protein substantially or completely inhibits the activity of the ALK7.
  • the ALK7 activity is reduced by 10%, 20%, 30%, 50%, 70%, 80%, 90%, 95%, or 100%.
  • the antagonist ALK7-binding protein is an anti-ALK7 antibody, such as a full-length antibody or an ALK7-binding antibody fragment.
  • the antagonist anti-ALK7 antibody inhibits or reduces the activity of ALK7 by at least 10%, 20%, 30%, 50%, 70%, 80%, 90%, 95%, or even 100%.
  • Binding affinity generally refers to the strength of the sum total of non-covalent interactions between a single binding site of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen). Unless indicated otherwise, "binding affinity” refers to intrinsic binding affinity which reflects a 1 : 1 interaction between members of a binding pair (e.g., antibody and antigen).
  • the affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (K D ). Affinity can be measured by common methods known in the art, including those described herein and can be used for the purposes of the present disclosure.
  • IC 50 is the median inhibitory concentration of an ALK7-binding protein (e.g., an anti-ALK7 antibody). In functional assays, IC 50 is the concentration that reduces a biological response by 50% of its maximum. In ligand- receptor binding studies, IC 50 is the concentration that reduces ligand-receptor binding by 50% of maximal specific binding level.
  • IC 50 can be calculated by any number of means known in the art.
  • the fold improvement in potency for the antibodies or other binding protein provided herein as compared to a reference anti-ALK7 antibody or other ALK7- binding protein can be at least 2-fold, 4-fold, 6-fold, 8-fold, 10-fold, 20-fold, 30-fold, 40- fold, 50-fold, 60-fold, 70-fold, 80-fold, 90-fold, 100-fold, 1 10-fold, 120-fold, 130-fold, 140-fold, 150-fold, 160-fold, 170-fold, or at least 180-fold.
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • FcRs Fc receptors
  • cytotoxic cells e.g., Natural Killer (NK) cells, neutrophils, and macrophages
  • NK Natural Killer
  • IgG antibodies directed to the surface of target cells "arm" the cytotoxic cells and are absolutely required for such killing. Lysis of the target cell is extracellular, requires direct cell-to-cell contact, and does not involve complement.
  • an ALK7-binding protein e.g., an ALK7 antibody, including an ALK7-binding fragment, variant, and derivative thereof
  • polynucleotide, vector, cell, or composition which is "isolated” is a protein (e.g., antibody), polynucleotide, vector, cell, or composition which is in a form not found in nature.
  • Isolated proteins, polynucleotides, vectors, cells or compositions include those which have been purified to a degree that they are no longer in a form in which they are found in nature.
  • a protein, polynucleotide, vector, cell, or composition which is isolated is substantially pure.
  • Isolated proteins and isolated nucleic acid will be free or substantially free of material with which they are naturally associated such as other polypeptides or nucleic acids with which they are found in their natural environment, or the environment in which they are prepared (e.g., cell culture) when such preparation is by recombinant DNA technology practiced in vitro or in vivo.
  • Proteins and nucleic acid may be formulated with diluents or adjuvants and still for practical purposes be isolated - for example the proteins will normally be mixed with gelatin or other carriers if used to coat microtitre plates for use in immunoassays, or will be mixed with pharmaceutically acceptable carriers or diluents when used in diagnosis or therapy.
  • subject refers to any subject, particularly a mammalian subject, for whom diagnosis, prognosis, or therapy is desired.
  • Mammalian subjects include but are not limited to humans, non-human primates, domestic animals, farm animals, rodents, and the like, which is to be the recipient of a particular treatment.
  • composition refers to a preparation which is in such form as to permit the biological activity of the active ingredient to be effective, and which contains no additional components at concentrations that are unacceptably toxic to a subject to which the composition would be administered.
  • Such composition can be sterile.
  • an "effective amount" of a polypeptide, e.g., an antigen binding protein including an antibody, as disclosed herein is an amount sufficient to carry out a specifically stated purpose.
  • An “effective amount” can be determined empirically and in a routine manner, in relation to the stated purpose.
  • the term "therapeutically effective amount” refers to an amount of a polypeptide, e.g., an antigen binding protein including an antibody, or other drug effective to "treat" a disease or condition in a subject (e.g., a mammal such as a human) and provides some improvement or benefit to a subject having the disease or condition.
  • a “therapeutically effective” amount is an amount that provides some alleviation, mitigation, and/or decrease in at least one clinical symptom of an ALK7- mediated disease or condition.
  • Clinical symptoms associated with the diseases or conditions that can be treated by the methods of the disclosure are well known. Further, therapeutic effects need not be complete or curative, as long as some benefit is provided to the subject.
  • the term "therapeutically effective” refers to an amount of a therapeutic agent that is capable of reducing ALK7 activity in a subject in need thereof.
  • the actual amount administered and rate and time-course of administration will depend on the nature and severity of what is being treated. Prescription of treatment, e.g., decisions on dosage etc., is within the responsibility of general practitioners and other medical doctors.
  • a "sufficient amount” or “an amount sufficient to” achieve a particular result in a subject having an ALK7-mediated disease or condition refers to an amount of a therapeutic agent ⁇ e.g., an antigen binding protein including an antibody, as disclosed herein) that is effective to produce a desired effect, which is optionally a therapeutic effect ⁇ i.e., by administration of a therapeutically effective amount).
  • a therapeutic agent e.g., an antigen binding protein including an antibody, as disclosed herein
  • such particular result is a reduction in ALK7 activity in a subject in need thereof.
  • label refers to a detectable compound or composition which is conjugated directly or indirectly to a moiety such as an anti-ALK7 antibody so as to generate a "labeled” moiety.
  • the label can be detectable by itself ⁇ e.g., radioisotope labels or fluorescent labels) or, in the case of an enzymatic label, can catalyze chemical alteration of a substrate compound or composition which is detectable.
  • Terms such as “treating,” or “treatment,” “to treat” or “ameliorating” and “to ameliorate” refer to both (a) therapeutic measures that cure, slow down, lessen symptoms of, and/or halt progression of a diagnosed pathologic condition or disorder and (b) prophylactic or preventative measures that prevent and/or slow the development of a targeted disease or condition.
  • subjects in need of treatment include those already with the disease or condition; those at risk of developing the disease or condition; and those in whom the disease or condition is to be prevented.
  • a subject is successfully “treated” according to the methods provided herein if the subject shows, e.g., total, partial, or transient amelioration or elimination of a symptom associated with the disease or condition.
  • the disclosure provides a method for treating a disease, disorder or condition selected from, obesity (e.g., abdominal obesity); insulin resistance; metabolic syndrome and other metabolic diseases or conditions; a lipid disorder such as, low HDL levels, high LDL levels, hyperlipidemia, hypertriglyceridemia or dyslipidemia; lipoprotein aberrations; decreased triglycerides; inflammation (e.g., liver inflammation and/or inflammation of adipose tissue), fatty liver disease; non-alcoholic fatty liver disease; hyperglycemia; impaired glucose tolerance (IGT); hyperinsulinemia; high cholesterol (e.g., high LDL levels and hypercholesterolemia); cardiovascular disease such as, heart disease including coronary heart disease, congestive heart failure, stroke, peripheral vascular disease, atherosclerosis; arteriosclerosis, and hypertension; Syndrome X; vascular restenosis; neuropathy; retinopathy; neurodegenerative disease; endothelial dysfunction, respiratory dysfunction, renal disease (e.g., nephropathy); pancre
  • combination with or “combination therapies” refers to any form of administration such that additional therapies (e.g., second, third, fourth, etc.) are still effective in the body (e.g., multiple compounds are simultaneously effective in the subject, which may include synergistic effects of those compounds). Effectiveness may not correlate to measurable concentration of the agent in blood, serum, or plasma.
  • the different therapeutic compounds can be administered either in the same formulation or in separate formulations, either concomitantly or sequentially, and on different schedules. Thus, a subject that receives such treatment can benefit from a combined effect of different therapies.
  • One or more ALK7-binding proteins provided herein can be administered concurrently with, prior to, or subsequent to, one or more other additional agents and/or supportive therapies.
  • each therapeutic agent will be administered at a dose and/or on a time schedule determined for that particular agent.
  • the particular combination to employ in a regimen will take into account compatibility of the antagonist of the present disclosure with therapy and/or the desired outcome.
  • cancer refers to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth.
  • cancers include but are not limited to, carcinoma including adenocarcinomas, lymphomas, blastomas, melanomas, sarcomas, and leukemias.
  • cancers include squamous cell cancer, small-cell lung cancer, non-small cell lung cancer, gastrointestinal cancer, Hodgkin's and non-Hodgkin's lymphoma, pancreatic cancer, glioblastoma, glioma, cervical cancer, ovarian cancer, liver cancer such as hepatic carcinoma and hepatoma, bladder cancer, breast cancer (including hormonally mediated breast cancer, see, e.g., Innes et al, Br. J.
  • cancer 94: 1057-1065 (2006) colon cancer, colorectal cancer, endometrial carcinoma, myeloma (such as multiple myeloma), salivary gland carcinoma, kidney cancer such as renal cell carcinoma and Wilms' tumors, basal cell carcinoma, melanoma, prostate cancer, vulval cancer, thyroid cancer, testicular cancer, esophageal cancer, various types of head and neck cancer and cancers of mucinous origins, such as, mucinous ovarian cancer, cholangiocarcinoma (liver) and renal papillary carcinoma.
  • the cancer is breast, endometrial, or uterine cancer.
  • the cancer is a myeloma ⁇ e.g., multiple myeloma, plasmacytoma, localized myeloma, and extramedullary myeloma), or endometrial, gastric, liver, colon, renal or pancreatic cancer.
  • polynucleotide and nucleic acid are used interchangeably and are intended to encompass a singular nucleic acid as well as plural nucleic acids, and refers to an isolated nucleic acid molecule or construct, e.g., messenger RNA (mRNA), complementary DNA (cDNA), or plasmid DNA (pDNA).
  • mRNA messenger RNA
  • cDNA complementary DNA
  • pDNA plasmid DNA
  • a polynucleotide comprises a conventional phosphodiester bond or a non-conventional bond (e.g., an amide bond, such as found in peptide nucleic acids (PNA)).
  • PNA peptide nucleic acids
  • nucleic acid refers to any one or more nucleic acid segments, e.g., DNA, cDNA, or RNA fragments, present in a polynucleotide.
  • isolated refers to a nucleic acid molecule, DNA or RNA, which has been removed from its native environment, for example, a recombinant polynucleotide encoding an antigen binding protein contained in a vector is considered isolated for the purposes of the present disclosure.
  • Further examples of an isolated polynucleotide include recombinant polynucleotides maintained in heterologous host cells or purified (partially or substantially) from other polynucleotides in a solution.
  • Isolated RNA molecules include in vivo or in vitro RNA transcripts of polynucleotides of the present disclosure.
  • Isolated polynucleotides or nucleic acids according to the present disclosure further include such molecules produced synthetically.
  • polynucleotides or nucleic acids can include regulatory elements such as promoters, enhancers, ribosome binding sites, or transcription termination signals.
  • vector means a construct, which is capable of delivering, and in some embodiments expressing, one or more gene(s) or sequence(s) of interest in a host cell.
  • vectors include, but are not limited to, viral vectors, naked DNA or RNA expression vectors, plasmid, cosmid or phage vectors, DNA or RNA expression vectors associated with cationic condensing agents, DNA or RNA expression vectors encapsulated in liposomes, and certain eukaryotic cells, such as producer cells.
  • the term "host cell” refers to a cell or a population of cells harboring or capable of harboring a recombinant nucleic acid.
  • Host cells can be prokaryotic (e.g., E. coli), or eukaryotic.
  • the host cells can be fungal cells including yeast such as Saccharomyces cerevisiae, Pichia pastoris, or Schizosaccharomyces pombe.
  • the host cells also be any of various animal cells, such as insect cells (e.g., Sf-9) or mammalian cells (e.g., HEK293F, CHO, COS-7, NIH-3T3, NS0, PER.C6®, and hybridoma).
  • the host cells is a CHO cell selected from the group consisting of CHO-K, CHO-0 CHO- LeclO, CHO-Lecl3, CHO-Lecl, CHO Pro " 5, and CHO dhfr " .
  • the host cell is a hybridoma.
  • polypeptide polypeptide
  • peptide protein
  • the terms “polypeptide,” “peptide,” and “protein” are used interchangeably herein to refer to polymers of amino acids of any length.
  • the polymer can be linear or branched, it can comprise modified amino acids, and it can be interrupted by non-amino acids.
  • the terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation with a labeling component.
  • polypeptides containing one or more analogs of an amino acid including, for example, unnatural amino acids, etc.
  • the ALK7-binding proteins can occur as single chains or associated chains.
  • a "recombinant" polypeptide, protein or antibody refers to polypeptide, protein or antibody produced via recombinant DNA technology. Recombinantly produced polypeptides, proteins and antibodies expressed in host cells are considered isolated for the purpose of the present disclosure, as are native or recombinant polypeptides which have been separated, fractionated, or partially or substantially purified by any suitable technique.
  • fragments, variants, or derivatives of polypeptides are also included in the present disclosure.
  • fragment when referring to polypeptides and proteins include any polypeptides or proteins which retain at least some of the properties of the reference polypeptide or protein. Fragments of polypeptides include proteolytic fragments, as well as deletion fragments.
  • variant refers to an antibody or polypeptide sequence that differs from that of a parent antibody or polypeptide sequence by virtue of at least one amino acid modification.
  • variants of antibodies or polypeptides include fragments, and also antibodies or polypeptides with altered amino acid sequences due to amino acid substitutions, deletions, or insertions.
  • Variants can be naturally or non-naturally occurring.
  • Non-naturally occurring variants can be produced using art-known mutagenesis techniques.
  • Variant polypeptides can comprise conservative or non- conservative amino acid substitutions, deletions or additions.
  • derivatives refers to antibodies or polypeptides which have been altered so as to exhibit additional features not found on the native antibody or polypeptide.
  • An example of a “derivative” antibody is a fusion or a conjugate with a second polypeptide or another molecule (e.g., a polymer such as PEG, a chromophore, or a fluorophore) or atom (e.g., a radioisotope).
  • amino acid substitution refers to replacing an amino acid residue present in a parent sequence with another amino acid residue.
  • An amino acid can be substituted in a parent sequence, for example, via chemical peptide synthesis or through known recombinant methods.
  • references to a "substitution at position X" or “substitution at position X” refer to the substitution of an amino acid residue present at position X with an alternative amino acid residue.
  • substitution patterns can described according to the schema AXY, wherein A is the single letter code corresponding to the amino acid residue naturally present at position X, and Y is the substituting amino acid residue.
  • substitution patterns can described according to the schema XY, wherein Y is the single letter code corresponding to the amino acid residue substituting the amino acid residue naturally present at position X.
  • a "conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain.
  • Families of amino acid residues having similar side chains have been previously defined, including basic side chains (e.g., Lys, Arg, His), acidic side chains (e.g., Asp, Glu), uncharged polar side chains (e.g., Gly, Asp, Gin, Ser, Thr, Tyr, Cys), nonpolar side chains (e.g., Ala, Val, Leu, He, Pro, Phe, Met, Trp), beta-branched side chains (e.g., Thr, Val, He) and aromatic side chains (e.g., Tyr, Phe, Trp, His).
  • basic side chains e.g., Lys, Arg, His
  • acidic side chains e.g., Asp, Glu
  • uncharged polar side chains e.g., Gly, Asp, Gin, Ser, Thr, Tyr, Cys
  • a string of amino acid residues can be conservatively replaced with a structurally similar string that differs in order and/or composition of side chain family members.
  • Non-conservative substitutions include those in which (a) a residue having an electropositive side chain (e.g., Arg, His, or Lys) is substituted for, or by, an electronegative residue (e.g., Glu or Asp), (b) a hydrophilic residue (e.g., Ser or Thr) is substituted for, or by, a hydrophobic residue (e.g., Ala, Leu, He, Phe, or Val), (c) a Cys or Pro is substituted for, or by, any other residue, or (d) a residue having a bulky hydrophobic or aromatic side chain (e.g., Val, His, He, or Trp) is substituted for, or by, one having a smaller side chain (e.g., Ala or Ser) or no side chain (e.g., Gly).
  • an electropositive side chain e.g., Arg, His, or Lys
  • an electronegative residue e.g., Glu or Asp
  • substitutions can be readily identified.
  • a substitution can be taken from any one of D-Ala, Gly, beta- Ala, L-Cys and D- Cys.
  • a replacement can be any one of D-Lys, Arg, D-Arg, homo-Arg, Met, D- Met, ornithine, or D-ornithine.
  • substitutions in functionally important regions that can be expected to induce changes in the properties of isolated polypeptides are those in which (a) a polar residue (e.g., Ser or Thr) is substituted for (or by) a hydrophobic residue (e.g., Leu, He, Phe, or Ala); (b) a Cys residue is substituted for (or by) any other residue; (c) a residue having an electropositive side chain (e.g., Lys, Arg, or His), is substituted for (or by) a residue having an electronegative side chain (e.g., Glu or Asp); or (d) a residue having a bulky side chain (e.g., Phe) is substituted for (or by) one not having such a side chain (e.g., Gly).
  • a polar residue e.g., Ser or Thr
  • a hydrophobic residue e.g., Leu, He, Phe, or Ala
  • Cys residue is substituted for (
  • amino acid insertion refers to introducing a new amino acid residue between two amino acid residues present in the parent sequence.
  • An amino acid residue can be inserted in a parent sequence, for example, via chemical peptide synthesis or through recombinant methods known in the art.
  • insertion between positions X and Y or “insertion between Kabat positions X and Y,” wherein X and Y correspond to amino acid residue positions (e.g., a cysteine amino acid residue insertion between positions 239 and 240), refers to the insertion of an amino acid residue between the X and Y positions, and also to the insertion in a nucleic acid sequence of a codon encoding an amino acid residue between the codons encoding the amino acid residues at positions X and Y.
  • percent sequence identity or “percent identity” between two polynucleotide or polypeptide sequences refers to the number of identical matched positions shared by the sequences over a comparison window, taking into account additions or deletions (i.e., gaps) that must be introduced for optimal alignment of the two sequences.
  • a matched position is any position where an identical nucleotide or amino acid is presented in both the target and reference sequence. Gaps presented in the target sequence are not counted since gaps are not nucleotides or amino acids. Likewise, gaps presented in the reference sequence are not counted since target sequence nucleotides or amino acids are counted, not nucleotides or amino acids from the reference sequence.
  • the percentage of sequence identity is calculated by determining the number of positions at which the identical amino-acid residue or nucleic acid base occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity.
  • the comparison of sequences and determination of percent sequence identity between two sequences can be accomplished using readily available software programs. Suitable software programs are available from various sources, and for alignment of both protein and nucleotide sequences. One suitable program to determine percent sequence identity is bl2seq, part of the BLAST suite of program available from the U.S. government's National Center for Biotechnology Information BLAST web site (blast.ncbi.nlm.nih.gov).
  • B12seq performs a comparison between two sequences using either the BLASTN or BLASTP algorithm.
  • BLASTN is used to compare nucleic acid sequences
  • BLASTP is used to compare amino acid sequences.
  • Other suitable programs are, e.g., Needle, Stretcher, Water, or Matcher, part of the EMBOSS suite of bioinformatics programs and also available from the European Bioinformatics Institute (EBI) at www.ebi.ac.uk/Tools/psa.
  • the structure for carrying a CDR or a set of CDRs will generally be of an antibody heavy or light chain sequence or substantial portion thereof in which the CDR or set of CDRs is located at a location corresponding to the CDR or set of CDRs of naturally occurring VH and VL antibody variable domains encoded by rearranged immunoglobulin genes.
  • the structures and locations of immunoglobulin variable domains and their CDRs can readily be determined by one skilled in the art using programs and known variable domain residue numbering systems such as Chothia, Chothia+, and Kabat can routinely be determined by reference to Kabat (Kabat et al, Sequences of Proteins of Immunological Interest. 4th Edition. U.S. DHHS.
  • CDRs can also be carried by other scaffolds such as fibronectin, cytochrome B, albumin (e.g., ALBUdAb (Domantis/GSK) and ALB-Kunitz (Dyax)), unstructured repeat sequences of 3 or 6 amino acids (e.g., PASylation® technology and XTEN® technology), and sequences containing elastin-like repeat domains (see, e.g., U.S. Pat. Appl. No. 61/442,106, which is herein incorporated by reference in its entirety).
  • scaffolds such as fibronectin, cytochrome B, albumin (e.g., ALBUdAb (Domantis/GSK) and ALB-Kunitz (Dyax)), unstructured repeat sequences of 3 or 6 amino acids (e.g., PASylation® technology and XTEN® technology), and sequences containing elastin-like repeat domains (see, e.g., U.S. Pat
  • a CDR amino acid sequence substantially as set out herein can be carried as a
  • HCDR3 in a human variable domain or a substantial portion thereof.
  • the HCDR3 sequences substantially as set out herein represent embodiments of the present disclosure and each of these may be carried as a HCDR3 in a human heavy chain variable domain or a substantial portion thereof.
  • Variable domains employed in the present disclosure can be obtained from any germ-line or rearranged human variable domain, or can be a synthetic variable domain based on consensus sequences of known human variable domains.
  • a CDR sequence e.g., CDR3
  • CDR3 can be introduced into a repertoire of variable domains lacking a CDR (e.g., CDR3), using recombinant DNA technology.
  • Marks et al provide methods of producing repertoires of antibody variable domains in which consensus primers directed at or adjacent to the 5' end of the variable domain area are used in conjunction with consensus primers to the third framework region of human VH genes to provide a repertoire of VH variable domains lacking a CDR3. Marks et al, further describe how this repertoire can be combined with a CDR3 of a particular antibody.
  • the CDR3- derived sequences of the present disclosure can be shuffled with repertoires of VH or VL domains lacking a CDR3, and the shuffled complete VH or VL domains combined with a cognate VL or VH domain to provide antigen binding proteins.
  • the repertoire can then be displayed in a suitable host system such as the phage display system of Intl. Appl. Publ. No. WO92/01047 or any of a subsequent large body of literature, including Kay et al, (1996) Phage Display of Peptides and Proteins: A Laboratory Manual, San Diego: Academic Press, so that suitable antigen binding proteins may be selected.
  • a repertoire can consist of from anything from 104 individual members upwards, for example from 10 6 to 10 8 ,or 10 10 , members.
  • Other suitable host systems include yeast display, bacterial display, T7 display, and ribosome display.
  • yeast display for a review of ribosome display for see Lowe et al, Curr. Pharm. Biotech. 517-527 (2004) and Intl. Appl. Publ. No. WO92/01047, each of which is herein incorporated by reference herein in its entirety.
  • An ALK7-binding protein ⁇ e.g., an anti-ALK7 antibody
  • ALK7-binding protein is said to "compete" with a reference molecule for binding to ALK7 if it binds to ALK7 to the extent that it blocks, to some degree, binding of the reference molecule to ALK7.
  • the ability of proteins to compete for binding to ALK7 and thus to interfere with, block or "cross-block” one another's binding to ALK7 can be determined by any standard competitive binding assay known in the art including, for example, a competition ELISA assay, surface plasmon resonance (SPR; BIACORE®, Biosensor, Piscataway, N.J.) or according to methods described by Scatchard et al. ⁇ Ann. N.Y.
  • An ALK7- binding protein may be said to competitively inhibit binding of the reference molecule to ALK7, for example, by at least 90%, at least 80%>, at least 70%, at least 60%>, or at least 50%). According to some embodiments, the ALK7-binding protein competitively inhibits binding of the reference molecule to ALK7, by at least 90%, at least 80%>, at least 70%, at least 60%), or at least 50%. According to other embodiments, the ALK7-binding protein competitively inhibits binding of a reference molecule to ALK7, by at least 90%, at least 80%, at least 70%, at least 60%, or at least 50%.
  • Proteins that specifically bind ALK7 are provided.
  • antagonist ALK-7 binding proteins are provided.
  • the ALK7 binding proteins are antibodies.
  • the antibodies are antagonist anti-ALK7 antibodies.
  • ALK7 refers to a family of activin receptor-like kinase-
  • ALK7 proteins from any species and variants derived from such ALK7 proteins by mutagenesis or other modification.
  • Reference to ALK7 herein is understood to be a reference to any one of the currently identified forms.
  • Members of the ALK7 family are generally transmembrane proteins, composed of a ligand-binding extracellular domain with a cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine kinase activity.
  • isoforms of human ALK7 There are various naturally occurring isoforms of human ALK7.
  • the sequence of canonical human ALK7 isoform 1 precursor protein (NCBI Ref Seq P_660302.2) is as follows:
  • the ALK7-binding protein binds ALK7 with an affinity that is at least, 100, 500, or 1000 times greater than the affinity of the ALK7-binding protein for a control protein that is not a TGF-beta receptor family member.
  • the ALK7-binding protein binds ALK7 and has a dissociation constant (K D ) of ⁇ 1 ⁇ , ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM, ⁇ 0.1 nM, ⁇ 10 pM, ⁇ 1 pM, or ⁇ 0.1 pM.
  • the ALK7-binding protein has a KD for human ALK7 within the range of ⁇ 1 ⁇ and >0.1 pM, ⁇ 100 ⁇ and >0.1 pM, or ⁇ 100 ⁇ and >1 pM.
  • BIACORE® analysis is used to determine the ability of an
  • ALK7-binding protein e.g., an anti-ALK7 antibody
  • ALK7-binding protein to compete with/block the binding to ALK7 protein by a reference ALK7-binding protein (e.g., an anti-ALK7 antibody).
  • ALK7-Fc fusion protein is captured on a CM5 BIACORE® chip by previously attached anti-niFc IgG to generate an ALK7-coated surface.
  • 200-800 resonance units of ALK7-Fc (dimeric) would be coupled to the chip (an amount that gives easily measurable levels of binding but that is readily saturable by the concentrations of test reagent being used).
  • the two ALK7-binding proteins (termed A* and B*) to be assessed for their ability to compete with/block each other are mixed at a one to one molar ratio of binding sites in a suitable buffer to create a test mixture.
  • concentrations on a binding site basis the molecular weight of an ALK7-binding protein is assumed to be the total molecular weight of the ALK7-binding protein divided by the number of ALK7- binding sites on that ALK7-binding protein.
  • each ALK7-binding protein i.e., A* and B*
  • the concentration of each ALK7-binding protein (i.e., A* and B*) in the test mixture should be high enough to readily saturate the binding sites for that ALK7-binding protein on the ALK7-Fc molecules captured on the BIACORE® chip.
  • the A* and B* ALK7-binding proteins in the mixture are at the same molar concentration (on a binding basis) and that concentration would typically be between 1.00 and 1.5 micromolar (on a binding site basis).
  • Separate solutions containing ALK7-binding protein A* alone and ALK7-binding protein B* alone are also prepared.
  • ALK7-binding protein A* and ALK7-binding protein B* in these solutions should be in the same buffer and at the same concentration as in the test mixture.
  • the test mixture is passed over the ALK7-Fc-coated BIACORE® chip and the total amount of binding recorded.
  • the chip is then treated in such a way as to remove the bound ALK7-binding proteins without damaging the chip-bound ALK7-Fc. Typically, this is done by treating the chip with 30 mM HC1 for 60 seconds.
  • the solution of ALK7-binding protein A* alone is then passed over the ALK7-Fc-coated surface and the amount of binding recorded.
  • the chip is again treated to remove the bound antibody without damaging the chip-bound ALK7-Fc.
  • the solution of ALK7-binding protein B* alone is then passed over the ALK7-Fc-coated surface and the amount of binding recorded.
  • the maximum theoretical binding of the mixture of ALK7-binding protein A* and ALK7-binding protein B* is next calculated, and is the sum of the binding of each ALK7-binding protein when passed over the ALK7 surface alone. If the actual recorded binding of the mixture is less than this theoretical maximum then the two ALK7-binding proteins are competing with/blocking each other.
  • a blocking ALK7-binding protein is one which will bind to ALK7 in the above BIACORE® blocking assay such that during the assay and in the presence of a second ALK7-binding protein the recorded binding is between 80% and 0.1% (e.g., 80% > to 4%) of the maximum theoretical binding, specifically between 75% and 0.1 % (e.g., 75% to 4%) of the maximum theoretical binding, and more specifically between 70% and 0.1% (e.g., 70% to 4%) of maximum theoretical binding (as defined above) of the two ALK7-binding proteins in combination.
  • the BIACORE® assay described above is an exemplary assay used to determine if two ALK7-binding proteins such as anti-ALK7 antibodies compete with/block each other for binding ALK7.
  • ALK7-binding proteins such as anti-ALK7 antibodies compete with/block each other for binding ALK7.
  • particular ALK7-binding proteins may not bind to ALK7-FC coupled via anti-Fc IgG to a CM5 BIACORE® chip (this might occur when the relevant binding site on ALK7 is masked or destroyed by ALK7 linkage to Fc).
  • blocking can be determined using a tagged version of ALK7, for example C-terminal His-tagged ALK7.
  • an anti-His antibody would be coupled to the BIACORE® chip and then the His-tagged ALK7 would be passed over the surface of the chip and captured by the anti-His antibody.
  • the cross-blocking analysis would be carried out essentially as described above, except that after each chip regeneration cycle, new His-tagged ALK7 would be loaded back onto the surface coated with anti-His antibody.
  • various other known tags and tag binding protein combinations can be used for such a blocking analysis (e.g., HA tag with anti-HA antibodies; FLAG tag with anti-FLAG antibodies; biotin tag with streptavidin).
  • the following generally describes an ELISA assay for determining whether an ALK7-binding protein blocks or is capable of blocking the binding of a reference ALK7-binding protein to ALK7.
  • an ELISA is used to determine the ability of an ALK7- binding protein (e.g., an anti-ALK7 antibody) to compete for binding to ALK7 with a reference ALK7-binding protein (e.g., an anti-ALK7 antibody or ALK7 ligand).
  • ALK7-binding protein e.g., an anti-ALK7 antibody
  • the general principle of such an assay is to have a reference ALK7-binding protein (e.g., an anti-ALK7 antibody) coated onto the wells of an ELISA plate. An excess amount of a second potentially blocking, test ALK7-binding protein is added in solution (i.e., not bound to the ELISA plate). A limited amount of ALK7 (or alternatively ALK7-Fc) is then added to the wells.
  • the coated reference ALK7-binding protein and the test ALK7- binding protein in solution compete for binding of the limited number of ALK7 (or ALK7-Fc) molecules.
  • the plate is washed to remove ALK7 that has not been bound by the coated reference ALK7-binding protein and to also remove the test, solution-phase ALK7-binding protein as well as any complexes formed between the test, solution-phase ALK7-binding protein and ALK7.
  • the amount of bound ALK7 is then measured using an appropriate ALK7 detection reagent.
  • a test ALK7-binding protein in solution that is able to block binding of the coated reference ALK7-binding protein to ALK7 will be able to cause a decrease in the number of ALK7 molecules that the coated reference ALK7- binding protein can bind relative to the number of ALK7 molecules that the coated reference ALK7-binding protein can bind in the absence of the second, solution-phase test ALK7-binding protein.
  • the background signal for the assay is defined as the signal obtained in wells with the coated reference ALK7-binding protein, solution-phase test ALK7-binding protein, ALK7 buffer only (i.e., no ALK7) and ALK7 detection reagents.
  • the positive control signal for the assay is defined as the signal obtained in wells with the coated reference ALK7-binding protein, solution-phase test ALK7-binding protein buffer only (i.e., no solution-phase test ALK7-binding protein), ALK7 and an ActRII receptor (e.g., ActRIIA or ActRIIB) detection reagents.
  • the ELISA assay is be run in such a manner so as to have the positive control signal at least 3 times the background signal.
  • the cross-blocking assay may be run in the format just described and also reversed, with the test ALK7-binding protein as the coated antibody and the reference ALK7-binding protein as the solution-phase antibody.
  • the ALK7-binding protein binds ALK7 with an affinity that is at least, 100, 500, or 1000 times greater than the affinity of the ALK7-binding protein for a control protein that is not a TGF-beta receptor family member. In additional embodiments, the ALK7-binding protein binds ALK7 with an affinity that is at least, 100, 500, or 1000 times greater than the affinity of the ALK7-binding protein for a control protein that is not a TGF-beta receptor family member.
  • the ALK7-binding protein binds ALK7 and has a dissociation constant (K D ) of ⁇ 1 ⁇ , ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM, ⁇ 0.1 nM, ⁇ 10 pM, ⁇ 1 pM, or ⁇ 0.1 pM.
  • the ALK7-binding protein has a KD for human ALK7 within the range of ⁇ 1 ⁇ and >0.1 pM, ⁇ 100 ⁇ and > 0.1 pM, or ⁇ 100 ⁇ and >1 pM.
  • a cell-based lipolysis inhibition assay is used to determine the ability of an ALK7-binding protein (e.g., an antagonist anti-ALK7 antibody) to reduce (inhibit) ALK7-mediated inhibition of lipolysis in mammalian white adipoctyes.
  • the lipolysis inhibition assay is performed using mature whit adipocytes (e.g., human, mouse, or rat) to determine the ability of an ALK7-binding protein (e.g., an anti-ALK7 antibody) to reduce ALK7 activity. Kits, reagents and methods for conducting a lipolysis assay are commercially available and known in the art.
  • the lipolysis inhibition assay is performed as provided in the Examples herein.
  • the assay is performed according to the instructions and reagents as provided in a commercially available lipolysis assay kit (e.g., BioAssay Systems, EnzyChromTM Adipolysis Assay Kit, Cat. No. EAPL-200; Abeam Cat. No. abl85433; Zen-Bio, Cat. No. LIP-l-NCLl; BioVision, Cat. No. K577-100; Sigma- Aldrich, Cat. No. MAK211; and AdipoLyzeTM Lipolysis Detection Assay, Lonza, Cat. No. 193339).
  • a commercially available lipolysis assay kit e.g., BioAssay Systems, EnzyChromTM Adipolysis Assay Kit, Cat. No. EAPL-200; Abeam Cat. No. abl85433; Zen-Bio, Cat. No. LIP-l-NCLl; BioVision, Cat. No. K
  • the ALK7-binding protein, an ALK7-binding protein is an ALK7-binding protein
  • ALK7 antagonist and increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a mature white adipose cell by 5% to 100%>, 10%> 95%, 10 to 90%, 10 to 85%, 10 to 80%, 10 to 75%, 10 to 70%, 10 to 65%, 10 to 60%, 10 to 55%, 10 to 50%), or 10 to 45%), as determined using standard techniques and conditions in a lipolysis inhibition assay performed in the presence of activin B (50 ng/ml) (e.g., as described in the examples herein).
  • an ALK7-binding protein increases lipolysis by 5% to 100%, 10% to 80%>, or 10%> to 60%>.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%), 10% to 80%), or 10%) to 60%). In some embodiments, the ALK7-binding protein increase lipolysis in a mature white adipose cell by at least 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%), 90%), or 95%), or by about 100%), as determined, using standard techniques and conditions in a lipolysis inhibition assay performed in the presence of activin B (50 ng/ml) (e.g., as described in the examples herein).
  • activin B 50 ng/ml
  • Pharmacodynamic parameters dependent on ALK7 signaling can be measured as endpoints for in vivo testing of ALK7-binding proteins in order to identify those binding proteins that are able to neutralize ALK7 and provide a therapeutic benefit.
  • An ALK7 neutralizing binding agent is defined as one capable of causing a statistically significant change, as compared to vehicle-treated animals, in such a pharmacodynamic parameter.
  • Such in vivo testing can be performed in any suitable mammal (e.g., mouse, rat, or monkey
  • an ALK7-binding protein is an antibody that specifically binds ALK7.
  • the ALK7-binding protein is a full-length anti- ALK7 antibody.
  • the antibody is a monoclonal antibody, a recombinant antibody, a human antibody, a humanized antibody, a chimeric antibody, a bi-specific antibody, a multi-specific antibody, or an ALK7-binding antibody fragment thereof.
  • the anti-ALK7 antibody is an ALK7-binding antibody fragment.
  • the ALK7-binding antibody fragment is a: Fab, Fab', F(ab') 2 , Fv fragment, diabody, or single chain antibody molecule.
  • the ALK7-antibody is a Fd, single chain Fv(scFv), disulfide linked Fv, V- NAR domain, IgNar, intrabody, IgGACH2, minibody, F(ab') 3 tetrabody, triabody, diabody, single-domain antibody, DVD-Ig, Fcab, mAb 2 , (scFv) 2 , scFv-Fc or bis-scFv.
  • the ALK7-binding protein is an antibody that includes a VH and a VL.
  • the anti-ALK7 antibody further includes a heavy chain constant region or fragment thereof.
  • the antibody comprises a heavy chain immunoglobulin constant region selected from the group consisting of: (a) a human IgA constant region, or fragment thereof; (b) a human IgD constant region, or fragment thereof; (c) a human IgE constant domain, or fragment thereof; (d) a human IgGl constant region, or fragment thereof; (e) a human IgG2 constant region, or fragment thereof; (f) a human IgG3 constant region, or fragment thereof; (g) a human IgG4 constant region, or fragment thereof; and (h) a human IgM constant region, or fragment thereof.
  • an ALK7-binding protein comprises a heavy chain constant region or fragment thereof, e.g., a human IgG constant region or fragment thereof.
  • the ALK7-binding protein comprises a heavy chain immunoglobulin constant domain that has, or has been mutated to have altered effector function and/or half-life.
  • the ALK7-binding protein is an antibody that comprises an IgGl heavy chain constant region containing a mutation that decreases effector function (see, e.g., Idusogie et al, J. Immunol. 166:2571-2575 (2001); Sazinsky et al, PNAS USA 105:20167-20172 (2008); Davis et al, J. Rheumatol. 34:2204-2210 (2007); Bolt et al., Eur. J. Immunol. 23 :403-411 (1993); Alegre et al., Transplantation 57: 1537-1543 (1994); Xu et al, Cell Immunol.
  • the heavy chain constant region or fragment thereof includes one or more amino acid substitutions relative to a wild-type IgG constant domain wherein the modified IgG has decreased ADCC compared to the half-life of an IgG having the wild-type IgG constant domain.
  • Fc sequence engineering modifications contained in the provided antibodies that decrease ADCC include one or more modifications corresponding to: IgGl-K326W, E333S; IgG2-E333S; IgGl-N297A; IgGl-L234A, L235A; IgG2-V234A, G237A; IgG4-L235A, G237A, E318A; IgG4- S228P, L236E; IgG2-EU sequence 118-260; IgG4-EU sequence 261-447; IgG2-H268Q, V309L, A330S, A331 S; IgGl-C220S, C226S, C229S, P238S; IgGl-C226S, C229S, E233P, L234V, L235A; and IgGl-L234F, L235E, P331 S, wherein the position numbering is according to the EU index as in Kabat.
  • an ALK7-binding protein comprises a heavy chain immunoglobulin constant domain that has, or has been mutated to have, reduced CDC activity.
  • the ALK7-binding protein is an antibody that comprises an IgGl heavy chain constant region containing a mutation that decreases CDC activity (see, e.g., W097/11971 and WO07/106585; U.S. Appl. Publ. 2007/0148167A1; McEarchern et al, Blood 109: 1185-1192 (2007); Hayden-Ledbetter et al, Clin.
  • Fc sequence engineering modifications contained in an anti-ALK7 antibody that decrease CDC include one or more modifications corresponding to: IgGl-S239D, A330L, I332E; IgG2 EU sequence 118-260; IgG4-EU sequence 261-447; IgG2-H268Q, V309L, A330S, A331 S; IgGl- C226S, C229S, E233P, L234V, L235A; IgGl-L234F, L235E, P331 S; and IgGl- C226S, P230S.
  • the heavy chain constant region or fragment thereof includes one or more amino acid substitutions relative to a wild-type IgG constant domain wherein the modified IgG has an increased half-life compared to the half-life of an IgG having the wild-type IgG constant domain.
  • the IgG constant domain can contain one or more amino acid substitutions of amino acid residues at positions 251-257, 285-290, 308-314, 385-389, and 428-436, wherein the amino acid position numbering is according to the EU index as set forth in Kabat.
  • the IgG constant domain can contain one or more of a substitution of the amino acid at Kabat position 252 with Tyr, Phe, Trp, or Thr; a substitution of the amino acid at Kabat position 254 with Thr; a substitution of the amino acid at Kabat position 256 with Ser, Arg, Gin, Glu, Asp, or Thr; a substitution of the amino acid at Kabat position 257 with Leu; a substitution of the amino acid at Kabat position 309 with Pro; a substitution of the amino acid at Kabat position 311 with Ser; a substitution of the amino acid at Kabat position 428 with Thr, Leu, Phe, or Ser; a substitution of the amino acid at Kabat position 433 with Arg, Ser, Iso, Pro, or Gin; or a substitution of the amino acid at Kabat position 434 with Trp, Met, Ser, His, Phe, or Tyr.
  • the IgG constant domain can contain amino acid substitutions relative to a wild-type human IgG constant domain including a substitution of the amino acid at Kabat position 252 with Tyr, a substitution of the amino acid at Kabat position 254 with Thr, and a substitution of the amino acid at Kabat position 256 with Glu.
  • the ALK7-binding protein is an antibody that comprises a light chain immunoglobulin constant region.
  • the antibody comprises a human Ig kappa constant region or a human Ig lambda constant region.
  • the ALK7-binding protein comprises a set of CDRs: VH-
  • the ALK7-binding protein comprises a set of CDRs wherein the CDRs are present in a VH and a VL pair selected from the group consisting of: (a) a VH sequence of SEQ ID NO:4, and a VL sequence of SEQ ID NO: 13; (b) a VH sequence of SEQ ID NO:22, and a VL sequence of SEQ ID NO: 31; (c) a VH sequence of SEQ ID NO: 40, and a VL sequence of SEQ ID NO:49; and (d) a VH sequence of SEQ ID NO:58 and a VL sequence of SEQ ID NO:67; and wherein the protein binds ALK7.
  • the ALK7-binding protein comprises a set of CDRs: VH-
  • the ALK7-binding protein comprises a set of CDRs wherein the CDRs are present in a VH and a VL pair selected from the group consisting of: (a) a VH sequence of SEQ ID NO: 152, and a VL sequence of SEQ ID NO:98; (b) a VH sequence of SEQ ID NO: 159, and a VL sequence of SEQ ID NO: 110; and (c) a VH sequence of SEQ ID NO: 165, and a VL sequence of SEQ ID NO: 171; and wherein the protein binds ALK7.
  • the ALK7-binding protein comprises a set of CDRs: VH-
  • the ALK7-binding protein comprises a set of CDRs wherein the CDRs are present in a VH and a VL pair selected from the group consisting of: (a) a VH sequence of SEQ ID NO:91, and a VL sequence of SEQ ID NO:98; (b) a VH sequence of SEQ ID NO: 105, and a VL sequence of SEQ ID NO: 110; (c) a VH sequence of SEQ ID NO: 117, and a VL sequence of SEQ ID NO: 124; (d) a VH sequence of SEQ ID NO: 128 and a VL sequence of SEQ ID NO: 135; and (d) a VH sequence of SEQ ID NO: 140 and a VL sequence of SEQ ID NO:
  • an ALK7-binding protein comprises a set of CDRs: (a) VH-
  • the ALK7- binding protein comprises a set of CDRs, wherein the set of CDRs is identical to, or has a total of one, two, three, four, five, six, seven, eight, nine, ten, or fewer than ten, amino acid substitutions, deletions, and/or insertions from a reference set of CDRs in a VH or VL sequence disclosed in Table 1 A.
  • an ALK7-binding protein comprises a set of CDRs: (a) VH-
  • the ALK7- binding protein comprises a set of CDRs, wherein the set of CDRs is identical to, or has a total of one, two, three, four, five, six, seven, eight, nine, ten, or fewer than ten, amino acid substitutions, deletions, and/or insertions from a reference set of CDRs in a VH or VL sequence disclosed in Table IB.
  • an ALK7-binding protein comprises a set of CDRs: VH-
  • the ALK7-binding protein comprises a set of CDRs, wherein the set of CDRs is identical to, or has a total of one, two, three, four, five, six, seven, eight, nine, ten, or fewer than ten, amino acid substitutions, deletions, and/or insertions from a reference set of CDRs in a VH and VL sequence pair disclosed in Table 3.
  • the ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VH-CDR1, VH-CDR2, VH-CDR3, VL-CDRl, VL-CDR2, and VL-CDR3, wherein the set of CDRs is identical to, or has a total of one, two, three, four, five, six, seven, eight, nine, ten, or fewer than ten, amino acid substitutions, deletions, and/or insertions from a reference set of CDRs in which: (a)(i) VH-CDRl comprises the amino acid sequence of SEQ ID NO: l; (ii) VH-CDR2 comprises the amino acid sequence of SEQ ID NO:2; (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO:3; (iv) VL-CDRl comprises the amino acid sequence of SEQ ID NO: 10; (v) VL-CDR2 comprises the amino acid sequence of
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF- beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the type II receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody). In further embodiments, the ALK7-binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%. In some embodiments, the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%), or 10%) to 60%). In some embodiments, the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%), or 10%) to 60%).
  • adipocyte cells e.g., white adipocytes
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7- binding protein has 2, 3, or 4 of the above characteristics.
  • the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VH-CDR1, VH-CDR2, VH-CDR3, VL-CDRl, VL-CDR2, and VL-CDR3, wherein the set of CDRs is identical to, or has a total of one, two, three, four, five, six, seven, eight, nine, ten, or fewer than ten, amino acid substitutions, deletions, and/or insertions from a reference set of CDRs in which: (a)(i) VH-CDR1 comprises the amino acid sequence of SEQ ID NO:37; (ii) VH-CDR2 comprises the amino acid sequence of SEQ ID NO:56; (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO:90; (iv) VL-CDR1 comprises the amino acid sequence of SEQ ID NO:95; (v) VL-CDR2 comprises the amino acid sequence of SEQ ID NO:
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the type II receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDFl, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody). In further embodiments, the ALK7-binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%. In some embodiments, the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%. In some embodiments, the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%), 10%) to 80%), or 10% to 60%.
  • adipocyte cells e.g., white adipocytes
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VH-CDR1, VH-CDR2, VH-CDR3, VL-CDRl, VL-CDR2, and VL-CDR3, wherein the set of CDRs is identical to, or has a total of one, two, three, four, five, six, seven, eight, nine, ten, or fewer than ten, amino acid substitutions, deletions, and/or insertions from a reference set of CDRs in which: (a)(i) VH-CDR1 comprises the amino acid sequence of SEQ ID NO:88; (ii) VH-CDR2 comprises the amino acid sequence of SEQ ID NO:89; (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO:90; (iv) VL-CDRl comprises the amino acid sequence of SEQ ID NO:95; (v) VL-CDR2 comprises the amino acid sequence of SEQ ID NO:
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the type II receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDFl, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody). In further embodiments, the ALK7-binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%. In some embodiments, the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%. In some embodiments, the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%), 10%) to 80%), or 10%> to 60%>.
  • adipocyte cells e.g., white adipocytes
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VH-CDR1, VH-CDR2, VH-CDR3, VL-CDRl, VL-CDR2, and VL-CDR3, wherein: (a)(i) VH-CDR1 comprises the amino acid sequence of SEQ ID NO: l ; (ii) VH-CDR2 comprises the amino acid sequence of SEQ ID NO:2; (iii) VH- CDR3 comprises the amino acid sequence of SEQ ID NO:3; (iv) VL-CDRl comprises the amino acid sequence of SEQ ID NO: 10; (v) VL-CDR2 comprises the amino acid sequence of SEQ ID NO: 1 1 ; and (vi) VL-CDR3 comprises the amino acid sequence of SEQ ID NO: 12; (b)(i) VH-CDR1 comprises the amino acid sequence of SEQ ID NO: 19; (ii) VH-CDR2 comprises the amino acid sequence
  • the ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VH-CDR1, VH-CDR2, VH-CDR3, VL-CDRl, VL-CDR2, and VL-CDR3, wherein: (a)(i) VH-CDR1 comprises the amino acid sequence of SEQ ID NO:37; (ii) VH-CDR2 comprises the amino acid sequence of SEQ ID NO:56; (iii) VH- CDR3 comprises the amino acid sequence of SEQ ID NO:90; (iv) VL-CDRl comprises the amino acid sequence of SEQ ID NO:95; (v) VL-CDR2 comprises the amino acid sequence of SEQ ID NO: 96; and (vi) VL-CDR3 comprises the amino acid sequence of SEQ ID NO:97; (b)(i) VH-CDR1 comprises the amino acid sequence of SEQ ID NO: 156; (ii) VH-CDR2 comprises the amino
  • the ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VH-CDR1, VH-CDR2, VH-CDR3, VL-CDRl, VL-CDR2, and VL-CDR3, wherein: (a)(i) VH-CDR1 comprises the amino acid sequence of SEQ ID NO:88; (ii) VH-CDR2 comprises the amino acid sequence of SEQ ID NO:89; (iii) VH- CDR3 comprises the amino acid sequence of SEQ ID NO:90; (iv) VL-CDRl comprises the amino acid sequence of SEQ ID NO:95; (v) VL-CDR2 comprises the amino acid sequence of SEQ ID NO: 96; and (vi) VL-CDR3 comprises the amino acid sequence of SEQ ID NO:97; (b)(i) VH-CDR1 comprises the amino acid sequence of SEQ ID NO: 102; (ii) VH-CDR2 comprises the amino
  • the ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs that has a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than ten, or zero, amino acid substitutions, deletions, and/or insertions from a reference set of CDRs in which: (a)(i) VH-CDR1 comprises the amino acid sequence of SEQ ID NO: l ; (ii) VH-CDR2 comprises the amino acid sequence of SEQ ID NO:2; (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO:3; (iv) VL- CDR1 comprises the amino acid sequence of SEQ ID NO: 10; (v) VL-CDR2 comprises the amino acid sequence of SEQ ID NO: 1 1 ; and (vi) VL-CDR3 comprises the amino acid sequence of SEQ ID NO: 12; and wherein the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and activin B on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with ActRIIA or ActRIIB) for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and an ActRII receptor (e.g., ActRIIA or ActRIIB) in the presence of GDF 1, GDF3, GDF8, activin B, activin A/B, and/
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti- ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%).
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs that has a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than ten, or zero, amino acid substitutions, deletions, and/or insertions from a reference set of CDRs in which:(i) VH-CDR1 comprises the amino acid sequence of SEQ ID NO: 19; (ii) VH-CDR2 comprises the amino acid sequence of SEQ ID NO:20; (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO:21 ; (iv) VL-CDRl comprises the amino acid sequence of SEQ ID NO:28; (v) VL-CDR2 comprises the amino acid sequence of SEQ ID NO:29; and (vi) VL-CDR3 comprises the amino acid sequence of SEQ ID NO:30; and wherein the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a A type II receptor (e.g., ActRIIA or ActRIIB), and activin B on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and an ActRII receptor (e.g., ActRIIA or ActRIIB) in the presence of GDF 1, GDF3, GDF8, activin B, activin A/B, and/or No
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs that has a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than ten, or zero, amino acid substitutions, deletions, and/or insertions from a reference set of CDRs in which: (i) VH-CDRl comprises the amino acid sequence of SEQ ID NO:37; (ii) VH-CDR2 comprises the amino acid sequence of SEQ ID NO:38; (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO:39; (iv) VL-CDR1 comprises the amino acid sequence of SEQ ID NO:46; (v) VL-CDR2 comprises the amino acid sequence of SEQ ID NO:47; and (vi) VL-CDR3 comprises the amino acid sequence of SEQ ID NO:48; and wherein the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and an ActRII receptor (
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs that has a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than ten, or zero, amino acid substitutions, deletions, and/or insertions from a reference set of CDRs in which: (i) VH-CDRl comprises the amino acid sequence of SEQ ID NO:55; (ii) VH-CDR2 comprises the amino acid sequence of SEQ ID NO:56; (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO: 57; (iv) VL-CDRl comprises the amino acid sequence of SEQ ID NO:64; (v) VL-CDR2 comprises the amino acid sequence of SEQ ID NO:65; and (vi) VL-CDR3 comprises the amino acid sequence of SEQ ID NO:66; and wherein the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and an ActRIIA or
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs that has a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than ten, or zero, amino acid substitutions, deletions, and/or insertions from a reference set of CDRs in which: (a)(i) VH-CDR1 comprises the amino acid sequence of SEQ ID NO:88; (ii) VH-CDR2 comprises the amino acid sequence of SEQ ID N089; (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO:90; (iv) VL- CDR1 comprises the amino acid sequence of SEQ ID NO:95; (v) VL-CDR2 comprises the amino acid sequence of SEQ ID NO:96; and (vi) VL-CDR3 comprises the amino acid sequence of SEQ ID NO:97; and wherein the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and activin B on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with ActRIIA or ActRIIB) for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and an ActRII receptor (e.g., ActRIIA or ActRIIB) in the presence of GDF 1, GDF3, GDF8, activin B, activin A/B, and/
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti- ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs that has a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than ten, or zero, amino acid substitutions, deletions, and/or insertions from a reference set of CDRs in which:(i) VH-CDR1 comprises the amino acid sequence of SEQ ID NO: 102; (ii) VH-CDR2 comprises the amino acid sequence of SEQ ID NO: 103; (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO: 104; (iv) VL- CDR1 comprises the amino acid sequence of SEQ ID NO: 107; (v) VL-CDR2 comprises the amino acid sequence of SEQ ID NO: 108; and (vi) VL-CDR3 comprises the amino acid sequence of SEQ ID NO: 109; and wherein the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a A type II receptor (e.g., ActRIIA or ActRIIB), and activin B on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and an ActRII receptor (e.g., ActRIIA or ActRIIB) in the presence of GDF 1, GDF3, GDF8, activin B, activin A/B, and/or No
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs that has a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than ten, or zero, amino acid substitutions, deletions, and/or insertions from a reference set of CDRs in which: (i) VH-CDR1 comprises the amino acid sequence of SEQ ID NO: 1 14; (ii) VH-CDR2 comprises the amino acid sequence of SEQ ID NO: 1 15; (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO: 1 16; (iv) VL- CDR1 comprises the amino acid sequence of SEQ ID NO: 121 ; (v) VL-CDR2 comprises the amino acid sequence of SEQ ID NO: 122; and (vi) VL-CDR3 comprises the amino acid sequence of SEQ ID NO: 123; and wherein the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and an ActRIIA or
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs that has a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than ten, or zero, amino acid substitutions, deletions, and/or insertions from a reference set of CDRs in which: (i) VH-CDRl comprises the amino acid sequence of SEQ ID NO: 125; (ii) VH-CDR2 comprises the amino acid sequence of SEQ ID NO: 126; (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO: 127; (iv) VL- CDR1 comprises the amino acid sequence of SEQ ID NO: 132; (v) VL-CDR2 comprises the amino acid sequence of SEQ ID NO: 133; and (vi) VL-CDR3 comprises the amino acid sequence of SEQ ID NO: 134; and wherein the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and an ActRII receptor (
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs that has a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than ten, or zero, amino acid substitutions, deletions, and/or insertions from a reference set of CDRs in which: (i) VH-CDR1 comprises the amino acid sequence of SEQ ID NO: 137; (ii) VH-CDR2 comprises the amino acid sequence of SEQ ID NO: 138; (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO: 139; (iv) VL- CDR1 comprises the amino acid sequence of SEQ ID NO: 145; (v) VL-CDR2 comprises the amino acid sequence of SEQ ID NO: 146; and (vi) VL-CDR3 comprises the amino acid sequence of SEQ ID NO: 147; and wherein the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and an ActRII receptor (
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VH-CDRl, VH-CDR2, and VH-CDR3, wherein the set of CDRs is identical to, or has a total of one, two, three, four, five, six, seven, eight, nine, ten, or fewer than ten, amino acid substitutions, deletions, and/or insertions from a reference set of CDRs in which: (i) VH-CDRl comprises the amino acid sequence of SEQ ID NO:37; (ii) VH-CDR2 comprises the amino acid sequence of SEQ ID NO:38; and (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO:39 or 57; and the protein binds ALK7.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VH-CDR1, VH-CDR2, and VH-CDR3, wherein: (i) VH-CDRl comprises the amino acid sequence of SEQ ID NO:37; (ii) VH- CDR2 comprises the amino acid sequence of SEQ ID NO: 38; and (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO:39; and the protein binds ALK7.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VH-CDRl, VH-CDR2, and VH-CDR3, wherein the set of CDRs is identical to, or has a total of one, two, three, four, five, six, seven, eight, nine, ten, or fewer than ten, amino acid substitutions, deletions, and/or insertions from a reference set of CDRs in which: (i) VH-CDRl comprises the amino acid sequence of SEQ ID NO:37; (ii) VH- CDRl comprises the amino acid sequence of SEQ ID NO: 38; and (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO:39; and the protein binds ALK7.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VH-CDRl, VH-CDR2, and VH-CDR3, wherein the set of CDRs is identical to, or has a total of one, two, three, four, five, six, seven, eight, nine, ten, or fewer than ten, amino acid substitutions, deletions, and/or insertions from a reference set of CDRs in which: (i) VH-CDRl comprises the amino acid sequence of SEQ ID NO:37; (ii) VH- CDRl comprises the amino acid sequence of SEQ ID NO: 38; and (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO:57; and the protein binds ALK7.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VH-CDRl , VH-CDR2, and VH-CDR3, wherein: (i) VH-CDRl comprises the amino acid sequence of SEQ ID NO:37; (ii) VH-CDR2 comprises the amino acid sequence of SEQ ID NO:38; and (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO:57; and the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and an ActRII receptor (
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti- ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%).
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VH-CDRl, VH-CDR2, and VH-CDR3, wherein the set of CDRs is identical to, or has a total of one, two, three, four, five, six, seven, eight, nine, ten, or fewer than ten, amino acid substitutions, deletions, and/or insertions from a reference set of CDRs in which: (i) VH-CDRl comprises the amino acid sequence of SEQ ID NO: l ; (ii) VH-CDR2 comprises the amino acid sequence of SEQ ID NO:2; and (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO:3; and the protein binds ALK7.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VH-CDRl, VH-CDR2, and VH-CDR3, wherein: (i) VH- CDRl comprises the amino acid sequence of SEQ ID NO: l ; (ii) VH-CDR2 comprises the amino acid sequence of SEQ ID NO:2; and (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO:3; and the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and an ActRII receptor (
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti- ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%).
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VH-CDRl, VH-CDR2, and VH-CDR3, wherein the set of CDRs is identical to, or has a total of one, two, three, four, five, six, seven, eight, nine, ten, or fewer than ten, amino acid substitutions, deletions, and/or insertions from a reference set of CDRs in which: (i) VH-CDRl comprises the amino acid sequence of SEQ ID NO: 19; (ii) VH-CDR2 comprises the amino acid sequence of SEQ ID NO:20; and (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO:21 ; and the protein binds ALK7.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VH-CDR1, VH-CDR2, and VH-CDR3, wherein: (i) VH-CDR1 comprises the amino acid sequence of SEQ ID NO: 19; (ii) VH-CDR2 comprises the amino acid sequence of SEQ ID NO:20; and (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO:21 ; and the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and an ActRIIA or
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VH-CDRl, VH-CDR2, and VH-CDR3, wherein the set of CDRs is identical to, or has a total of one, two, three, four, five, six, seven, eight, nine, ten, or fewer than ten, amino acid substitutions, deletions, and/or insertions from a reference set of CDRs in which: (i) VH-CDRl comprises the amino acid sequence of SEQ ID NO:37; (ii) VH-CDR2 comprises the amino acid sequence of SEQ ID NO:38; and (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO:39; and the protein binds ALK7.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VH-CDRl, VH-CDR2, and VH-CDR3, wherein (i) VH-CDRl comprises the amino acid sequence of SEQ ID NO:37; (ii) VH- CDRl comprises the amino acid sequence of SEQ ID NO:38; and (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO:39; and the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF- beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and an ActRII
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VH-CDRl, VH-CDR2, and VH-CDR3, wherein the set of CDRs is identical to, or has a total of one, two, three, four, five, six, seven, eight, nine, ten, or fewer than ten, amino acid substitutions, deletions, and/or insertions from a reference set of CDRs in which: (i) VH-CDRl comprises the amino acid sequence of SEQ ID NO:55; (ii) VH-CDR2 comprises the amino acid sequence of SEQ ID NO:56; and (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO:57; and the protein binds ALK7.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VH-CDRl, VH-CDR2, and VH-CDR3, wherein (i) VH-CDRl comprises the amino acid sequence of SEQ ID NO:55; (ii) VH- CDR2 comprises the amino acid sequence of SEQ ID NO:56; and (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO:57; and the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF- beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and an ActRII
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VH-CDRl, VH-CDR2, and VH-CDR3, wherein the set of CDRs is identical to, or has a total of one, two, three, four, five, six, seven, eight, nine, ten, or fewer than ten, amino acid substitutions, deletions, and/or insertions from a reference set of CDRs in which: (i) VH-CDRl comprises the amino acid sequence of SEQ ID NO:88; (ii) VH-CDR2 comprises the amino acid sequence of SEQ ID NO:89; and (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO:90; and the protein binds ALK7.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VH-CDRl, VH-CDR2, and VH-CDR3, wherein: (i) VH-CDRl comprises the amino acid sequence of SEQ ID NO:88; (ii) VH-CDR2 comprises the amino acid sequence of SEQ ID NO:89; and (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO:90; and the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and an ActRII receptor (
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VH-CDRl, VH-CDR2, and VH-CDR3, wherein the set of CDRs is identical to, or has a total of one, two, three, four, five, six, seven, eight, nine, ten, or fewer than ten, amino acid substitutions, deletions, and/or insertions from a reference set of CDRs in which: (i) VH-CDRl comprises the amino acid sequence of SEQ ID NO: 102; (ii) VH-CDR2 comprises the amino acid sequence of SEQ ID NO: 103; and (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO: 104; and the protein binds ALK7.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VH-CDR1, VH-CDR2, and VH-CDR3, wherein: (i) VH-CDR1 comprises the amino acid sequence of SEQ ID NO: 102; (ii) VH-CDR2 comprises the amino acid sequence of SEQ ID NO: 103; and (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO: 104; and the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and an ActRIIA or
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VH-CDRl, VH-CDR2, and VH-CDR3, wherein the set of CDRs is identical to, or has a total of one, two, three, four, five, six, seven, eight, nine, ten, or fewer than ten, amino acid substitutions, deletions, and/or insertions from a reference set of CDRs in which: (i) VH-CDRl comprises the amino acid sequence of SEQ ID NO: 1 14; (ii) VH-CDR2 comprises the amino acid sequence of SEQ ID NO: 1 15; and (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO: 1 16; and the protein binds ALK7.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VH-CDRl, VH-CDR2, and VH-CDR3, wherein (i) VH-CDRl comprises the amino acid sequence of SEQ ID NO: 1 14; (ii) VH- CDRl comprises the amino acid sequence of SEQ ID NO: 1 15; and (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO: 1 16; and the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF- beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and an ActRII
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VH-CDRl, VH-CDR2, and VH-CDR3, wherein the set of CDRs is identical to, or has a total of one, two, three, four, five, six, seven, eight, nine, ten, or fewer than ten, amino acid substitutions, deletions, and/or insertions from a reference set of CDRs in which: (i) VH-CDRl comprises the amino acid sequence of SEQ ID NO: 125; (ii) VH-CDR2 comprises the amino acid sequence of SEQ ID NO: 126; and (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO: 127; and the protein binds ALK7.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VH-CDRl, VH-CDR2, and VH-CDR3, wherein (i) VH-CDRl comprises the amino acid sequence of SEQ ID NO: 125; (ii) VH- CDR2 comprises the amino acid sequence of SEQ ID NO: 126; and (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO: 127; and the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF- beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and an ActRII
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VH-CDRl, VH-CDR2, and VH-CDR3, wherein the set of CDRs is identical to, or has a total of one, two, three, four, five, six, seven, eight, nine, ten, or fewer than ten, amino acid substitutions, deletions, and/or insertions from a reference set of CDRs in which: (i) VH-CDRl comprises the amino acid sequence of SEQ ID NO: 137; (ii) VH-CDR2 comprises the amino acid sequence of SEQ ID NO: 138; and (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO: 139; and the protein binds ALK7.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VH-CDRl, VH-CDR2, and VH-CDR3, wherein (i) VH-CDRl comprises the amino acid sequence of SEQ ID NO: 137; (ii) VH- CDR2 comprises the amino acid sequence of SEQ ID NO: 138; and (iii) VH-CDR3 comprises the amino acid sequence of SEQ ID NO: 139; and the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF- beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and an ActRII
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VL-CDRl, VL-CDR2, and VL-CDR3, wherein the set of CDRs is identical to, or has a total of one, two, three, four, five, six, seven, eight, nine, ten, or fewer than ten, amino acid substitutions, deletions, and/or insertions from a reference set of CDRs in which: (i) VL-CDRl comprises the amino acid sequence of SEQ ID NO: 10; (ii) VL-CDR2 comprises the amino acid sequence of SEQ ID NO: 1 1 ; and (iii) VL-CDR3 comprises the amino acid sequence of SEQ ID NO: 12; and wherein the protein binds ALK7.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VL-CDRl, VL-CDR2, and VL-CDR3, wherein: (i) VL-CDRl comprises the amino acid sequence of SEQ ID NO: 10; (ii) VL-CDR2 comprises the amino acid sequence of SEQ ID NO: 1 1 ; and (iii) VL-CDR3 comprises the amino acid sequence of SEQ ID NO: 12; and wherein the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VL-CDRl, VL-CDR2, and VL-CDR3, wherein the set of CDRs is identical to, or has a total of one, two, three, four, five, six, seven, eight, nine, ten, or fewer than ten, amino acid substitutions, deletions, and/or insertions from a reference set of CDRs in which: (i) VL-CDRl comprises the amino acid sequence of SEQ ID NO:28; (ii) VL-CDR2 comprises the amino acid sequence of SEQ ID NO:29; and (iii) VL-CDR3 comprises the amino acid sequence of SEQ ID NO:30; and wherein the protein binds ALK7.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VL-CDRl, VL-CDR2, and VL-CDR3, wherein: (i) VL-CDRl comprises the amino acid sequence of SEQ ID NO:28; (ii) VL-CDR2 comprises the amino acid sequence of SEQ ID NO:29; and (iii) VL-CDR3 comprises the amino acid sequence of SEQ ID NO:30; and wherein the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VL-CDRl, VL-CDR2, and VL-CDR3, wherein the set of CDRs is identical to, or has a total of one, two, three, four, five, six, seven, eight, nine, ten, or fewer than ten, amino acid substitutions, deletions, and/or insertions from a reference set of CDRs in which: (i) VL-CDRl comprises the amino acid sequence of SEQ ID NO:46; (ii) VL-CDR2 comprises the amino acid sequence of SEQ ID NO:47; and (iii) VL-CDR3 comprises the amino acid sequence of SEQ ID NO:48; and wherein the protein binds ALK7.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VL-CDRl, VL-CDR2, and VL-CDR3, wherein: (i) VL-CDRl comprises the amino acid sequence of SEQ ID NO:46; (ii) VL-CDR2 comprises the amino acid sequence of SEQ ID NO:47; and (iii) VL-CDR3 comprises the amino acid sequence of SEQ ID NO:48; and wherein the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VL-CDRl, VL-CDR2, and VL-CDR3, wherein the set of CDRs is identical to, or has a total of one, two, three, four, five, six, seven, eight, nine, ten, or fewer than ten, amino acid substitutions, deletions, and/or insertions from a reference set of CDRs in which: (i) VL-CDRl comprises the amino acid sequence of SEQ ID NO:64; (ii) VL-CDR2 comprises the amino acid sequence of SEQ ID NO:65; and (iii) VL-CDR3 comprises the amino acid sequence of SEQ ID NO:66; and wherein the protein binds ALK7.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VL-CDRl, VL-CDR2, and VL-CDR3, wherein: (i) VL-CDRl comprises the amino acid sequence of SEQ ID NO:64; (ii) VL-CDR2 comprises the amino acid sequence of SEQ ID NO:65; and (iii) VL-CDR3 comprises the amino acid sequence of SEQ ID NO:66; and wherein the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VL-CDRl, VL-CDR2, and VL-CDR3, wherein the set of CDRs is identical to, or has a total of one, two, three, four, five, six, seven, eight, nine, ten, or fewer than ten, amino acid substitutions, deletions, and/or insertions from a reference set of CDRs in which: (i) VL-CDRl comprises the amino acid sequence of SEQ ID NO:95; (ii) VL-CDR2 comprises the amino acid sequence of SEQ ID NO:96; and (iii) VL-CDR3 comprises the amino acid sequence of SEQ ID NO:97; and wherein the protein binds ALK7.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VL-CDRl, VL-CDR2, and VL-CDR3, wherein: (i) VL-CDRl comprises the amino acid sequence of SEQ ID NO:95; (ii) VL-CDR2 comprises the amino acid sequence of SEQ ID NO:96; and (iii) VL-CDR3 comprises the amino acid sequence of SEQ ID NO:97; and wherein the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VL-CDRl, VL-CDR2, and VL-CDR3, wherein the set of CDRs is identical to, or has a total of one, two, three, four, five, six, seven, eight, nine, ten, or fewer than ten, amino acid substitutions, deletions, and/or insertions from a reference set of CDRs in which: (i) VL-CDRl comprises the amino acid sequence of SEQ ID NO: 107; (ii) VL-CDR2 comprises the amino acid sequence of SEQ ID NO: 108; and (iii) VL- CDR3 comprises the amino acid sequence of SEQ ID NO: 109; and wherein the protein binds ALK7.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VL-CDRl, VL-CDR2, and VL-CDR3, wherein: (i) VL- CDRl comprises the amino acid sequence of SEQ ID NO: 107; (ii) VL-CDR2 comprises the amino acid sequence of SEQ ID NO: 108; and (iii) VL-CDR3 comprises the amino acid sequence of SEQ ID NO: 109; and wherein the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VL-CDRl, VL-CDR2, and VL-CDR3, wherein the set of CDRs is identical to, or has a total of one, two, three, four, five, six, seven, eight, nine, ten, or fewer than ten, amino acid substitutions, deletions, and/or insertions from a reference set of CDRs in which: (i) VL-CDRl comprises the amino acid sequence of SEQ ID NO: 121 ; (ii) VL-CDR2 comprises the amino acid sequence of SEQ ID NO: 122; and (iii) VL- CDR3 comprises the amino acid sequence of SEQ ID NO: 123; and wherein the protein binds ALK7.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VL-CDRl, VL-CDR2, and VL-CDR3, wherein: (i) VL- CDRl comprises the amino acid sequence of SEQ ID NO: 121 ; (ii) VL-CDR2 comprises the amino acid sequence of SEQ ID NO: 122; and (iii) VL-CDR3 comprises the amino acid sequence of SEQ ID NO: 123; and wherein the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VL-CDRl, VL-CDR2, and VL-CDR3, wherein the set of CDRs is identical to, or has a total of one, two, three, four, five, six, seven, eight, nine, ten, or fewer than ten, amino acid substitutions, deletions, and/or insertions from a reference set of CDRs in which: (i) VL-CDRl comprises the amino acid sequence of SEQ ID NO: 132; (ii) VL-CDR2 comprises the amino acid sequence of SEQ ID NO: 133; and (iii) VL- CDR3 comprises the amino acid sequence of SEQ ID NO: 134; and wherein the protein binds ALK7.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VL-CDRl, VL-CDR2, and VL-CDR3, wherein: (i) VL- CDRl comprises the amino acid sequence of SEQ ID NO: 132; (ii) VL-CDR2 comprises the amino acid sequence of SEQ ID NO: 133; and (iii) VL-CDR3 comprises the amino acid sequence of SEQ ID NO: 134; and wherein the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VL-CDRl, VL-CDR2, and VL-CDR3, wherein the set of CDRs is identical to, or has a total of one, two, three, four, five, six, seven, eight, nine, ten, or fewer than ten, amino acid substitutions, deletions, and/or insertions from a reference set of CDRs in which: (i) VL-CDRl comprises the amino acid sequence of SEQ ID NO: 145; (ii) VL-CDR2 comprises the amino acid sequence of SEQ ID NO: 146; and (iii) VL- CDR3 comprises the amino acid sequence of SEQ ID NO: 147; and wherein the protein binds ALK7.
  • an ALK7-binding protein specifically binds ALK7 and comprises a set of CDRs: VL-CDRl, VL-CDR2, and VL-CDR3, wherein: (i) VL- CDR1 comprises the amino acid sequence of SEQ ID NO: 145; (ii) VL-CDR2 comprises the amino acid sequence of SEQ ID NO: 146; and (iii) VL-CDR3 comprises the amino acid sequence of SEQ ID NO: 147; and wherein the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • an ALK7-binding protein comprises a VH-CDR3 or a VL-
  • the ALK7-binding protein comprises a VH-CDR3 or a VL-CDR3 sequence disclosed in Table 1A. In some embodiments an ALK7-binding protein comprises a VH-CDR3 and a VL-CDR3 sequence disclosed herein. In further embodiments, the ALK7-binding protein comprises a VH-CDR3 and a VL-CDR3 sequence disclosed in Table 1 A. In some embodiments, the ALK7-binding protein comprises a VFI-CDR3 or a VL-CDR3 sequence disclosed in Table IB.
  • the ALK7-binding protein comprises a VFI-CDR3 and a VL-CDR3 sequence disclosed in Table IB. In some embodiments, the ALK7-binding protein comprises a VFI-CDR3 or a VL-CDR3 sequence disclosed in Table 3. In further embodiments, the ALK7-binding protein comprises a VFI-CDR3 and a VL-CDR3 sequence disclosed in Table 3.
  • the disclosure provides an ALK7-binding protein comprising a VFI-CDR3 having the amino acid sequence of SEQ ID NO:3.
  • the ALK7-binding protein comprises a VFI-CDR3 having the amino acid sequence of SEQ ID NO: 3 and a VH-CDR2 having the amino acid sequence of SEQ ID NO:2.
  • the ALK7-binding protein comprises a VFI-CDR3 having the amino acid sequence of SEQ ID NO:3, a VFI-CDR2 having the amino acid sequence of SEQ ID NO:2, and a VH-CDR1 having the amino acid sequence of SEQ ID NO: l .
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF- beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the disclosure provides an ALK7-binding protein comprising a VH-CDR3 having the amino acid sequence of SEQ ID NO:21.
  • the ALK7-binding protein comprises a VH-CDR3 having the amino acid sequence of SEQ ID NO:21 and a VH-CDR2 having the amino acid sequence of SEQ ID NO:20.
  • the ALK7-binding protein comprises a VH-CDR3 having the amino acid sequence of SEQ ID NO:21, a VH-CDR2 having the amino acid sequence of SEQ ID NO:20, and a VH-CDR1 having the amino acid sequence of SEQ ID NO: 19.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF- beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%), or 10%) to 60%).
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%), or 10%) to 60%).
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7- binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein comprises a VFI-CDR3 having the amino acid sequence of SEQ ID NO:39. In further embodiments the ALK7-binding protein comprises a VFI-CDR3 having the amino acid sequence of SEQ ID NO:39 and a VH-CDR2 having the amino acid sequence of SEQ ID NO:38. In further embodiments, the ALK7-binding protein comprises a VFI-CDR3 having the amino acid sequence of SEQ ID NO:39, a VH-CDR2 having the amino acid sequence of SEQ ID NO:38, and a VH-CDR1 having the amino acid sequence of SEQ ID NO:37.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein comprises a VFI-CDR3 having the amino acid sequence of SEQ ID NO:57. In further embodiments the ALK7-binding protein comprises a VFI-CDR3 having the amino acid sequence of SEQ ID NO:57 and a VH-CDR2 having the amino acid sequence of SEQ ID NO:56. In further embodiments, the ALK7-binding protein comprises a VFI-CDR3 having the amino acid sequence of SEQ ID NO:57, a VH-CDR2 having the amino acid sequence of SEQ ID NO:56, and a VH-CDR1 having the amino acid sequence of SEQ ID NO:55.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the disclosure provides an ALK7-binding protein comprising a VH-CDR1 having the amino acid sequence of SEQ ID NO: l .
  • the disclosure provides an ALK7-binding protein comprising a VH-CDR1 having the amino acid sequence of SEQ ID NO: l and a VH-CDR2 having the amino acid sequence of SEQ ID NO:2.
  • the disclosure provides an ALK7- binding protein comprising a VH-CDR1 having the amino acid sequence of SEQ ID NO: l, a VH-CDR2 having the amino acid sequence of SEQ ID NO:2, and a VH-CDR3 having the amino acid sequence of SEQ ID NO:3 or 21.
  • the disclosure provides an ALK7-binding protein comprising a VH-CDR2 having the amino acid sequence of SEQ ID NO:2.
  • the ALK7-binding protein comprises a VH-CDR2 having the amino acid sequence of SEQ ID NO:2 and a VH-CDRl having the amino acid sequence of SEQ ID NO: 1.
  • the ALK7-binding protein comprises a VH-CDR2 having the amino acid sequence of SEQ ID NO:2, a VH-CDRl having the amino acid sequence of SEQ ID NO: 1, and a VH-CDR3 having the amino acid sequence of SEQ ID NO:3 or 21.
  • the disclosure provides an ALK7-binding protein comprising a VH-CDRl having the amino acid sequence of SEQ ID NO:38. In further embodiments, the disclosure provides an ALK7-binding protein comprising a VH-CDRl having the amino acid sequence of SEQ ID NO:37 and a VH-CDR2 having the amino acid sequence of SEQ ID NO:38. In further embodiments, the disclosure provides an ALK7-binding protein comprising a VH-CDRl having the amino acid sequence of SEQ ID NO:37, a VH-CDR2 having the amino acid sequence of SEQ ID NO:38, and a VH- CDR3 having the amino acid sequence of SEQ ID NO:39 or 57.
  • the disclosure provides an ALK7-binding protein comprising a VH-CDR2 having the amino acid sequence of SEQ ID NO:38.
  • the ALK7-binding protein comprises a VH-CDR2 having the amino acid sequence of SEQ ID NO:38 and a VH-CDRl having the amino acid sequence of SEQ ID NO:37.
  • the ALK7-binding protein comprises a VH-CDR2 having the amino acid sequence of SEQ ID NO: 38, a VH-CDRl having the amino acid sequence of SEQ ID NO: 37, and a VH-CDR3 having the amino acid sequence of SEQ ID NO:39 or 57.
  • the disclosure provides an ALK7-binding protein comprising a VH-CDR3 having the amino acid sequence of SEQ ID NO:90.
  • the ALK7-binding protein comprises a VH-CDR3 having the amino acid sequence of SEQ ID NO: 90 and a VH-CDR2 having the amino acid sequence of SEQ ID NO:89.
  • the ALK7-binding protein comprises a VH-CDR3 having the amino acid sequence of SEQ ID NO: 90, a VH-CDR2 having the amino acid sequence of SEQ ID NO: 89, and a VH-CDRl having the amino acid sequence of SEQ ID NO:88.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF- beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%), or 10%) to 60%).
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%), or 10%) to 60%).
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7- binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the disclosure provides an ALK7-binding protein comprising a VFI-CDR3 having the amino acid sequence of SEQ ID NO: 104.
  • the ALK7-binding protein comprises a VFI-CDR3 having the amino acid - I l l - sequence of SEQ ID NO: 104 and a VH-CDR2 having the amino acid sequence of SEQ ID NO: 103.
  • the ALK7-binding protein comprises a VH-CDR3 having the amino acid sequence of SEQ ID NO: 104, a VH-CDR2 having the amino acid sequence of SEQ ID NO: 103, and a VH-CDR1 having the amino acid sequence of SEQ ID NO: 102.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDFl, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%), 10%) to 80%), or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein comprises a VH-CDR3 having the amino acid sequence of SEQ ID NO: 1 16. In further embodiments the ALK7-binding protein comprises a VH-CDR3 having the amino acid sequence of SEQ ID NO: 1 16 and a VH-CDR2 having the amino acid sequence of SEQ ID NO: 1 15. In further embodiments, the ALK7-binding protein comprises a VH-CDR3 having the amino acid sequence of SEQ ID NO: 1 16, a VH-CDR2 having the amino acid sequence of SEQ ID NO: 1 15, and a VH-CDR1 having the amino acid sequence of SEQ ID NO: 1 14.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein comprises a VH-CDR3 having the amino acid sequence of SEQ ID NO: 127. In further embodiments the ALK7-binding protein comprises a VH-CDR3 having the amino acid sequence of SEQ ID NO: 127 and a VH-CDR2 having the amino acid sequence of SEQ ID NO: 126. In further embodiments, the ALK7-binding protein comprises a VH-CDR3 having the amino acid sequence of SEQ ID NO: 127, a VH-CDR2 having the amino acid sequence of SEQ ID NO: 126, and a VH-CDR1 having the amino acid sequence of SEQ ID NO: 125.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the disclosure provides an ALK7-binding protein comprising a VH-CDR3 having the amino acid sequence of SEQ ID NO: 164.
  • the ALK7-binding protein comprises a VH-CDR3 having the amino acid sequence of SEQ ID NO: 164 and a VH-CDR2 having the amino acid sequence of SEQ ID NO: 138 or 163.
  • the ALK7-binding protein comprises a VH- CDR3 having the amino acid sequence of SEQ ID NO: 164, a VH-CDR2 having the amino acid sequence of SEQ ID NO: 103, and a VH-CDR1 having the amino acid sequence of SEQ ID NO: l or 137.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDFl, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%), 10%) to 80%), or 10%> to 60%>.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein comprises a VH-CDR3 having the amino acid sequence of SEQ ID NO: 139. In further embodiments the ALK7-binding protein comprises a VH-CDR3 having the amino acid sequence of SEQ ID NO: 139 and a VH-CDR2 having the amino acid sequence of SEQ ID NO: 138. In further embodiments, the ALK7-binding protein comprises a VH-CDR3 having the amino acid sequence of SEQ ID NO: 139, a VH-CDR2 having the amino acid sequence of SEQ ID NO: 138, and a VH-CDR1 having the amino acid sequence of SEQ ID NO: 137.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the disclosure provides an ALK7-binding protein comprising a VH-CDRl having the amino acid sequence of SEQ ID NO:88. In further embodiments, the disclosure provides an ALK7-binding protein comprising a VH-CDRl having the amino acid sequence of SEQ ID NO:88 and a VH-CDR2 having the amino acid sequence of SEQ ID NO:89. In further embodiments, the disclosure provides an ALK7-binding protein comprising a VH-CDRl having the amino acid sequence of SEQ ID NO:88, a VH-CDR2 having the amino acid sequence of SEQ ID NO:89, and a VH- CDR3 having the amino acid sequence of SEQ ID NO:90.
  • the disclosure provides an ALK7-binding protein comprising a VH-CDR2 having the amino acid sequence of SEQ ID NO:89.
  • the ALK7-binding protein comprises a VH-CDR2 having the amino acid sequence of SEQ ID NO: 89 and a VH-CDRl having the amino acid sequence of SEQ ID NO:88.
  • the ALK7-binding protein comprises a VH-CDR2 having the amino acid sequence of SEQ ID NO: 89, a VH-CDRl having the amino acid sequence of SEQ ID NO:88, and a VH-CDR3 having the amino acid sequence of SEQ ID NO:90.
  • the disclosure provides an ALK7-binding protein comprising a VH-CDRl having the amino acid sequence of SEQ ID NO: 102. In further embodiments, the disclosure provides an ALK7-binding protein comprising a VH-CDRl having the amino acid sequence of SEQ ID NO: 102 and a VH-CDR2 having the amino acid sequence of SEQ ID NO: 103. In further embodiments, the disclosure provides an ALK7-binding protein comprising a VH-CDRl having the amino acid sequence of SEQ ID NO: 102, a VH-CDR2 having the amino acid sequence of SEQ ID NO: 103, and a VH- CDR3 having the amino acid sequence of SEQ ID NO: 104.
  • the disclosure provides an ALK7-binding protein comprising a VH-CDR2 having the amino acid sequence of SEQ ID NO: 103.
  • the ALK7-binding protein comprises a VH-CDR2 having the amino acid sequence of SEQ ID NO: 103 and a VH-CDRl having the amino acid sequence of SEQ ID NO: 102.
  • the ALK7-binding protein comprises a VH-CDR2 having the amino acid sequence of SEQ ID NO: 103, a VH-CDRl having the amino acid sequence of SEQ ID NO: 102, and a VH-CDR3 having the amino acid sequence of SEQ ID NO: 104.
  • the disclosure provides an ALK7-binding protein comprising a VH-CDRl having the amino acid sequence of SEQ ID NO: 114. In further embodiments, the disclosure provides an ALK7-binding protein comprising a VH-CDRl having the amino acid sequence of SEQ ID NO: 114 and a VH-CDR2 having the amino acid sequence of SEQ ID NO: 115. In further embodiments, the disclosure provides an ALK7-binding protein comprising a VH-CDRl having the amino acid sequence of SEQ ID NO: 114, a VH-CDR2 having the amino acid sequence of SEQ ID NO: 115, and a VH- CDR3 having the amino acid sequence of SEQ ID NO: 116.
  • the disclosure provides an ALK7-binding protein comprising a VH-CDR2 having the amino acid sequence of SEQ ID NO: 115.
  • the ALK7-binding protein comprises a VH-CDR2 having the amino acid sequence of SEQ ID NO: 115 and a VH-CDRl having the amino acid sequence of SEQ ID NO: 114.
  • the ALK7-binding protein comprises a VH-CDR2 having the amino acid sequence of SEQ ID NO: 115, a VH-CDRl having the amino acid sequence of SEQ ID NO: 114, and a VH-CDR3 having the amino acid sequence of SEQ ID NO: 116.
  • the disclosure provides an ALK7-binding protein comprising a VH-CDRl having the amino acid sequence of SEQ ID NO: 125. In further embodiments, the disclosure provides an ALK7-binding protein comprising a VH-CDRl having the amino acid sequence of SEQ ID NO: 125 and a VH-CDR2 having the amino acid sequence of SEQ ID NO: 126. In further embodiments, the disclosure provides an ALK7-binding protein comprising a VH-CDRl having the amino acid sequence of SEQ ID NO: 125, a VH-CDR2 having the amino acid sequence of SEQ ID NO: 126, and a VH- CDR3 having the amino acid sequence of SEQ ID NO: 127.
  • the disclosure provides an ALK7-binding protein comprising a VH-CDR2 having the amino acid sequence of SEQ ID NO: 126.
  • the ALK7-binding protein comprises a VH-CDR2 having the amino acid sequence of SEQ ID NO: 126 and a VH-CDRl having the amino acid sequence of SEQ ID NO: 125.
  • the ALK7-binding protein comprises a VH-CDR2 having the amino acid sequence of SEQ ID NO: 126, a VH-CDRl having the amino acid sequence of SEQ ID NO: 125, and a VH-CDR3 having the amino acid sequence of SEQ ID NO: 127.
  • the disclosure provides an ALK7-binding protein comprising a VH-CDRl having the amino acid sequence of SEQ ID NO: 137. In further embodiments, the disclosure provides an ALK7-binding protein comprising a VH-CDRl having the amino acid sequence of SEQ ID NO: 137 and a VH-CDR2 having the amino acid sequence of SEQ ID NO: 138. In further embodiments, the disclosure provides an ALK7-binding protein comprising a VH-CDRl having the amino acid sequence of SEQ ID NO: 137, a VH-CDR2 having the amino acid sequence of SEQ ID NO: 138, and a VH- CDR3 having the amino acid sequence of SEQ ID NO: 139.
  • the disclosure provides an ALK7-binding protein comprising a VH-CDR2 having the amino acid sequence of SEQ ID NO: 138.
  • the ALK7-binding protein comprises a VH-CDR2 having the amino acid sequence of SEQ ID NO: 138 and a VH-CDRl having the amino acid sequence of SEQ ID NO: 137.
  • the ALK7-binding protein comprises a VH-CDR2 having the amino acid sequence of SEQ ID NO: 138, a VH-CDRl having the amino acid sequence of SEQ ID NO: 137, and a VH-CDR3 having the amino acid sequence of SEQ ID NO: 139.
  • the disclosure provides an ALK7-binding protein comprising a VL-CDR3 having the amino acid sequence of SEQ ID NO: 12.
  • the ALK7-binding protein comprises a VL-CDR3 having the amino acid sequence of SEQ ID NO: 12 and a VL-CDR2 having the amino acid sequence of SEQ ID NO: 1 1.
  • the ALK7-binding protein comprises a VL-CDR3 having the amino acid sequence of SEQ ID NO: 12, a VL-CDR2 having the amino acid sequence of SEQ ID NO: 1 1, and a VL-CDR1 having the amino acid sequence of SEQ ID NO: 10.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF- beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%), or 10%) to 60%).
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%), or 10%) to 60%).
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7- binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the disclosure provides an ALK7-binding protein comprising a VL-CDR3 having the amino acid sequence of SEQ ID NO: 30.
  • the ALK7-binding protein comprises a VL-CDR3 having the amino acid sequence of SEQ ID NO:30 and a VL-CDR2 having the amino acid sequence of SEQ ID NO:29.
  • the ALK7-binding protein comprises a VL-CDR3 having the amino acid sequence of SEQ ID NO: 30, a VL-CDR2 having the amino acid sequence of SEQ ID NO:29, and a VL-CDRl having the amino acid sequence of SEQ ID NO:28.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF- beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the disclosure provides an ALK7-binding protein comprising a VL-CDR3 having the amino acid sequence of SEQ ID NO:48.
  • the ALK7-binding protein comprises a VL-CDR3 having the amino acid sequence of SEQ ID NO:48 and a VL-CDR2 having the amino acid sequence of SEQ ID NO:47.
  • the ALK7-binding protein comprises a VL-CDR3 having the amino acid sequence of SEQ ID NO:48, a VL-CDR2 having the amino acid sequence of SEQ ID NO:47, and a VL-CDR1 having the amino acid sequence of SEQ ID NO:46.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF- beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%), or 10%) to 60%).
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%>, 10%> to 80%), or 10%) to 60%).
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7- binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein comprises a VL-CDR3 having the amino acid sequence of SEQ ID NO:66. In further embodiments the ALK7-binding protein comprises a VL-CDR3 having the amino acid sequence of SEQ ID NO:66 and a VL-CDR2 having the amino acid sequence of SEQ ID NO:65. In further embodiments, the ALK7-binding protein comprises a VL-CDR3 having the amino acid sequence of SEQ ID NO:66, a VL-CDR2 having the amino acid sequence of SEQ ID NO:65, and a VL-CDR1 having the amino acid sequence of SEQ ID NO:64.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the disclosure provides an ALK7-binding protein comprising a VL-CDR3 having the amino acid sequence of SEQ ID NO: 97.
  • the ALK7-binding protein comprises a VL-CDR3 having the amino acid sequence of SEQ ID NO: 97 and a VL-CDR2 having the amino acid sequence of SEQ ID NO:96.
  • the ALK7-binding protein comprises a VL-CDR3 having the amino acid sequence of SEQ ID NO: 97, a VL-CDR2 having the amino acid sequence of SEQ ID NO: 96, and a VL-CDR1 having the amino acid sequence of SEQ ID NO:95.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF- beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%), or 10%) to 60%).
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%), or 10%) to 60%).
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7- binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the disclosure provides an ALK7-binding protein comprising a VL-CDR3 having the amino acid sequence of SEQ ID NO: 109.
  • the ALK7-binding protein comprises a VL-CDR3 having the amino acid sequence of SEQ ID NO: 109 and a VL-CDR2 having the amino acid sequence of SEQ ID NO: 108.
  • the ALK7-binding protein comprises a VL-CDR3 having the amino acid sequence of SEQ ID NO: 109, a VL-CDR2 having the amino acid sequence of SEQ ID NO: 108, and a VL-CDR1 having the amino acid sequence of SEQ ID NO: 107.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%), 10%) to 80%), or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the disclosure provides an ALK7-binding protein comprising a VL-CDR3 having the amino acid sequence of SEQ ID NO: 123.
  • the ALK7-binding protein comprises a VL-CDR3 having the amino acid sequence of SEQ ID NO: 123 and a VL-CDR2 having the amino acid sequence of SEQ ID NO: 122.
  • the ALK7-binding protein comprises a VL-CDR3 having the amino acid sequence of SEQ ID NO: 123, a VL-CDR2 having the amino acid sequence of SEQ ID NO: 122, and a VL-CDR1 having the amino acid sequence of SEQ ID NO: 121.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%), 10%) to 80%), or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein comprises a VL-CDR3 having the amino acid sequence of SEQ ID NO: 134. In further embodiments the ALK7-binding protein comprises a VL-CDR3 having the amino acid sequence of SEQ ID NO: 134 and a VL-CDR2 having the amino acid sequence of SEQ ID NO: 133. In further embodiments, the ALK7-binding protein comprises a VL-CDR3 having the amino acid sequence of SEQ ID NO: 134, a VL-CDR2 having the amino acid sequence of SEQ ID NO: 133, and a VL-CDR1 having the amino acid sequence of SEQ ID NO: 132.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein comprises a VL-CDR3 having the amino acid sequence of SEQ ID NO: 147. In further embodiments the ALK7-binding protein comprises a VL-CDR3 having the amino acid sequence of SEQ ID NO: 147 and a VL-CDR2 having the amino acid sequence of SEQ ID NO: 146. In further embodiments, the ALK7-binding protein comprises a VL-CDR3 having the amino acid sequence of SEQ ID NO: 147, a VL-CDR2 having the amino acid sequence of SEQ ID NO: 146, and a VL-CDR1 having the amino acid sequence of SEQ ID NO: 145.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the disclosure provides an ALK7-binding protein comprising a VH-antigen binding domain 3 (ABD3) having the amino acid sequence of SEQ ID NO:75, 78, 81, or 84.
  • the ALK7-binding protein comprises a VH-ABD3 having the amino acid sequence of SEQ ID NO:75.
  • the ALK7-binding protein comprises a VH-ABD3 having the amino acid sequence of SEQ ID NO: 75 and a VH-antigen binding domain 2 (VH-ABD2) having the amino acid sequence of SEQ ID NO:74.
  • the ALK7-binding protein comprises a VH-ABD3 having the amino acid sequence of SEQ ID NO:75, a VH-ABD2 having the amino acid sequence of SEQ ID NO: 74, and a VH-antigen binding domain 1 (VH-ABD1) having the amino acid sequence of SEQ ID NO: 73.
  • the ALK7-binding protein comprises a VH-ABD3 having the amino acid sequence of SEQ ID NO:75.
  • the ALK7-binding protein comprises a VH-ABD3 having the amino acid sequence of SEQ ID NO: 75 and a VH-antigen binding domain 2 (VH- ABD2) having the amino acid sequence of SEQ ID NO:74.
  • the ALK7-binding protein comprises a VH-ABD3 having the amino acid sequence of SEQ ID NO:75, a VH-ABD2 having the amino acid sequence of SEQ ID NO:74, and a VH- antigen binding domain 1 (VH-ABDl) having the amino acid sequence of SEQ ID NO:73.
  • the ALK7-binding protein comprises a VH-ABD3 having the amino acid sequence of SEQ ID NO:78.
  • the ALK7-binding protein comprises a VH-ABD3 having the amino acid sequence of SEQ ID NO:78 and a VH- antigen binding domain 2 (VH-ABD2) having the amino acid sequence of SEQ ID NO:77.
  • the ALK7-binding protein comprises a VH-ABD3 having the amino acid sequence of SEQ ID NO: 78, a VH-ABD2 having the amino acid sequence of SEQ ID NO: 77, and a VH-antigen binding domain 1 (VH-ABDl) having the amino acid sequence of SEQ ID NO:76.
  • the ALK7-binding protein comprises a VH-ABD3 having the amino acid sequence of SEQ ID NO:81.
  • the ALK7-binding protein comprises a VH-ABD3 having the amino acid sequence of SEQ ID NO: 81 and a VH-antigen binding domain 2 (VH-ABD2) having the amino acid sequence of SEQ ID NO:80.
  • the ALK7-binding protein comprises a VH-ABD3 having the amino acid sequence of SEQ ID NO:81, a VH- ABD2 having the amino acid sequence of SEQ ID NO: 80, and a VH-antigen binding domain 1 (VH-ABDl) having the amino acid sequence of SEQ ID NO:79.
  • the ALK7-binding protein comprises a VH-ABD3 having the amino acid sequence of SEQ ID NO:84.
  • the ALK7-binding protein comprises a VH-ABD3 having the amino acid sequence of SEQ ID NO: 84 and a VH-antigen binding domain 2 (VH-ABD2) having the amino acid sequence of SEQ ID NO:83.
  • the ALK7-binding protein comprises a VH-ABD3 having the amino acid sequence of SEQ ID NO: 84, a VH-ABD2 having the amino acid sequence of SEQ ID NO: 83, and a VH-antigen binding domain 1 (VH-ABD 1) having the amino acid sequence of SEQ ID NO:82.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDFl, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%), 10%) to 80%), or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • an ALK7-binding protein comprises a VH or a VL which has a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions compared to a reference VH or VL disclosed herein.
  • the ALK7-binding protein comprises a VH or a VL which has a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions compared to a reference VH or VL disclosed in Table IB.
  • an ALK7-binding protein comprises a VH and a VL pair which has a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions compared to a reference VH and VL pair disclosed herein.
  • the ALK7-binding protein comprises a VH and VL pair which has a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions compared to a reference VH and VL pair disclosed in Table IB.
  • the ALK7-binding protein comprises a VH or a VL which has a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions compared to a reference VH or VL disclosed in Table 3.
  • the ALK7-binding protein comprises a VH and VL pair which has a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions compared to a reference VH and VL pair disclosed in Table IB or Table 3.
  • the ALK7-binding protein a VH and a VL pair selected from the group consisting of: (a)(i) a VH sequence having a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions from a reference VH sequence selected from the group consisting of SEQ ID NO: 4, and (ii) a VL sequence having a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions from a reference VL sequence of SEQ ID NO: 13; (b)(i) a VH sequence having a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions from a reference VH sequence of SEQ ID NO: 13; (b
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF- beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein a VH and a VL pair selected from the group consisting of: (a)(i) a VH sequence having a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions from a reference VH sequence selected from the group consisting of SEQ ID NO:91, and (ii) a VL sequence having a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions from a reference VL sequence of SEQ ID NO:98; (b)(i) a VH sequence having a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions from a reference VH sequence of SEQ ID NO:
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDFl, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%), 10%) to 80%), or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein a VH and a VL pair selected from the group consisting of: (a)(i) a VH sequence having a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions from a reference VH sequence selected from the group consisting of SEQ ID NO: 152, and (ii) a VL sequence having a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions from a reference VL sequence of SEQ ID NO:98; (b)(i) a VH sequence having a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions from a reference VH sequence of SEQ ID NO:
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein comprises a VH and a VL pair wherein the VH sequence has a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions from a reference VH sequence of SEQ ID NO:4; and the VL sequence has a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions from a reference VL sequence of SEQ ID NO: 13; and wherein the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein comprises a VH and a VL pair wherein the VH sequence has a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions from a reference VH sequence of SEQ ID NO:22; and the VL sequence has a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions from a reference VL sequence of SEQ ID NO:31 ; and wherein the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein comprises a VH and a VL pair wherein the VH sequence has a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions from a reference VH sequence of SEQ ID NO:40; and the VL sequence has a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions from a reference VL sequence of SEQ ID NO:49; and wherein the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein comprises a VH and a VL pair wherein the VH sequence has a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions from a reference VH sequence of SEQ ID NO: 58 and the VL sequence has a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions from a reference VL sequence of SEQ ID NO:67; and wherein the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein comprises a VH and a VL pair wherein the VH sequence has a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions from a reference VH sequence of SEQ ID NO:91 ; and the VL sequence has a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions from a reference VL sequence of SEQ ID NO:98; and wherein the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDFl, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein comprises a VH and a VL pair wherein the VH sequence has a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions from a reference VH sequence of SEQ ID NO: 105; and the VL sequence has a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions from a reference VL sequence of SEQ ID NO: 1 10; and wherein the protein binds ALK7.
  • the ALK7- binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g.,
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein comprises a VH and a VL pair wherein the VH sequence has a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions from a reference VH sequence of SEQ ID NO: 1 17; and the VL sequence has a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions from a reference VL sequence of SEQ ID NO: 124; and wherein the protein binds ALK7.
  • the ALK7- binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDFl, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein comprises a VH and a VL pair wherein the VH sequence has a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions from a reference VH sequence of SEQ ID NO: 128 and the VL sequence has a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions from a reference VL sequence of SEQ ID NO: 135; and wherein the protein binds ALK7.
  • the ALK7- binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g.,
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein comprises a VH and a VL pair wherein the VH sequence has a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions from a reference VH sequence of SEQ ID NO: 140 and the VL sequence has a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions from a reference VL sequence of SEQ ID NO: 148; and wherein the protein binds ALK7.
  • the ALK7- binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDFl, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein comprises a VH sequence having a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions from a reference VH sequence selected from the group consisting of (a) SEQ ID NO:4, (b) SEQ ID NO:22, (c) SEQ ID NO:40, and (d) SEQ ID NO:58; and wherein the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein comprises a VH sequence having a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions from a reference VH sequence selected from the group consisting of (a) SEQ ID NO:91, (b) SEQ ID NO: 105, (c) SEQ ID NO: 1 17, (d) SEQ ID NO: 128, and (e) SEQ ID NO: 140; and wherein the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDFl, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%), 10%) to 80%), or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein comprises a VL sequence having a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions from a reference VL sequence of (a) SEQ ID NO: 13; (b) SEQ ID NO:31 ; (c) SEQ ID NO:49; and (d) SEQ ID NO:67; and wherein the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein comprises a VL sequence having a total of one, two, three, four, five, six, seven, eight, nine, ten, fewer than fifteen, or zero, amino acid substitutions, deletions, and/or insertions from a reference VL sequence of (a) SEQ ID NO:98; (b) SEQ ID NO: 1 10; (c) SEQ ID NO: 124; (d) SEQ ID NO: 135, and (e) SEQ ID NO: 148; and wherein the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • an ALK7-binding protein comprises a VH or a VL which has at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a reference VH or VL disclosed herein.
  • the ALK7-binding protein comprises a VH or a VL which has at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a reference VH or VL disclosed in Table 1A.
  • the ALK7-binding protein comprises a VH or a VL which has at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a reference VH or VL disclosed in Table IB.
  • the ALK7-binding protein comprises a VH or a VL which has at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a reference VH or VL disclosed in Table 3.
  • an ALK7- binding protein comprises a VH and VL which has at least 90%, 95%, 96%, 97%, 98%, 99%), or 100%) sequence identity to a reference VH and VL disclosed herein.
  • the ALK7-binding protein comprises a VH and VL which has at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a reference VH and VL disclosed in Table 1A.
  • the ALK7-binding protein comprises a VH and VL which has at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a reference VH and VL disclosed in Table IB. In further embodiments, the ALK7-binding protein comprises a VH and VL which has at least 90%, 95%, 96%, 97%, 98%), 99%), or 100% sequence identity to a reference VH and VL disclosed in Table 3.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF- beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein specifically binds ALK7 and comprises a VH having (a) at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:4; (b) at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:22; (c) at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:40; and (d) a VH having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:58; and wherein the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDFl, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%), 10%) to 80%), or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein specifically binds ALK7 and comprises a VH having (a) at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:91 ; (b) at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 105; (c) at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 1 17; (d) a VH having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 128; and (e) a VH having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 140; and wherein the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%), 10%) to 80%), or 10%> to 60%>.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein specifically binds ALK7 and comprises a VL having: (a) at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 13; (b) at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:31 ; (c) at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:49; and (d) at least 90%, 95%, 96%, 97%, 98%, 99%), or 100%) sequence identity to SEQ ID NO:67; and wherein the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF- beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein specifically binds ALK7 and comprises a VL having: (a) at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:98; (b) at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 1 10; (c) at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 124; (d) at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 135; and (e) at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 148; and wherein the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDFl, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%), 10%) to 80%), or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein specifically binds ALK7 and comprises a VH and a VL pair selected from the group consisting of: (a)(i) a VH having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:4, and (ii) a VL having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 13; (b)(i) a VH having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:22, and (ii) a VL having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 31 ; (c)(i) a VH having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:40, and (ii) a VH having at
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF- beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%), or 10%) to 60%).
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%), or 10%) to 60%).
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7- binding protein has 2, 3, or 4 of the above characteristics.
  • the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein specifically binds ALK7 and comprises a VH and a VL pair selected from the group consisting of: (a)(i) a VH having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 152, and (ii) a VL having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:98; (b)(i) a VH having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 159, and (ii) a VL having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 1 10; and (c)(i) a VH having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 165, and (
  • the ALK7- binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g.,
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein specifically binds ALK7 and comprises a VH and a VL pair selected from the group consisting of: (a)(i) a VH having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:91, and (ii) a VL having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:98; (b)(i) a VH having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 105, and (ii) a VL having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 1 10; (c)(i) a VH having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 1 17, and (ii)
  • the ALK7- binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g.,
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein specifically binds ALK7 and comprises a VH having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:4, and a VL having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO: 13.
  • the ALK7-binding protein specifically binds ALK7 and comprises a VH of SEQ ID NO:4 and a VL of SEQ ID NO: 13.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%), 10%) to 80%), or 10%> to 60%>.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein specifically binds ALK7 and comprises a VH having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID SEQ ID NO:22, and a VL having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:31.
  • the ALK7- binding protein specifically binds ALK7 and comprises a VH of SEQ ID SEQ ID NO:22 and a VL of SEQ ID NO:31.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDFl, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%), 10%) to 80%), or 10%> to 60%>.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein specifically binds ALK7 and comprises a VH having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:40, and a VL having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:49.
  • the ALK7-binding protein specifically binds ALK7 and comprises a VH of SEQ ID NO:40 and a VL of SEQ ID NO:49.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%), 10%) to 80%), or 10%> to 60%>.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein specifically binds ALK7 and comprises a VH having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 58, and a VL having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100%) sequence identity to SEQ ID NO:67.
  • the ALK7-binding protein specifically binds ALK7 and comprises a VH of SEQ ID NO:58 and a VL of SEQ ID NO:67.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDFl, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%), 10%) to 80%), or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • ALK7 ligands selected from the group consisting of: GDF l, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein specifically binds ALK7 and comprises a VH having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 91, and a VL having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:98.
  • the ALK7-binding protein specifically binds ALK7 and comprises a VH of SEQ ID NO:91 and a VL of SEQ ID NO: 98.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDFl, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%), 10%) to 80%), or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein specifically binds ALK7 and comprises a VH having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID SEQ ID NO: 105, and a VL having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 1 10.
  • the ALK7-binding protein specifically binds ALK7 and comprises a VH of SEQ ID SEQ ID NO: 105 and a VL of SEQ ID NO: 1 10.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein specifically binds ALK7 and comprises a VH having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 1 17, and a VL having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 124.
  • the ALK7-binding protein specifically binds ALK7 and comprises a VH of SEQ ID NO: 1 17 and a VL of SEQ ID NO: 124.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%), 10%) to 80%), or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein specifically binds ALK7 and comprises a VH having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 128, and a VL having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 135.
  • the ALK7-binding protein specifically binds ALK7 and comprises a VH of SEQ ID NO: 128 and a VL of SEQ ID NO: 135.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%), 10%) to 80%), or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein specifically binds ALK7 and comprises a VH having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 140, and a VL having at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 148.
  • the ALK7-binding protein specifically binds ALK7 and comprises a VH of SEQ ID NO: 140 and a VL of SEQ ID NO: 148.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%), 10%) to 80%), or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein comprises a VH and a VL pair selected from the group consisting of: (a) a VH sequence of SEQ ID NO:4 and a VL sequence of SEQ ID NO: 13; (b) a VH sequence of SEQ ID NO: 22, and a VL sequence of SEQ ID NO:31 ; (c) a VH sequence of SEQ ID NO:40, and a VL sequence of SEQ ID NO:49; and (d) a VH sequence of SEQ ID NO:58 and a VL sequence of SEQ ID NO:67; and wherein the protein binds ALK7.
  • the ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the ALK7-binding protein comprises a VH and a VL pair selected from the group consisting of: (a) a VH sequence of SEQ ID NO:91 and a VL sequence of SEQ ID NO:98; (b) a VH sequence of SEQ ID NO: 105, and a VL sequence of SEQ ID NO: 1 10; (c) a VH sequence of SEQ ID NO: 1 17, and a VL sequence of SEQ ID NO: 124; (d) a VH sequence of SEQ ID NO: 128 and a VL sequence of SEQ ID NO: 135; and (e) a VH sequence of SEQ ID NO: 140 and a VL sequence of SEQ ID NO: 148; and wherein the protein binds ALK7.
  • the ALK7- binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g.,
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • an ALK7-binding protein cross-blocks or competes for binding to ALK7 with an antibody comprising a VH and a VL sequence pair disclosed herein. In additional embodiments an ALK7-binding protein cross-blocks or competes for binding to ALK7 with an antibody comprising a VH and a VL sequence pair disclosed in Table 1A. In some embodiments, the ALK7-binding protein specifically binds ALK7 and comprises a VH of SEQ ID NO:4, 22, 40, or 58. In additional embodiments, the ALK7-binding protein specifically binds ALK7 and comprises a VL of SEQ ID NO: 13, 31, 49, or 67.
  • the ALK7-binding protein specifically binds ALK7 and comprises a VH of SEQ ID NO: 4, 22, 40, or 58; and a VL of SEQ ID NO: 13, 31, 49, or 67.
  • an ALK7-binding protein binds to the same epitope as an ALK7-binding protein disclosed herein.
  • an ALK7-binding protein binds to the same epitope as an ALK7-binding protein disclosed in Table 1 A.
  • the ability of an ALK7-binding protein to compete for binding with and/or bind the same epitope of ALK7 as a reference ALK7-binding protein can readily be determined using techniques disclosed herein or otherwise known in the art.
  • an ALK7-binding protein cross-blocks or competes for binding to ALK7 with an antibody comprising a VH and a VL sequence pair disclosed in Table IB.
  • the ALK7-binding protein specifically binds ALK7 and comprises a VH of SEQ ID NO: 152, 159, or 166.
  • the ALK7- binding protein specifically binds ALK7 and comprises a VL of SEQ ID NO:98, 110, or 171.
  • the ALK7-binding protein specifically binds ALK7 and comprises a VH of SEQ ID NO: 152, 159, or 166; and a VL of SEQ ID NO: 98, 110, or 171.
  • an ALK7-binding protein binds to the same epitope as an ALK7-binding protein disclosed herein. In additional embodiments, an ALK7-binding protein binds to the same epitope as an ALK7-binding protein disclosed in Table 1 A. The ability of an ALK7-binding protein to compete for binding with and/or bind the same epitope of ALK7 as a reference ALK7-binding protein can readily be determined using techniques disclosed herein or otherwise known in the art.
  • an ALK7-binding protein cross-blocks or competes for binding to ALK7 with an antibody comprising a VH and a VL sequence pair disclosed in Table IB or Table 3.
  • the ALK7-binding protein specifically binds ALK7 and comprises a VH of SEQ ID NO: 91, 105, 117, 128, or 140.
  • the ALK7-binding protein specifically binds ALK7 and comprises a VL of SEQ ID NO: 98, 110, 124, 135, or 148.
  • the ALK7-binding protein specifically binds ALK7 and comprises a VH of SEQ ID NO: 91, 105, 117, 128, or 140; and a VL of SEQ ID NO: 98, 110, 124, 135, or 148.
  • an ALK7-binding protein binds to the same epitope as an ALK7-binding protein disclosed herein.
  • an ALK7-binding protein binds to the same epitope as an ALK7-binding protein disclosed in Table 1 A.
  • an ALK7- binding protein binds to the same epitope as an ALK7-binding protein disclosed in Table IB or Table 3.
  • the ability of an ALK7-binding protein to compete for binding with and/or bind the same epitope of ALK7 as a reference ALK7-binding protein can readily be determined using techniques disclosed herein or otherwise known in the art.
  • the ALK7-binding protein comprises a VH sequence of
  • an ALK7- binding protein cross-blocks or competes for binding to ALK7 with an antibody comprising a VH sequence of SEQ ID NO: 40 and a VL sequence of SEQ ID NO: 49.
  • the ALK7-binding protein binds the same epitope of ALK7 as an antibody comprising a VH sequence of SEQ ID NO:40 and a VL sequence of SEQ ID NO:49.
  • the ALK7-binding protein comprises a VH sequence of
  • an ALK7- binding protein cross-blocks or competes for binding to ALK7 with an antibody comprising a VH sequence of SEQ ID NO: 58 and a VL sequence of SEQ ID NO: 67.
  • the ALK7-binding protein binds the same epitope of ALK7 as an antibody comprising a VH sequence of SEQ ID NO:58 and a VL sequence of SEQ ID NO:67.
  • the ALK7-binding protein comprises a VH and a VL sequence of antibody J01. In some embodiments, the the ALK7-binding protein comprises a VH sequence of SEQ ID NO: 152 and a VL sequence of SEQ ID NO:98. In some embodiments, an ALK7-binding protein cross-blocks or competes for binding to ALK7 with an antibody comprising a VH sequence of SEQ ID NO: 152 and a VL sequence of SEQ ID NO: 98. In further embodiments, the ALK7-binding protein binds the same epitope of ALK7 as an antibody comprising a VH sequence of SEQ ID NO: 152 and a VL sequence of SEQ ID NO: 98.
  • the ALK7-binding protein comprises a VH and a VL sequence of antibody J02.
  • the ALK7-binding protein comprises a VH sequence of SEQ ID NO:91 and a VL sequence of SEQ ID NO: 98.
  • an ALK7-binding protein cross-blocks or competes for binding to ALK7 with an antibody comprising a VH sequence of SEQ ID NO:91 and a VL sequence of SEQ ID NO: 98.
  • the ALK7-binding protein binds the same epitope of ALK7 as an antibody comprising a VH sequence of SEQ ID NO:91 and a VL sequence of SEQ ID NO: 98.
  • the ALK7-binding protein comprises a VH and a VL sequence of antibody KOI .
  • the the ALK7-binding protein comprises a VH sequence of SEQ ID NO: 159 and a VL sequence of SEQ ID NO: 110.
  • an ALK7-binding protein cross-blocks or competes for binding to ALK7 with an antibody comprising a VH sequence of SEQ ID NO: 159 and a VL sequence of SEQ ID NO: 110.
  • the ALK7-binding protein binds the same epitope of ALK7 as an antibody comprising a VH sequence of SEQ ID NO: 159 and a VL sequence of SEQ ID NO: 110.
  • the ALK7-binding protein comprises a VH and a VL sequence of antibody K02.
  • the ALK7-binding protein comprises a VH sequence of SEQ ID NO: 105 and a VL sequence of SEQ ID NO: 110.
  • an ALK7-binding protein cross-blocks or competes for binding to ALK7 with an antibody comprising aVH sequence of SEQ ID NO: 105 and a VL sequence of SEQ ID NO: 110.
  • the ALK7-binding protein binds the same epitope of ALK7 as an antibody comprising aVH sequence of SEQ ID NO: 105 and a VL sequence of SEQ ID NO: 110.
  • the ALK7-binding protein comprises a VH and a VL sequence of antibody G04. In some embodiments, the ALK7-binding protein comprises a VH sequence of SEQ ID NO: 4 and a VL sequence of SEQ ID NO: 13. In some embodiments, an ALK7-binding protein cross-blocks or competes for binding to ALK7 with an antibody comprising a VH sequence of SEQ ID NO:4 and a VL sequence of SEQ ID NO: 13. In further embodiments, the ALK7-binding protein binds the same epitope of ALK7 as an antibody comprising a VH sequence of SEQ ID NO:4 and a VL sequence of SEQ ID NO: 13.
  • the ALK7-binding protein comprises a VH and a VL sequence of antibody G05. In some embodiments, the ALK7-binding protein comprises a VH sequence of SEQ ID NO: 117 and a VL sequence of SEQ ID NO: 124. In some embodiments, an ALK7-binding protein cross-blocks or competes for binding to ALK7 with an antibody comprising a VH sequence of SEQ ID NO: 117 and a VL sequence of SEQ ID NO: 124. In further embodiments, the ALK7-binding protein binds the same epitope of ALK7 as an antibody comprising a VH sequence of SEQ ID NO: 117 and a VL sequence of SEQ ID NO: 124.
  • the ALK7-binding protein comprises a VH and a VL sequence of antibody C02.
  • the ALK7-binding protein comprises a VH sequence of SEQ ID NO:22 and a VL sequence of SEQ ID NO:31.
  • an ALK7-binding protein cross-blocks or competes for binding to ALK7 with an antibody comprising aVH sequence of SEQ ID NO:22 and a VL sequence of SEQ ID NO:31.
  • the ALK7-binding protein binds the same epitope of ALK7 as an antibody comprising aVH sequence of SEQ ID NO:22 and a VL sequence of SEQ ID NO: 31.
  • the ALK7-binding protein comprises a VH and a VL sequence of antibody C03. In some embodiments, the ALK7-binding protein comprises a VH sequence of SEQ ID NO: 128 and a VL sequence of SEQ ID NO: 135. In some embodiments, an ALK7-binding protein cross-blocks or competes for binding to ALK7 with an antibody comprising a VH sequence of SEQ ID NO: 128 and a VL sequence of SEQ ID NO: 135. In further embodiments, the ALK7-binding protein binds the same epitope of ALK7 as an antibody comprising a VH sequence of SEQ ID NO: 128 and a VL sequence of SEQ ID NO : 135.
  • the ALK7-binding protein comprises a VH and a VL sequence of antibody L01. In some embodiments, the the ALK7-binding protein comprises a VH sequence of SEQ ID NO: 165 and a VL sequence of SEQ ID NO: 171. In some embodiments, an ALK7-binding protein cross-blocks or competes for binding to ALK7 with an antibody comprising a VH sequence of SEQ ID NO: 165 and a VL sequence of SEQ ID NO: 171. In further embodiments, the ALK7-binding protein binds the same epitope of ALK7 as an antibody comprising a VH sequence of SEQ ID NO: 165 and a VL sequence of SEQ ID NO : 171.
  • the ALK7-binding protein comprises a VH and a VL sequence of antibody L02.
  • the ALK7-binding protein comprises a VH sequence of SEQ ID NO: 140 and a VL sequence of SEQ ID NO: 148.
  • an ALK7-binding protein cross-blocks or competes for binding to ALK7 with an antibody comprising a VH sequence of SEQ ID NO: 140 and a VL sequence of SEQ ID NO: 148.
  • the ALK7-binding protein binds the same epitope of ALK7 as an antibody comprising a VH sequence of SEQ ID NO: 140 and a VL sequence of SEQ ID NO: 148.
  • the ALK7-binding protein is an antibody that specifically binds ALK7.
  • the anti-ALK7 antibody is a murine antibody, a humanized antibody, a chimeric antibody, a monoclonal antibody, a polyclonal antibody, a recombinant antibody, a multispecific antibody, or any combination thereof.
  • the anti-ALK7 antibody is an Fv fragment, an Fab fragment, an F(ab')2 fragment, an Fab' fragment, a dsFv fragment, an scFv fragment, or an sc(Fv)2 fragment.
  • the ALK7-binding protein specifically binds ALK7 and blocks an activity of an ALK7-ligand (e.g., GDF l, GDF3, GDF8, activin B, activin A/B, or Nodal).
  • the ALK7-binding protein specifically binds ALK7 and blocks an activity of a co-receptor (e.g., cripto).
  • the ALK7- binding protein specifically binds ALK7 and decreases the fat formation associated with the activity of an ALK7 ligand (e.g., GDF l, GDF3, GDF8, activin B, activin A/B, or Nodal).
  • the ALK7-binding protein specifically binds ALK7 and treats or ameliorates one or more disease or conditions associated with excess weight, obesity or a metabolic disorder.
  • the disease or condition is type II diabetes.
  • the disease or condition is hypertension.
  • the metabolic disorder i s dyslipidemia, insulin resistance, hyperinsulinemia or hyperglycemia.
  • the ALK7-binding protein decreases ALK7-mediated Smad signaling.
  • an ALK7- binding protein antagonizes ALK7-mediated inhibition of lipolysis in white and/or brown adipose cells by 5% to 100%, 10% to 95%, 10 to 90%, 10 to 85%, 10 to 80%, 10 to 75%, 10 to 70%, 10 to 75%, 10 to 70%, 10 to 60%, 10 to 55%, 10 to 50%, or 10 to 45%, as determined in a lipolysis assay.
  • an ALK7-binding protein reduces or decreases ALK7-mediated inhibition of lipolysis in white and/or brown adipose cells by at least 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 95%, or by about 100%, as determined in a lipolysis assay.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal).
  • the ALK7-binding protein binds ALK7 and inhibits or decreases one or more conditions associated with overweight, obesity, insulin resistance, diabetes, atherosclerosi s, hypertens on, inflammation, and/or NAFLD (e.g., fatty liver and/or NASH).
  • NAFLD e.g., fatty liver and/or NASH.
  • the ALK7-binding protein decreases ALK7-mediated Smad signaling.
  • the ALK7-binding protein inhibits ALK7-mediated inhibition of lipolysis in white adipose cells by 5% to 100%, 10% to 95%, 10 to 90%, 10 to 85%, 10 to 80%, 10 to 75%, 10 to 70%, 10 to 75%, 10 to 70%, 10 to 60%, 10 to 55%, 10 to 50%, or 10 to 45%, as determined using standard techniques and conditions in a lipolysis inhibition assay performed in the presence of activin B (50 ng/ml) (e.g., as described in the examples herein).
  • activin B 50 ng/ml
  • an ALK7-binding protein reduces or decreases ALK7-mediated inhibition of lipolysis in white adipose cells by at least 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%), 90%), or 95%), or by about 100%, as determined, using standard techniques and conditions in a lipolysis inhibition assay performed in the presence of activin B (50 ng/ml) (e.g., as described in the examples herein).
  • the ALK7- binding protein binds ALK7 and inhibits or decreases one or more conditions associated with overweight, obesity, insulin resistance, diabetes, atherosclerosis, hypertension, inflammation, and/or NAFLD (e.g., fatty liver and/or N ASH).
  • the blocking of ALK7 activity by an ALK7-binding protein inhibits or decreases one or more conditions associated with excess body weight, insulin resistance, obesity or diabetes, such as hypertension, cancer, and neuropathy, retinopathy, and card ovascular, pulmonary and kidney disease, in further embodiments the blocking of ALK7 inhibits or decreases one or more conditions associated with metabolic disease.
  • the ALK7-binding protein e.g., an anti-ALK7 antibody
  • the ALK7-binding protein inhibits or decreases the inhibition of lipolysis by a Smad- dependent pathway.
  • an anti-ALK7 antibody e.g., a full-length
  • ALK7-antibody and an ALK7-binding antibody fragment, and a variant and derivative thereof) containing a VH and/or VL amino acid sequence that binds ALK7 can have at least 85%, 90%, 95%, 96%, 97%, 98% 99%, or 100% sequence identity to a sequence set forth herein.
  • the VH and/or VL amino acid sequence(s) that binds ALK7 comprise 8, 7, 6, 5, 4, 3, 2, 1 amino acid additions, substitutions (e.g., conservative substitutions) or deletions relative to a sequence set forth herein.
  • the VH and/or VL amino acid sequence that binds ALK7 comprise 1, 2, 3, 4, 5 or more amino acid additions, substitutions (e.g., conservative substitutions) or deletions relative to a sequence set forth herein.
  • An anti-ALK7 antibody containing VH and VL regions having a certain percent similarity to a VH region or VL region, or having one or more substitutions, deletions and/or insertions (e.g., conservative substitutions) can be obtained by mutagenesis (e.g., site-directed or PCR-mediated mutagenesis) of nucleic acid molecules encoding VH and/or VL regions described herein, followed by testing of the encoded altered antibody for binding to ALK7 and optionally testing for retained function using the functional assays described herein or an assay known in the art that can routinely be modified to test the retained function.
  • an ALK7-binding protein such as, an anti-ALK7 antibody (e.g., a full-length ALK7-antibody and an ALK7-binding antibody fragment, and a variant and derivative thereof) for hALK7, or murALK7
  • an anti-ALK7 antibody e.g., a full-length ALK7-antibody and an ALK7-binding antibody fragment, and a variant and derivative thereof
  • hALK7, or murALK7 can be determined experimentally using any suitable method known in the art, e.g., flow cytometry, enzyme- linked immunosorbent assay (ELISA), or radioimmunoassay (RIA), or kinetics (e.g., BIACORE® or KINEXA® analysis). Direct binding assays and competitive binding assay formats can be readily employed.
  • the measured affinity of a particular antibody- antigen interaction can vary if measured under different conditions (e.g., salt concentration, pH, temperature).
  • affinity and other ALK7-binding parameters e.g., K D or Kd, K on , K 0ff
  • measurements of affinity and other ALK7-binding parameters are made with standardized solutions of ALK7- binding proteins and ALK7 and the measurements are performed using standardized conditions and methods, as described herein or otherwise known in the art.
  • the disclosure further provides an ALK7-binding protein such as, an anti-ALK7 antibody as described herein, where the ALK7-binding protein is conjugated to a heterologous agent.
  • the heterologous agent is an antimicrobial agent, a therapeutic agent, a prodrug, a peptide, a protein, an enzyme, a lipid, a biological response modifier, a pharmaceutical agent, a lymphokine, a heterologous antibody or antibody fragment, a detectable label, or a polyethylene glycol (PEG).
  • PEG polyethylene glycol
  • the ALK7-binding protein is not an anti-ALK7 antibody.
  • phage display technology can been used to identify/produce an ALK7-binding protein.
  • the ALK7-binding protein comprises a protein scaffold based on a type selected from the group consisting of VASP polypeptides, avian pancreatic polypeptide (aPP), tetranectin (based on CTLD3), affilin (based on ⁇ -crystallin/ubiquitin), a knottin, an SH3 domain, a PDZ domain, tendamistat, transferrin, an ankyrin consensus repeat domain ⁇ e.g., DARPins), a lipocalin protein fold ⁇ e.g., anticalins and Duocalins), a Protein Epitope Mimetic (PEM), a maxybody/avimer, a domain antibody a fibronectin domain ⁇ e.g., 10 Fn3, see, e.g., U.S. Appl. Publ. Nos. 2003/0170753 and 20090155275, each of which is herein incorporated by reference in its entirety), a domain of protein A ⁇
  • the disclosure provides an ALK7-binding protein ⁇ e.g., an anti-ALK7 antibody such as, a full-length anti-ALK7 antibody and an ALK7-binding antibody fragment) that cross-blocks or competes for binding ALK7 with an anti-ALK7 antibody provided herein.
  • an ALK7-binding protein that binds to the same epitope of ALK7 as an ALK7-binding protein provided herein.
  • test ALK7-binding protein to inhibit the binding of, for example, a reference binding protein such as an antibody comprising a VH sequence of SEQ ID NO:4 and a VL sequence of SEQ ID NO: 13, a VH sequence of SEQ ID NO:22 and a VL sequence of SEQ ID NO:31, a VH sequence of SEQ ID NO:40 and a VL sequence of SEQ ID NO: 49, or a VH sequence of SEQ ID NO:58 and a VL sequence of SEQ ID NO: 67, to ALK7 demonstrates that the test ALK7-binding protein can compete with the reference antibody for binding to ALK7.
  • a reference binding protein such as an antibody comprising a VH sequence of SEQ ID NO:4 and a VL sequence of SEQ ID NO: 13, a VH sequence of SEQ ID NO:22 and a VL sequence of SEQ ID NO:31, a VH sequence of SEQ ID NO:40 and a VL sequence of SEQ ID NO: 49, or
  • Such an ALK7-binding protein can, according to non-limiting theory, bind to the same or a related (e.g., a structurally similar or spatially proximal) epitope on ALK7 as the ALK7-reference antibody with which it competes.
  • the ALK7-binding protein binds to the same epitope on ALK7 as an antibody comprising a VH sequence of SEQ ID NO:4 and a VL sequence of SEQ ID NO: 13, a VH sequence of SEQ ID NO:22 and a VL sequence of SEQ ID NO:31, a VH sequence of SEQ ID NO:40 and a VL sequence of SEQ ID NO:49,or a VH sequence of SEQ ID NO: 58 and a VL sequence of SEQ ID NO: 67, respectively.
  • Such an ALK7-binding protein can, according to non-limiting theory, bind to the same or a related (e.g., a structurally similar or spatially proximal) epitope on ALK7 as the ALK7-reference antibody with which it competes.
  • the ALK7-binding protein binds to the same epitope on ALK7 as an antibody comprising a VH sequence of SEQ ID NO:91 and a VL sequence of SEQ ID NO: 98, a VH sequence of SEQ ID NO: 105 and a VL sequence of SEQ ID NO: 1 10, a VH sequence of SEQ ID NO: 1 17 and a VL sequence of SEQ ID NO: 124, a VH sequence of SEQ ID NO: 128 and a VL sequence of SEQ ID NO: 135, or a VH sequence of SEQ ID NO: 140 and a VL sequence of SEQ ID NO: 148, respectively.
  • type 1 TGF-beta receptor family members such as, ALK7
  • type II receptors e.g., ActRIIA and ActRIIB
  • Smads e.g., Smad2 and/or Smad3
  • an ALK7-binding protein e.g., an anti-ALK7 antibody
  • an ALK7-binding protein can decrease phosphorylation of ALK7 by one or more type II receptors (e.g., ActRIIA and/or ActRIIB) in an ALK7 and type II receptor-expressing cell (e.g., adipocyte).
  • an ALK7-binding protein e.g., an anti-ALK7 antibody
  • Smads e.g., Smad2 and/or Smad3
  • ALK7 receptor expressing cell is murine.
  • the ALK7 receptor expressing cell is human.
  • the ALK7 receptor expressing cell is an adipocyte.
  • an ALK7-binding protein has at least one characteristic selected from: (a) decreasing the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competing with one or more type II receptors for binding to ALK7; (c) competing with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) for binding to ALK7; (d) decreasing the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g., ActRIIA
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics. In some embodiments, the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody). In further embodiments, the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%. In some embodiments, the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10%) to 80%), or 10%> to 60%>.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein cross-blocks or competes for binding to ALK7 with an antibody having an ALK7-binding VH and VL pair disclosed herein.
  • the ALK7-binding protein is an anti-ALK7 antibody or an ALK7-binding antibody fragment.
  • an ALK7-binding protein decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF 1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more of the TGF-beta superfamily ligands.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%. In some embodiments, the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%. In some embodiments, the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%. In further embodiments the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein cross-blocks or competes for binding to ALK7 with an antibody having an ALK7-binding VH and VL pair disclosed herein.
  • the ALK7-binding protein is an anti-ALK7 antibody or an ALK7-binding antibody fragment.
  • an ALK7-binding competes with one or more type II receptors for binding to ALK7.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein cross-blocks or competes for binding to ALK7 with an antibody having an ALK7-binding VH and VL pair disclosed herein.
  • the ALK7-binding protein is an anti-ALK7 antibody or an ALK7-binding antibody fragment.
  • an ALK7-binding protein decreases the phosphorylation of Smads (e.g., Smad2 and/or Smad3) in cells expressing ALK7 and a type II receptor (e.g., ActRIIA and/or ActRIIB) in the presence of one or more TGF-beta ligands (e.g., GDF 1, GDF3, GDF8, activin B, activin AB, and/or Nodal).
  • the ALK7-binding protein decreases the phosphorylation of Smads as measured using a cell-based assay.
  • an ALK7-binding protein decreases ALK7-mediated phosphorylation with an IC 50 lower than 500 pM, lower than 350 pM, lower than 250 pM, lower than 150 pM, lower than 100 pM, lower than 75 pM, lower than 60 pM, lower than 50 pM, lower than 40 pM, lower than 30 pM, lower than 20 pM, lower than 15 pM, lower than 10 pM, or lower than 5 pM, as measured using a cell-based assay.
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%. In some embodiments, the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%. In some embodiments, the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%), 10%) to 80%), or 10%> to 60%>. In further embodiments the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein cross-blocks or competes for binding to ALK7 with an antibody having an ALK7-binding VH and VL pair disclosed herein.
  • the ALK7-binding protein is an anti-ALK7 antibody or an ALK7-binding antibody fragment.
  • an ALK7-binding protein binds to ALK7 with a KD of ⁇ 1 nM and >1 pM (e.g., as determined by BIACORE® analysis).
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein cross-blocks or competes for binding to ALK7 with an antibody having an ALK7-binding VH and VL pair disclosed herein.
  • the ALK7-binding protein is an anti-ALK7 antibody or an ALK7-binding antibody fragment.
  • an ALK7-binding protein decreases the formation of a complex containing ALK7, a co-receptor (e.g., cripto and/or cryptic), and one or more TGF-beta superfamily ligands (e.g., Nodal).
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%), or 10%) to 60%).
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein cross-blocks or competes for binding to ALK7 with an antibody having an ALK7-binding VH and VL pair disclosed herein.
  • the ALK7-binding protein is an anti-ALK7 antibody or an ALK7-binding antibody fragment.
  • the ALK7-binding protein binds the extracellular domain of ALK7.
  • the ALK7-binding protein is an anti-ALK7 antibody such as, a full-length anti-ALK7 antibody or an ALK7-binding antibody fragment, and variants, and derivatives thereof.
  • ALK7-binding proteins can be readily prepared using known techniques.
  • Monoclonal anti-ALK7 antibodies can be prepared using techniques known in the art, including hybridoma methods, such as those described by Kohler and Milstein, Nature 256:495-497 (1975). Using the hybridoma method, a mouse, hamster, or other appropriate host animal, is immunized as described above to elicit the production by lymphocytes of antibodies that will specifically bind to an immunizing antigen. Lymphocytes can also be immunized in vitro. Following immunization, the lymphocytes are isolated and fused with a suitable myeloma cell line to form hybridoma cells that can then be selected away from unfused lymphocytes and myeloma cells.
  • Hybridomas that produce monoclonal antibodies directed specifically against ALK7 such as hALK7, as determined by immunoprecipitation, immunoblotting, or by an in vitro binding assay ⁇ e.g., radioimmunoassay (RIA); enzyme-linked immunosorbent assay (ELISA)) can then be propagated either in in vitro culture using standard methods ⁇ see, e.g., Goding, Monoclonal Antibodies: Principles and Practice, Academic Press, 1986) or in vivo as ascites tumors in an animal.
  • the monoclonal antibodies can then be purified from the culture medium or ascites fluid as described for polyclonal antibodies above.
  • the provided monoclonal antibodies can also be made using recombinant DNA methods as described in U.S. Pat. No. 4,816,567, wherein the polynucleotides encoding a monoclonal antibody are isolated from mature B-cells or a hybridoma cell, such as by RT-PCR using oligonucleotide primers that specifically amplify the genes encoding the heavy and light chains of the antibody, and their sequence is determined using known procedures. The isolated polynucleotides encoding the heavy and light chains are then cloned into suitable expression vectors, which when transfected into host cells such as E.
  • coli cells simian COS cells, Chinese hamster ovary (CHO) cells, Per.C6 cells, or myeloma cells ⁇ e.g., NS0 cells) that do not otherwise produce immunoglobulin protein, monoclonal antibodies are generated by the host cells.
  • Recombinant anti-ALK7 monoclonal antibodies can also readily be isolated from phage display libraries expressing CDRs of the desired species using known techniques ⁇ see, e.g., McCafferty et al, Nature 348:552-554 (1990); Clackson et al, Nature 352:624-628 (1991); and Marks et al, J. Mol Biol. 222:581-597 (1991)).
  • the anti-ALK7 antibodies can optionally be humanized, resurfaced, and engineered to display high affinity for the ALK7 antigen and other favorable biological properties.
  • a humanized (or human) anti-ALK7 antibody can readily be designed and prepared using commonly available three-dimensional immunoglobulin modeling and known procedures for selecting framework (FW) residues, consensus sequences, and germline sequences to provide a desired antibody characteristic, such as increased affinity for ALK7.
  • Affinity maturation strategies and chain shuffling strategies are known in the art and can be employed to generate high affinity anti-ALK7 antibodies as well as derivatives and variants of the ALK7-binding proteins disclosed herein. See, e.g., Marks et al, Bio/Technology 10:779-783 (1992), which is herein incorporated by reference in its entirety.
  • An additional strategy for generating high affinity anti-ALK7 antibodies as well as derivatives and variants of the ALK7-binding proteins disclosed herein is to generate novel VH or VL regions carrying CDR-derived sequences of the disclosure using random mutagenesis of one or more selected VH and/or VL genes to generate mutations within the entire variable domain.
  • Humanization, resurfacing or engineering of anti-ALK7 antibodies of the disclosure can be performed using any known method including, but not limited to, those described in Jones et al, Nature 321 :522 (1986); Riechmann et al, Nature 332:323 (1988); Verhoeyen et al, Science 239: 1534 (1988)), Sims et al, J. Immunol. 151 : 2296 (1993); Chothia et al, J. Mol. Biol. 196:901 (1987), Carter et al, PNAS USA 89:4285 (1992); Presta et al, J. Immunol. 151 :2623 (1993), U.S. Pat. Nos.
  • known assays are available for readily selecting anti-ALK7-antibodies displaying desirable features (e.g., assays for determining binding affinity to ALIO; cross-blocking assays such as the BIACORE®-based human ALK7-binding protein competition binding assays described herein).
  • a humanized, resurfaced or similarly engineered antibody can have one or more amino acid residues from a source that is non-human, e.g., but not limited to, mouse, rat, rabbit, non-human primate or other mammal. These non-human amino acid residues are replaced by residues that are often referred to as "import" residues, which are typically taken from an "import" variable, constant or other domain of a known human sequence.
  • Such imported sequences can be used to reduce immunogenicity or reduce, enhance or modify binding, affinity, on-rate, off-rate, avidity, specificity, half-life, or any other suitable characteristic, as known in the art.
  • part or all of the non-human or human CDR sequences are maintained while the non-human sequences of the variable and constant regions can be replaced with human or other amino acids.
  • Nucleic acid(s) encoding an ALK7-binding protein such as a full-length anti-
  • ALK7 antibody can further be modified in a number of different manners using recombinant DNA technology to generate alternative antibodies.
  • nucleic acid(s) encoding the constant domains of the light and heavy chains of, for example, a mouse monoclonal antibody can be substituted (a) for those coding regions of, for example, a human antibody to generate a chimeric antibody or (b) for non- immunoglobulin encoding nucleic acid(s) to generate a fusion antibody.
  • the constant regions are truncated or removed to generate the desired antibody fragment of a monoclonal antibody.
  • Site-directed or high-density mutagenesis of the variable region coding sequence can be used to optimize specificity, affinity, etc. of a monoclonal antibody.
  • Anti-ALK7 human antibodies can be directly prepared using any of the numerous techniques known in the art. (See, e.g., Cole et al, Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77 (1985); Boemer et al, J. Immunol. 147(l):86-95 (1991); and U.S. Patent No. 5,750,373). Similarly, human anti-ALK7 antibodies can readily be obtained from immortalized human B lymphocyte immunized in vitro or isolated from an immunized individual that produces an antibody directed against ALK7.
  • Human anti-ALK7 antibodies can also be selected from a phage library that expresses human antibodies, as described, for example, in Vaughan et al, Nat. Biotech. 14:309-314 (1996), Sheets et al, PNAS 95:6157-6162 (1998), Hoogenboom and Winter, J. Mol. Biol. 227:381 (1991), and Marks et al, J. Mol. Biol. 222:581 (1991). Techniques for the generating and screening antibody phage libraries are also described in U.S. Pat. Nos.
  • Human anti-ALK7 antibodies can also be made in transgenic mice containing human immunoglobulin loci that are capable upon immunization of producing human antibodies in the absence of endogenous immunoglobulin production. This approach is described for example, in U.S. Pat. Nos. 5,545,807; 5,545,806; 5,569,825; 5,625, 126; 5,633,425; and 5,661,016.
  • Human anti-ALK7 antibodies can also be selected and/or isolated from yeast- based antibody presentation libraries, as disclosed in, for example, WO012/009568; WO09/036379; WO10/105256; WO03/074679 and U.S. Appl. Publ. No. US2002/0177170, the contents of each of which is herein incorporated by reference in its entirety.
  • yeast-based antibody presentation libraries as disclosed in, for example, WO012/009568; WO09/036379; WO10/105256; WO03/074679 and U.S. Appl. Publ. No. US2002/0177170, the contents of each of which is herein incorporated by reference in its entirety.
  • Such libraries are designed in silico to be reflective of the diversity afforded by the human preimmune repertoire.
  • anti-ALK7 antibodies may be selected from a yeast-displayed antibody library see, for example: Blaise et al, Gene 342(2):211-218 (2004); Boder et al, Nat Biotechnol. 15(6):553-557 (1997); Kuroda et al, Biotechnol. Lett. 33(1): 1-9 (2011). Review; Lauer et al, J. Pharm. Sci. 101(1): 102-15 (2012); Orcutt K.D. and Wittrup K.D. Antibody Engineering, yeast display and selection (2010), 207-233; Rakestraw et al, Protein Eng. Des. Sel. 24(6):525-30 (2011); and U.S. Patent Nos. 6,423,538; 6,696,251; and 6,699,658.
  • ALK7-binding antibody fragments produced recombinantly. Fab, Fv, and scFv antibody fragments can all be expressed in and secreted from E. coli or other host cells, thus allowing the production of large amounts of these fragments.
  • Such an ALK7-binding antibody fragments can additionally be isolated from the antibody phage libraries discussed above.
  • the ALK7-binding antibody fragment is a linear antibody as described in U.S. Pat. No. 5,641,870.
  • Other techniques for the production of antigen- binding antibody fragments are known in the art.
  • ALK7- binding antibody fragments can be produced by techniques known in the art including, but not limited to: (a) a F(ab')2 fragment produced by pepsin digestion of an antibody; (b) a Fab fragment generated by reducing the disulfide bridges of an F(ab')2 fragment, (c) a Fab fragment generated by the treatment of the anti-ALK7 antibody with papain and a reducing agent, and (d) Fv fragments.
  • an ALK7-binding protein ⁇ e.g., an anti-ALK7 antibody
  • an ALK7-binding protein can be modified in order to increase its serum half-life. This can be achieved, for example, by incorporation of a salvage receptor binding epitope into the ALK7-binding protein by mutation of an appropriate region in the ALK7-binding protein or by incorporating the salvage receptor epitope into a peptide tag that is then fused to the ALK7-binding protein at either end or in the middle ⁇ e.g., by DNA or peptide synthesis).
  • Other methods to increase the serum half-life of an ALK7-binding protein e.g., conjugation to a heterologous molecule such as PEG are known in the art.
  • Heteroconjugate ALK7-binding proteins ⁇ e.g., anti-ALK7 antibodies, such as a full-length anti-ALK7 antibodies and ALK7-binding antibody fragments, and variants and derivatives thereof) are also within the scope of the disclosure.
  • Heteroconjugate ALK7-binding proteins are composed of two covalently joined proteins. It is contemplated that the heteroconjugate ALK7-binding proteins can be prepared in vitro using known methods in synthetic protein chemistry, including those involving crosslinking agents.
  • immunotoxins can be constructed using a disulfide exchange reaction or by forming a thioether bond. Examples of suitable reagents for this purpose include iminothiolate and methyl-4-mercaptobutyrimidate.
  • ALK7-binding proteins can comprise any type of variable region that provides for the association of the antibody with ALK7.
  • variable region can comprise or be derived from any mammal that can be induced to mount a humoral response and generate immunoglobulins against the ALK7 antigen.
  • the variable region of an anti-ALK7 antibody can be, for example, of human, murine, non-human primate (e.g., cynomolgus monkeys, macaques, etc.) or lupine origin. In some embodiments both the variable and constant regions of the modified anti-ALK7 antibodies are human.
  • variable regions of compatible antibodies can be engineered or specifically tailored to improve the binding properties or reduce the immunogenicity of the molecule.
  • variable regions useful according to the disclosure can be humanized or otherwise altered through the inclusion of imported amino acid sequences using affinity maturation, mutagenesis procedures, chain shuffling strategies and/or other methods described herein or otherwise know in the art.
  • variable domains in both the heavy and light chains of an anti-ALK7 antibody are altered by at least partial replacement of one or more CDRs and/or by partial framework region replacement and sequence changing.
  • the CDRs can be derived from an antibody of the same class or even subclass as the antibody from which the framework regions are derived, it is envisaged that the CDRs will be derived from an antibody of different class and in certain embodiments from an antibody from a different species. It is not necessary to replace all of the CDRs with the complete CDRs from the donor variable region to transfer the antigen-binding capacity of one variable domain to another. Rather, it is only necessary to transfer those residues that are necessary to maintain the activity of the antigen-binding site. It is well within the competence of those of ordinary skill in the art, to routinely obtain a functional antibody with reduced immunogenicity. See, e.g., U.S. Pat. Nos. 5,585,089, 5,693,761 and 5,693,762.
  • the modified anti-ALK7 antibody of the disclosure will comprise antibodies in which at least a fraction of one or more of the constant region domains has been deleted or otherwise altered so as to provide desired biochemical characteristics such as decreased ADCC or increased serum half-life when compared with an antibody of approximately the same immunogenicity comprising a native or unaltered constant region.
  • the constant region of the modified anti-ALK7 antibodies comprise a human constant region. Modifications to the constant region can include additions, deletions or substitutions of one or more amino acids in one or more domains.
  • the modified anti-ALK7 antibodies disclosed herein can comprise alterations or modifications to one or more of the three heavy chain constant domains (CHI, CH2 or CH3) and/or to the light chain constant domain (CL).
  • the modified anti-ALK7 antibodies comprise constant regions wherein one or more domains are partially or entirely deleted are contemplated.
  • the modified anti- ALK7 antibodies comprise domain deleted constructs or variants wherein the entire CH2 domain has been removed (ACH2 constructs).
  • the omitted constant region domain can be replaced by a short amino acid spacer (e.g., 10 residues) that provides some of the molecular flexibility typically imparted by the absent constant region.
  • the constant region mediates several effector functions.
  • binding of the CI component of complement to antibodies activates the complement system.
  • Activation of complement is important in the opsonization and lysis of cell pathogens.
  • the activation of complement also stimulates the inflammatory response and can also be involved in autoimmune hypersensitivity.
  • antibodies bind to cells via the Fc region, with a Fc receptor site on the antibody Fc region binding to a Fc receptor (FcR) on a cell.
  • Fc receptor Fc receptor
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • an anti-ALK7 antibody has an altered effector function that, in turn, affects the biological profile of the administered anti-ALK7 antibody.
  • the deletion or inactivation (through point mutations or other means) of a constant region domain can reduce Fc receptor binding of the circulating modified antibody.
  • the constant region modifications can moderate complement binding and thus reduce the serum half-life and nonspecific association of a conjugated cytotoxin.
  • modifications of the constant region can be used to eliminate disulfide linkages or oligosaccharide moieties that allow for enhanced localization due to increased antigen specificity or antibody flexibility.
  • modifications to the constant region in accordance with this disclosure can easily be made using biochemical or molecular engineering techniques known to those of ordinary skill in the art.
  • an ALK7-binding protein provided herein is an ALK7 antibody that does not have one or more effector functions.
  • the anti-ALK7 antibody has no antibody-dependent cellular cytoxicity (ADCC) activity and/or no complement-dependent cytoxicity (CDC) activity.
  • the anti-ALK7 antibody does not bind to an Fc receptor and/or complement factors.
  • the anti-ALK7 antibody has no effector function. Examples of Fc sequence engineering modifications that reduce or eliminate ADCC and/or CDC activity and Fc receptor and/or complement factor binding are described herein or otherwise know in the art, as are assays and procedures for testing the same.
  • an anti-ALK7 antibody is engineered to fuse the CH3 domain directly to the hinge region of the respective modified antibody.
  • a peptide spacer is inserted between the hinge region and the modified CH2 and/or CH3 domains.
  • compatible constructs can be expressed in which the CH2 domain has been deleted and the remaining CH3 domain (modified or unmodified) is joined to the hinge region with a 5-20 amino acid spacer.
  • Such a spacer can be added, for instance, to ensure that the regulatory elements of the constant domain remain free and accessible or that the hinge region remains flexible.
  • Amino acid spacers can, in some cases, prove to be immunogenic and elicit an unwanted immune response against the construct. Accordingly, in certain embodiments, any spacer added to the construct can be relatively non-immunogenic, or even omitted altogether, so as to maintain the desired biochemical qualities of the modified anti-ALK7 antibody.
  • anti-ALK7 antibodies are modified by the partial deletion or substitution of a few or even a single amino acid in a constant region.
  • the mutation of a single amino acid in selected areas of the CH2 domain can be enough to substantially reduce Fc binding and thereby.
  • one or more constant region domains that control the effector function e.g., complement C 1Q binding
  • Such partial deletions of the constant regions can improve selected characteristics of the anti-ALK7 antibody (e.g., serum half-life) while leaving other desirable functions associated with the corresponding constant region domain intact.
  • the constant region of the anti-ALK7 antibody is modified through the mutation or substitution of one or more amino acids that enhances the profile of the resulting construct.
  • the disclosure also provides an anti-ALK7 antibody that contains the addition of one or more amino acids to the constant region to enhance desirable characteristics such, as decreasing or increasing effector function or providing attachments sites for one or more cytotoxin, labeling or carbohydrate moieties. In such embodiments it can be desirable to insert or replicate specific sequences derived from selected constant region domains.
  • the disclosure also provides an ALK7-binding protein that is a variant to an
  • the variant ALK7-binding protein has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor (e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF l, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDFl, GDF3 and/
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%), 10%) to 80%), or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • ALK7-binding proteins such as anti-ALK7 antibodies
  • additional chemical moieties known in the art for improving for example, the solubility, biological half-life, bioavailability, and to otherwise improve the stability, formulation and/or therapeutic properties of the ALK7-binding protein.
  • a non- exhaustive overview for such moieties can be found for example, in Remington's Pharmaceutical Sciences, 20th ed., Mack Publishing Co., Easton, PA (2000).
  • nucleic acid molecules and combinations of nucleic acid molecules that encode an ALK7-binding protein are also provided.
  • the nucleic acids molecules encode an anti-ALK7 antibody, such as a full-length anti-ALK7 antibody and an ALK7-binding antibody fragment.
  • the disclosure provides nucleic acid molecules that encode a variant or derivative of a full-length anti-ALK7 antibody or an ALK7-binding antibody fragment provided herein.
  • the nucleic acid molecules disclosed herein can be in the form of RNA or in the form of DNA.
  • DNA includes cDNA, genomic DNA, and synthetic DNA; and can be double-stranded or single-stranded, and if single stranded can be the coding strand/or non-coding (anti-sense) strand.
  • the nucleic acid molecule is isolated.
  • a nucleic acid molecule is substantially pure.
  • the nucleic acid is cDNA or is derived from cDNA.
  • the nucleic acid is be recombinantly produced.
  • the nucleic acid molecule comprises an ALK7-binding protein coding sequence operably linked to a control sequence that controls the expression of the coding sequence in a host cell or in vitro.
  • the coding sequence is a cDNA.
  • the disclosure also relates to vectors containing nucleic acid molecules comprises an ALK7-binding protein coding sequence operably linked to a control sequence that controls the expression of the coding sequence in a host cell or in vitro.
  • the nucleic acid molecule comprises a coding sequence for a mature ALK7-binding protein that is fused in the same reading frame to a heterologous polynucleotide sequence.
  • the heterologous polynucleotide sequence encodes a leader peptide sequence that facilitates the secretion of the expressed protein from the host cell transformed with the ALK7-binding protein encoding nucleic acid molecule(s).
  • a protein containing a leader sequence is referred to as a preprotein and can have the leader sequence cleaved by the host cell to form the mature form of the ALK7-binding protein.
  • heterologous polynucleotide sequence encodes additional 5' amino acid residues that can function for example, to facilitate purification, add or improve protein stability and/or therapeutic or diagnostic properties of the recombinantly expressed ALK7-binding protein.
  • the disclosure provides isolated nucleic acids such as an
  • ALK7-binding protein encoding cDNA fragments sufficient for use as a hybridization probe, PCR primer or sequencing primer.
  • the nucleic acid molecules encode an ALK7-binding protein that has at least one characteristic selected from the group consisting of: (a) decreases the formation of a complex containing ALK7, a type II receptor ⁇ e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands ⁇ e.g., activin B, activin AB, Nodal, GDF1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competes with one or more type II receptors for binding to ALK7; (c) competes with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF1, GDF3 and/or GDF8) for binding to ALK7; (d) decreases the phosphorylation of ALK7
  • the encoded ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody). In further embodiments, the encoded ALK-7 binding protein increases lipolysis in adipose cells expressing ALK7. In some embodiments, the encoded ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the encoded ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics. In some embodiments, the encoded ALK7-binding protein cross-blocks or competes for binding to ALK7 with an antibody having an ALK7-binding VH and VL pair disclosed herein.
  • the encoded ALK7-binding protein binds to the same epitope of ALK7 as an antibody disclosed herein. In some embodiments, the encoded ALK7-binding protein cross-blocks or competes for binding to ALK7 with an ALK7 binding antibody having a VH and VL pair disclosed herein. In additional embodiments, the encoded ALK7-binding protein binds to the same epitope of ALK7 as an antibody disclosed herein. In further embodiments, the nucleic acid molecules encode an ALK7-binding protein that specifically binds ALK7 and comprises a VH and a VL
  • the disclosure provides vectors and sets of vectors containing nucleic acids and sets of nucleic acids encoding the ALK7-binding proteins provided herein. Host cells transformed with these nucleic acids, sets of nucleic acids, vectors, and sets of vectors are also provided, as are methods of making an using the ALK7-binding proteins.
  • the disclosure provides a host cell comprising a nucleic acid molecule or combination of nucleic acid molecules or a vector as provided above, where the host cell can, in some instances express an ALK7-binding protein (e.g., an anti- ALK7 antibody such as, a full-length ALK7-antibody and an ALK7-binding antibody fragment), that specifically binds to ALK7.
  • an ALK7-binding protein e.g., an anti- ALK7 antibody such as, a full-length ALK7-antibody and an ALK7-binding antibody fragment
  • the disclosure provides a host cell transformed with a nucleic acid molecule or combination of nucleic acid molecules or a vector as provided above, where the host cell can, in some instances express an ALK7-binding protein that specifically binds to ALK7.
  • Such host cells can be utilized in a method of making an ALK7-binding protein as provided herein, where the method includes (a) culturing the host cell and (b)
  • the disclosure also provides a method for making an ALK7-binding protein comprising culturing a host cell (e.g., a hybridoma or transformed mammalian host cell) capable of expressing the ALK7-binding protein under suitable conditions and optionally provides a method for isolating the ALK7-binding protein secreted from the host cell. And the disclosure additionally provides the ALK7-binding protein isolated using the disclosed methods.
  • a host cell e.g., a hybridoma or transformed mammalian host cell
  • the polynucleotides comprise the coding sequence(s) for the mature ALK7-binding protein(s) (e.g., an ALK7-antibody, such as a full-length antibody and an ALK7-binding antibody fragment) fused in the same reading frame to a marker sequence that allows, for example, for purification of the encoded polypeptide.
  • ALK7-binding protein(s) e.g., an ALK7-antibody, such as a full-length antibody and an ALK7-binding antibody fragment
  • the marker sequence can be a hexa-histidine tag supplied by a pQE-9 vector to provide for purification of the mature polypeptide fused to the marker in the case of a bacterial host, or the marker sequence can be a hemagglutinin (HA) tag derived from the influenza hemagglutinin protein when a mammalian host (e.g., COS-7 cells) is used.
  • a mammalian host e.g., COS-7 cells
  • Nucleic acid variants encoding an ALK7-binding protein such as, an anti-ALK7 antibody and an ALK7-binding antibody fragment, are also provided.
  • Nucleic acid variants can contain alterations in the coding regions, non-coding regions, or both.
  • the nucleic acid variants contain alterations that produce silent substitutions, additions, or deletions, but do not alter the properties or activities of the encoded polypeptide.
  • the nucleic acid variants are produced by silent substitutions due to the degeneracy of the genetic code.
  • Nucleic acid variants can be produced for a variety of reasons, e.g., to optimize codon expression for a particular host (change codons in the human mRNA to those preferred by a bacterial host such as E. coli).
  • Vectors and cells comprising the nucleic acids described herein are also provided.
  • an anti-ALK7 antibody such as a full-length antibody and an ALK7-binding antibody fragment
  • an oligonucleotide synthesizer e.g., an anti-ALK7 antibody such as a full-length antibody and an ALK7-binding antibody fragment
  • Such oligonucleotides can be designed based on the amino acid sequence of the desired polypeptide and codon optimization based on the host cell preferences. Standard methods can routinely be applied to synthesize an isolate polynucleotide sequences encoding ALK7-binding proteins.
  • the nucleic acid sequences encoding ALK7-binding proteins can routinely be operably linked to a control sequence appropriate for expression of the ALK7-binding protein in a desired host.
  • the nucleic acid sequence(s) encoding an ALK7-binding protein is inserted into one or more expression vectors and operably linked to a control sequence(s) appropriate for expression of the protein in a desired host.
  • the coding sequence can be operably linked to or associated with transcriptional and translational expression control sequences that are functional in the chosen expression host.
  • recombinant expression vectors are used to amplify and express DNA encoding an ALK7-binding protein, such as, an anti-ALK7 antibody or an ALK7-binding antibody fragment.
  • Recombinant expression vectors are replicable DNA constructs which have synthetic or cDNA-derived DNA fragments encoding a polypeptide chain of an ALK7-binding protein operably linked to suitable transcriptional or translational regulatory elements derived from mammalian, microbial, viral or insect genes.
  • a transcriptional unit generally comprises an assembly of (1) a genetic element or elements having a regulatory role in gene expression, for example, transcriptional promoters or enhancers, (2) a structural or coding sequence which is transcribed into mRNA and translated into protein, and (3) appropriate transcription and translation initiation and termination sequences, as described in detail below.
  • Such regulatory elements can include an operator sequence to control transcription.
  • the ability to replicate in a host, usually conferred by an origin of replication, and a selection gene to facilitate recognition of transformants can additionally be incorporated.
  • DNA regions are operably linked when they are functionally related to each other.
  • DNA for a signal peptide is operably linked to DNA for a polypeptide if it is expressed as a precursor which participates in the secretion of the polypeptide; a promoter is operably linked to a coding sequence if it controls the transcription of the sequence; or a ribosome binding site is operably linked to a coding sequence if it is positioned so as to permit translation.
  • Structural elements intended for use in yeast expression systems include a leader sequence enabling extracellular secretion of translated protein by a host cell.
  • the protein can include an N-terminal methionine residue.
  • composition e.g., a pharmaceutical composition, comprising a nucleic acid or vector of as described above or elsewhere herein, optionally further comprising one or more carriers, diluents, excipients, or other additives.
  • a host cell transformed with the nucleic acid molecule or cDNA molecules and/or the vectors disclosed herein.
  • the disclosure also provides host cells transformed with the disclosed nucleic acid molecule or molecules operably linked to a control sequence and optionally inserted into a vector.
  • the host cell is a mammalian host cell.
  • the mammalian host cell is a NSO murine myeloma cell, a PER.C6® human cell, or a Chinese hamster ovary (CHO) cell.
  • the host cell is a hybridoma.
  • the disclosure provides a method of making an
  • ALK7-binding protein (e.g., an anti-ALK7 antibody such as, a full-length ALK7-antibody and an ALK7-binding antibody fragment, and variants and derivatives thereof) provided herein comprising culturing a transformed host cell or a hybridoma disclosed herein under suitable conditions for producing the ALK7-binding protein.
  • the disclosure optionally provides isolating the ALK7-binding protein secreted from the host cell.
  • the disclosure also optionally provides the ALK7-binding protein produced using this method and pharmaceutical compositions comprising the ALK7-binding protein and a pharmaceutically acceptable carrier.
  • the choice of expression control sequence and expression vector will depend upon the choice of host. A wide variety of expression host/vector combinations can be employed.
  • Useful expression vectors for eukaryotic hosts include, for example, vectors comprising expression control sequences from SV40, bovine papilloma virus, adenovirus and cytomegalovirus.
  • Useful expression vectors for bacterial hosts include known bacterial plasmids, such as plasmids from E. coli, including pCRl, pBR322, pMB9 and their derivatives, and also wider host range plasmids, such as Ml 3 and filamentous single-stranded DNA phages.
  • Suitable host cells for expression of an ALK7-binding protein include prokaryotes, yeast, insect or higher eukaryotic cells under the control of appropriate promoters.
  • Prokaryotes include gram negative or gram positive organisms, for example E. coli or bacilli.
  • Higher eukaryotic cells include established cell lines of mammalian origin as described below. Cell-free translation systems could also be employed. Additional information regarding methods of protein production, including antibody production, can be found, e.g., in U.S. Appl. Publ. No. 2008/0187954, U.S. Pat. Nos. 6,413,746 and 6,660,501, and Intl. Appl. Publ. No. WO04/009823, each of which is herein incorporated by reference in its entirety.
  • ALK7-binding proteins ⁇ e.g., an anti-ALK7 antibody such as, a full-length ALK7-antibody and an ALK7-binding antibody fragment, and variants and derivatives thereof.
  • an anti-ALK7 antibody such as, a full-length ALK7-antibody and an ALK7-binding antibody fragment, and variants and derivatives thereof.
  • Expression of recombinant ALK7-binding proteins in mammalian cells can be performed because such proteins are generally correctly folded, appropriately modified and completely functional.
  • mammalian host cell lines include HEK-293 and HEK-293T, the COS-7 lines of monkey kidney cells, described by Gluzman ⁇ Cell 23 : 175 (1981)), and other cell lines including, for example, L cells, C127, 3T3, Chinese hamster ovary (CHO), HeLa and BHK cell lines.
  • Mammalian expression vectors can comprise nontranscribed elements such as an origin of replication, a suitable promoter and enhancer linked to the gene to be expressed, and other 5' or 3' flanking nontranscribed sequences, and 5' or 3' nontranslated sequences, such as necessary ribosome binding sites, a polyadenylation site, splice donor and acceptor sites, and transcriptional termination sequences.
  • Baculovirus systems for production of heterologous proteinsin sect cells are reviewed by Luckow and Summers, BioTechnology 6:47 (1988).
  • ALK7-binding proteins produced by a transformed host cell or hybridoma can be purified according to any suitable method. Such standard methods include chromatography ⁇ e.g., ion exchange, affinity and sizing column chromatography), centrifugation, differential solubility, or by any other standard technique for protein purification. Affinity tags such as hexahistidine, maltose binding domain, influenza coat sequence and glutathione-S-transferase can be attached to the protein to allow easy purification by passage over an appropriate affinity column. ALK7-binding proteins can also be physically characterized using such techniques as proteolysis, nuclear magnetic resonance and x-ray crystallography.
  • supernatants from systems that secrete recombinant ALK7-binding proteins into culture media can be first concentrated using a commercially available protein concentration filter, for example, an Amicon or Millipore Pellicon ultrafiltration unit. Following the concentration step, the concentrate can be applied to a suitable purification matrix.
  • a suitable purification matrix for example, an anion exchange resin can be employed, for example, a matrix or substrate having pendant diethylaminoethyl (DEAE) groups.
  • the matrices can be acrylamide, agarose, dextran, cellulose or other types commonly employed in protein purification.
  • a cation exchange step can be employed.
  • Suitable cation exchangers include various insoluble matrices comprising sulfopropyl or carboxymethyl groups.
  • one or more reversed-phase high performance liquid chromatography (RP-HPLC) steps employing hydrophobic RP-HPLC media, e.g., silica gel having pendant methyl or other aliphatic groups, can be employed to further purify an ALK7- binding protein.
  • RP-HPLC reversed-phase high performance liquid chromatography
  • a recombinant ALK7-binding protein ⁇ e.g., an anti-ALK7 antibody such as, a full-length ALK7-antibody and an ALK7-binding antibody fragment and variants and derivatives thereof) produced in bacterial culture can be isolated, for example, by initial extraction from cell pellets, followed by one or more concentration, salting-out, aqueous ion exchange or size exclusion chromatography steps. High performance liquid chromatography (FIPLC) can be employed for final purification steps.
  • FRPLC high performance liquid chromatography
  • Microbial cells employed in expression of a recombinant protein can be disrupted by any convenient method, including freeze-thaw cycling, sonication, mechanical disruption, or use of cell lysing agents.
  • Methods known in the art for purifying target binding proteins such as full-length antibodies and antigen-binding antibody fragments also include, for example, those described in U.S. Appl. Publ. Nos. 2008/0312425, 2008/0177048, and 2009/0187005, each of which is incorporated herein by reference herein in its entirety.
  • the ALK7-binding protein is not an antibody.
  • a variety of methods are known for identifying and producing non-antibody polypeptides that bind with high affinity to a protein target. See, e.g., Skerra, Curr. Opin. Biotechnol. 18:295- 304 (2007), Hosse et al, Protein Science 15: 14-27 (2006), Gill et al, Curr. Opin. Biotechnol. 17:653-658 (2006), Nygren, FEBS J. 275:2668-2676 (2008), and Skerra, FEBS J. 275:2677-2683 (2008), each of which is herein incorporated by reference in its entirety.
  • phage display technology is used to identify/produce the ALK7-binding protein.
  • the polypeptide comprises a protein scaffold of a type selected from the group consisting of protein A, a lipocalin, a fibronectin domain (e.g., Fibronectin type III (Fn3)), an ankyrin consensus repeat domain, and thioredoxin.
  • ALK7-binding proteins including antibodies, immunoconjugates, and polypeptides
  • ALK7-binding proteins are useful in a variety of applications including, but not limited to, diagnostic methods and methods of treating and/or ameliorating various diseases and conditions with an ALK7-binding protein (e.g., an anti-ALK7 antibody).
  • Methods are provided for the use of an ALK7-binding protein (e.g., an anti-ALK7 antibody such as, a full-length antibody that specifically binds ALK7 and an ALK7-binding antibody fragment, and variants and derivatives thereof) to treat subjects having a disease or condition associated with ALK7 signaling, altered ALK7 expression, and/or can be ameliorated by reduced ALK7 signaling.
  • an ALK7-binding protein e.g., an anti-ALK7 antibody such as, a full-length antibody that specifically binds ALK7 and an ALK7-binding antibody fragment, and variants and derivatives thereof
  • the disclosure provides a pharmaceutical composition containing an ALK7-binding protein provided herein and a pharmaceutically acceptable carrier.
  • the disclosure provides a pharmaceutical composition containing an ALK7-binding protein provided herein and a pharmaceutically acceptable carrier, for use as a medicament.
  • the disclosure also provides the use of the pharmaceutical compositions disclosed herein for treating and/or ameliorating a disease or condition associated with ALK7 signaling, altered ALK7 expression, and/or that can be ameliorated by reduced ALK7 signaling.
  • the disease or condition treated using the pharmaceutical composition provided herein is obesity (e.g., abdominal obesity); overweight; insulin resistance; metabolic syndrome and other metabolic diseases or conditions; a lipid disorder such as, low HDL levels, high LDL levels, hyperlipidemia, hypertriglyceridemia or dyslipidemia; lipoprotein aberrations; decreased triglycerides; inflammation (e.g., liver inflammation and/or inflammation of adipose tissue), fatty liver disease; non-alcoholic fatty liver disease; hyperglycemia; impaired glucose tolerance (IGT); hyperinsulinemia; high cholesterol (e.g., high LDL levels and hypercholesterolemia); cardiovascular disease such as, heart disease including coronary heart disease, congestive heart failure, stroke, peripheral vascular disease, atherosclerosis; arteriosclerosis, and hypertension; Syndrome X; vascular restenosis; neuropathy; retinopathy; neurodegenerative disease; endothelial dysfunction, respiratory dysfunction, renal disease (e.g., nephropathy); pancreatitis
  • a pharmaceutical composition contains an ALK7-binding protein (e.g., an anti-ALK antagonist antibody) and a pharmaceutically acceptable carrier, and the ALK7 binding protein further comprises a labeling group or an effector group.
  • a "label” refers to one or more elements, isotopes, or chemical compounds attached to enable the detection in a screen.
  • Labels generally fall into three classes: (a) isotopic labels, which may be radioactive or heavy isotopes, (b) small molecule labels, which may include fluorescent and colorimetric dyes, or molecules such as biotin that enable other labeling methods, and (c) immune labels, which may be an epitope incorporated as a fusion partner that is recognized by an antibody, "Labeling group” refers to any detectable label.
  • the labeling group is coupled to the ALK7-binding protein via a spacer (e.g., a peptide spacer) to reduce potential steric hindrance. Labels may be incorporated into the compound at any position and may be incorporated in vitro or in vivo during protein expression.
  • the labeling group is selected from the group consisting of: isotopic labels, magnetic labels, redox active moieties, optical dyes, biotinylated groups and polypeptide epitopes recognized by a secondary reporter.
  • the labeling group is a fluorescent protein such as a Green Fluorescent Protein or derivative thereof ⁇ e.g., enhanced GFP, blue fluorescent protein or derivative thereof ⁇ e.g., EBFP (Enhanced Blue Fluorescent Protein), EBFP2, Azurite, mKalamal, cyan fluorescent protein or derivative thereof ⁇ e.g., ECFP (Enhanced Cyan Fluorescent Protein), Cerulean, CyPet), yellow fluorescent protein or derivative thereof ⁇ e.g., YFP, Citrine, Venus, YPet).
  • a fluorescent protein such as a Green Fluorescent Protein or derivative thereof ⁇ e.g., enhanced GFP, blue fluorescent protein or derivative thereof ⁇ e.g., EBFP (Enhanced Blue Fluorescent Protein), EBFP2, Azurite, mKalamal, cyan fluorescent protein or derivative thereof ⁇ e.g., ECFP (Enhanced Cyan Fluorescent Protein), Cerulean, CyPet), yellow fluorescent protein or derivative thereof ⁇ e.g., Y
  • the polypeptide epitope is a member selected from a biotin signaling peptide, histidine peptide (his), hemagglutinin (HA), Flag, gold binding peptide.
  • the effector group is selected from the group consisting of a radioisotope, radionucleotide, a toxin, a therapeutic and a chemotherapeutic agent.
  • the ALK7-binding proteins of the present disclosure have applications in in vitro and in vivo diagnostic and therapeutic utilities.
  • the ALK7-binding proteins can be administered to cells in culture, e.g., in vitro or in vivo, or in a subject, to treat, prevent or diagnose a variety of diseases or conditions.
  • the ALK7- binding proteins are human antibodies, murine antibodies, or humanized antibodies.
  • the method comprises contacting ALK7 with an antagonist ALK7-binding protein.
  • the antagonist ALK7-binding protein is an anti-ALK7 antibody. In some instances the method is performed in vivo. In other instances, the method is performed in vitro.
  • the blocked ALK7 activity is selected from (a) decreasing the formation of a complex containing ALK7, a type II receptor ⁇ e.g., ActRIIA or ActRIIB), and one or more TGF-beta superfamily ligands ⁇ e.g., activin B, activin AB, Nodal, GDF1, GDF3 and/or GDF8) on the surface of cells expressing ALK7 and the ActRII receptor in the presence of the one or more TGF-beta superfamily ligands; (b) competing with one or more type II receptors for binding to ALK7; (c) competing with one or more TGF-beta superfamily ligands (e.g., activin B, activin AB, Nodal, GDF1, GDF3 and/or GDF8) for binding to ALK7; (d) decreasing the phosphorylation of ALK7 in cells expressing ALK7 and a type II receptor (e.g., ActRIIA or ActRIIB)
  • the ALK7-binding protein is an ALK7 antagonist (e.g., a neutralizing anti-ALK7 antibody).
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipocyte cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay using adipocyte cells (e.g., white adipocytes) by 5% to 100%), 10%) to 80%), or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF 1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the ALK7-binding protein has 2, 3, or 4 of the above characteristics. In some embodiments, the ALK7-binding protein has at least 2, at least 3, or at least 4, of the above characteristics.
  • the disclosure provides for the treatment, prevention and/or amelioration of a disease or condition that comprises administering an ALK7-binding protein (e.g., an anti-ALK antagonist antibody) to a subject that has a disease or condition, or is at risk of developing a disease or condition, associated with ALK7 signaling, altered ALK7 expression, and/or can be ameliorated by reduced ALK7 signaling.
  • an ALK7-binding protein e.g., an anti-ALK antagonist antibody
  • the treatment includes the administration of an ALK7- binding protein to an isolated tissue or cells from a subject, where the subject has a disease or condition, or is at risk of developing a disease or condition, associated with ALK7 expression or ALK7 signaling.
  • the disclosure provides pharmaceutical compositions comprising an ALK7- binding protein and a pharmaceutically acceptable carrier.
  • Also provided are methods for treating and/or ameliorating conditions associated with an ALK7-mediated activity in a subject comprising administering to a subject in need thereof an effective amount of a pharmaceutical composition comprising an ALK7-binding protein provided herein.
  • the ALK7-binding protein is administered alone.
  • the ALK7-binding protein is administered as a combination therapy.
  • methods of reducing ALK7 activity in a subject comprising administering an effective amount of an ALK7-binding protein to a subject in need thereof.
  • an effective amount of an ALK7-binding protein can be administered for reducing body weight (e.g., promoting weight loss), reducing body weight gain (e.g., preventing weight gain), and/or treating obesity.
  • the ALK7-binding protein is an antibody disclosed herein.
  • the ALK7-binding protein is an ALK7 antagonist antibody.
  • the administered anti-ALK7-antibody cross- blocks or competes for binding ALK7 with an antibody having a VH and a VL pair disclosed in Table 1A.
  • the administered anti-ALK7-antibody binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table 1A. In some embodiments, the administered anti-ALK7-antibody cross-blocks or competes for binding ALK7 with an antibody having a VH and a VL pair disclosed in Table IB or Table 3. In some embodiments, the administered anti-ALK7-antibody binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table IB or Table 3. In certain instances, the subject has type 2 diabetes mellitus.
  • the disclosure provides a method of reducing body weight comprising administering to a subject desiring to reduce body weight, or in need thereof, an effective amount of an ALK7-binding protein (e.g., an antagonist antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment).
  • an ALK7-binding protein e.g., an antagonist antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment.
  • the ALK7-binding protein is an antibody disclosed herein.
  • the ALK7-binding protein is an ALK7 antagonist antibody.
  • the administered antagonist anti-ALK7-antibody cross-blocks or competes for binding ALK7 with an antibody having a VH and a VL pair disclosed in Table 1 A.
  • the administered antagonist anti-ALK7-antibody binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table 1A. In some embodiments, the administered antagonist anti-ALK7-antibody cross-blocks or competes for binding ALK7 with an antibody having a VH and a VL pair disclosed in Table IB or Table 3. In some embodiments, the administered antagonist anti-ALK7- antibody binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table IB or Table 3. In some embodiments, the subject is overweight (e.g., pre-obese).
  • the subject has a body mass index (BMI) of 25 kg/m 2 or greater. In further embodiments, the subject has a BMI of 25 kg/m 2 to 29.9 kg/m 2 , 30 kg/m 2 to 39.9 mkg/m 2 , 25 kg/m 2 to 39.9 kg/m 2 , or 25 kg/m 2 to 50 kg/m 2 . In some embodiments, the subject is obese. In some embodiments, the subject has a BMI of 30 kg/m 2 or greater (e.g., 30 to 39.9 kg/m 2 or 30 kg/m 2 to 50 kg/m 2 ). In some embodiments, the subject is morbidly obese.
  • BMI body mass index
  • the subject has a BMI of 40 kg/m 2 or greater. In further embodiments, the subject has a BMI of 40 kg/m 2 to 45 kg/m 2 , or 40 kg/m 2 to 50 kg/m 2 .
  • the subject has central obesity (e.g., excess adiposity in the abdominal region, including belly fat and/or visceral fat).
  • the subject has a waist/hip circumference ratio (WHR) of 0.85 or greater.
  • WHR waist/hip circumference ratio
  • the subject has peripheral obesity (e.g., excess adiposity on the hips).
  • the subject has type 2 diabetes mellitus.
  • the ALK7-binding protein is administered alone or as a combination therapy. In some embodiments, the administration is an adjunct to diet and/or exercise.
  • the disclosure provides a method of reducing weight gain comprising administering to a subject desiring to reduce weight gain, or in need thereof, an effective amount of an ALK7-binding protein (e.g., an antagonist antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment).
  • an ALK7-binding protein e.g., an antagonist antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment.
  • the ALK7-binding protein is an antibody disclosed herein.
  • the ALK7-binding protein is an ALK7 antagonist antibody.
  • the administered antagonist anti-ALK7-antibody cross-blocks or competes for binding ALK7 with an antibody having a VH and a VL pair disclosed in Table 1 A.
  • the administered antagonist anti-ALK7-antibody binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table 1A. In some embodiments, the administered antagonist anti-ALK7-antibody cross-blocks or competes for binding ALK7 with an antibody having a VH and a VL pair disclosed in Table IB or Table 3. In some embodiments, the administered antagonist anti-ALK7- antibody binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table IB or Table 3. In some embodiments, the subject is overweight (e.g., pre-obese). In some embodiments, the subject has a BMI of 25 kg/m 2 or greater. In further embodiments, the subject has a BMI of 25 kg/m 2 to 29.9 kg/m 2 , 30 kg/m 2 to 39.9
  • the subject is obese.
  • the subject has a BMI of 30 kg/m 2 or greater (e.g., 30 to 39.9 kg/m 2 or 30 kg/m 2 to 50 kg/m 2 ).
  • the subject is morbidly obese.
  • the subject has a BMI of 40 kg/m 2 or greater.
  • the subject has a BMI of 40 kg/m 2 to 45 kg/m 2 , or 40 kg/m 2 to 50 kg/m 2 .
  • the subject has type 2 diabetes mellitus.
  • Also provided is a method of treating or preventing a disease or condition associated with excess body weight comprising administering to a subject in need of treatment or prevention, an effective amount of an ALK7-binding protein (e.g., an antagonist antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment).
  • an ALK7-binding protein e.g., an antagonist antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment.
  • the administered ALK7-binding protein binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table 1A.
  • the administered ALK7- binding protein binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table IB or Table 3.
  • the treated or prevented disease or condition is obesity. In one embodiment, the treated or prevented disease or condition is insulin resistance. In one embodiment, the treated or prevented disease or condition is a member selected from the group consisting of: dyslipidemia, hyperlipidemia (total cholesterol level >240 mg/dL), hypercholesterolemia (e.g., total cholesterol level of >200 mg/dL, >220 mg/dL, >240 mg/dL, >250 mg/dL, or >275 mg/dL), low HDL serum level (e.g., ⁇ 40mg/dL, ⁇ 45 mg/dL, or ⁇ 50 mg/dL), high LDL serum level (e.g., > 100 mg/dL, > 130 mg/dL, > 160 mg/dL, or > 190 mg/dL), and hypertriglyceridemia (e.g., a fasting TG level of > 150 mg/dL, > 175 mg/dL, > 200 mg/dL, > 300 mg/dL, > 400 mg
  • the administration is an adjunct to diet and/or exercise.
  • the disclosure provides a method of reducing body weight in a subject who is overweight.
  • the method includes administering to an overweight subject an effective amount of an ALK7-binding protein (e.g., an antagonist antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment).
  • an ALK7-binding protein e.g., an antagonist antibody
  • the administered ALK7-binding protein e.g., an antagonist antibody
  • the administered ALK7-binding protein (e.g., an antagonist antibody) cross-blocks or competes for binding ALK7 with an antibody having a VH and a VL pair disclosed in Table 1A.
  • the administered ALK7-binding protein (e.g., an antagonist antibody) binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table 1A.
  • the administered ALK7-binding protein e.g., an antagonist antibody
  • the administered ALK7-binding protein (e.g., an antagonist antibody) cross-blocks or competes for binding ALK7 with an antibody having a VH and a VL pair disclosed in Table IB or Table 3.
  • the administered ALK7-binding protein (e.g., an antagonist antibody) binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table IB or Table 3.
  • the subject has a body mass index (BMI) of 25 kg/m 2 or greater.
  • the subject has a BMI of 25 kg/m 2 to 29.9 kg/m 2 , 30 kg/m 2 to 39.9 mkg/m 2 , 25 kg/m 2 to 39.9 kg/m 2 , or 25 kg/m 2 to 50 kg/m 2 ' or 27 to 40 kg/m 2 .
  • the subject is obese.
  • the subject has a BMI of 30 kg/m 2 or greater (e.g., 30 to 39.9 kg/m 2 or 30 kg/m 2 to 50 kg/m 2 ).
  • the ALK7-binding protein is administered alone or as a combination therapy. In some embodiments, the administration is an adjunct to diet and/or exercise.
  • the disclosure provides a method of reducing body weight in an obese subject.
  • the method includes administering to the subject an effective amount of an ALK7-binding protein (e.g., an antagonist antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment).
  • an ALK7-binding protein e.g., an antagonist antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment.
  • the administered ALK7-binding protein e.g., an antagonist antibody
  • the administered ALK7-binding protein binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table 1A.
  • the administered ALK7-binding protein (e.g., an antagonist antibody) cross-blocks or competes for binding ALK7 with an antibody having a VH and a VL pair disclosed in Table IB or Table 3.
  • the administered ALK7-binding protein (e.g., an antagonist antibody) binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table IB or Table 3.
  • the subject has a BMI of 30 kg/m 2 or greater (e.g., 30 to 39.9 kg/m 2 or 30 kg/m 2 to 50 kg/m 2 In some embodiments, the subject has a BMI of 40 kg/m 2 or greater.
  • the subject has central obesity (e.g., excess adiposity in the abdominal region, including belly fat and/or visceral fat). In some embodiments, the subject has a waist/hip circumference ratio (WHR) of 0.85 or greater. In some embodiments, the subject has peripheral obesity (e.g., excess adiposity on the hips).
  • WHR waist/hip circumference ratio
  • the ALK7-binding protein is administered alone or as a combination therapy. In some embodiments, the administration is an adjunct to diet and/or exercise.
  • the disclosure provides a method of treating and/or ameliorating obesity or a disease or condition associated with obesity, comprising administering to an obese subject, an effective amount of an ALK7-binding protein (e.g., an antagonist antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment).
  • an ALK7-binding protein e.g., an antagonist antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment.
  • the antagonist ALK7-binding protein is an antibody disclosed herein.
  • the ALK7-binding protein is an antibody disclosed herein.
  • the ALK7-binding protein is an ALK7 antagonist antibody.
  • the administered antagonist anti-ALK7- antibody cross-blocks or competes for binding ALK7 with an antibody having a VH and a VL pair disclosed in Table 1A.
  • the administered antagonist anti- ALK7-antibody binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table 1A. In some embodiments, the administered antagonist anti- ALK7-antibody cross-blocks or competes for binding ALK7 with an antibody having a VH and a VL pair disclosed in Table IB or Table 3. In some embodiments, the administered antagonist anti-ALK7-antibody binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table IB or Table 3. In some embodiments, the subject has a BMI of 30 kg/m 2 or greater.
  • the subject has a BMI of 30 to 39.9 kg/m 2 or 30 kg/m 2 to 50 kg/m 2 .
  • the subject is morbidly obese.
  • the subject has a body BMI of 40 kg/m 2 or greater.
  • the subject has a BMI of 40 kg/m 2 to 45 kg/m 2 , or 40 kg/m 2 to 50 kg/m 2
  • the subject has type 2 diabetes mellitus.
  • the subject has a BMI of 30 kg/m 2 or greater (e.g., 30 to 39.9 kg/m 2 ).
  • the subject has a BMI of at least 40 kg/m 2 .
  • the subject has central obesity (e.g., excess adiposity in the abdominal region, including belly fat and/or visceral fat). In some embodiments, the subject has a waist/hip circumference ratio (WHR) of 0.85 or greater. In some embodiments, the subject has peripheral obesity (e.g., excess adiposity on the hips).
  • WHR waist/hip circumference ratio
  • the ALK7-binding protein is administered alone or as a combination therapy. In some embodiments, the administration is an adjunct to diet and/or exercise.
  • Also provided is a method of treating or preventing a disease or condition associated with obesity comprising administering to a subject in need of treatment or prevention, an effective amount of an ALK7-binding protein (e.g., an antagonist antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment).
  • an ALK7-binding protein e.g., an antagonist antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment.
  • the administered ALK7-binding protein e.g., an antagonist antibody
  • the administered ALK7-binding protein binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table 1 A.
  • the administered ALK7- binding protein (e.g., an antagonist antibody) cross-blocks or competes for binding ALK7 with an antibody having a VH and a VL pair disclosed in Table IB or Table 3.
  • the administered ALK7-binding protein e.g., an antagonist antibody
  • the treated or prevented disease or condition is a member selected from the group consisting of: dyslipidemia, hyperlipidemia (total cholesterol level >240 mg/dL), hypercholesterolemia (e.g., total cholesterol level of >200 mg/dL, >220 mg/dL, >240 mg/dL, >250 mg/dL, or >275 mg/dL), low HDL serum level (e.g., ⁇ 40mg/dL, ⁇ 45 mg/dL, or ⁇ 50 mg/dL), high LDL serum level (e.g., > 100 mg/dL, > 130 mg/dL, > 160 mg/dL, or > 190 mg/dL), and hypertriglyceridemia (e.g., a fasting TG level of > 150 mg/dL, > 175 mg/dL, > 200 mg/dL, > 300 mg/dL, > 400 mg/dL, or > 499 mg/dL).
  • dyslipidemia total cholesterol level >240 mg/dL
  • the treated or prevented disease or condition is cardiovascular disease.
  • the treated or prevented disease or condition is hypertension (high blood pressure), myocardial infarction, stroke, peripheral artery disease, vasoregulatoin dysfunction, arteriosclerosis congestive heart failure, atherosclerosis, coronary heart disease, or microvascular disease.
  • the treated or prevented disease or condition is inflammation.
  • the treated or prevented disease or condition is a member selected from the group: retinopathy, bowel disease, ulcerative colitis, and asthma, inflammation (e.g., inflammation of the liver and/or inflammation of adipose tissue).
  • the treated or prevented disease or condition is liver disease.
  • the treated or prevented liver disease or condition is NAFLD.
  • the liver disease is fatty liver. In one embodiment, the liver disease is NASH. In another embodiment, the treated or prevented disease or condition is a member selected from the group: steatohepatitis, steatosis, fibrosis, and/or cirrhosis.
  • the treated or prevented disease or condition is a member selected from the group consisting of: cataract, macular degeneration, obstructive sleep apnea, phlebitis, gout, osteoarthritis, gallbladder disease, renal disease, pulmonary disease (e.g., asthma, hypoventilation syndrome, or respiratory dysfunction), and/or cancer (e.g., ovarian, breast, endometrial, liver, kidney, and/or colon cancer, and/or cancer metastasis (e.g., lymphatic metastasis, bloodstream metastasis, and/or tumor growth and invasion).
  • the treated or prevented disease or condition is infection.
  • the treated or prevented disease or condition is a slow healing or nonhealing wound.
  • the administration is an adjunct to diet and/or exercise.
  • the disclosure provides a method of reducing liver fat comprising administering an effective amount of an ALK7-binding protein (e.g., an antagonist antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment) to a subject in need thereof.
  • an ALK7-binding protein e.g., an antagonist antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment
  • the ALK7- binding protein is an antibody disclosed herein.
  • the ALK7- binding protein is an ALK7 antagonist antibody.
  • the administered antagonist anti-ALK7-antibody cross-blocks or competes for binding ALK7 with an antibody having a VH and a VL pair disclosed in Table 1A.
  • the administered antagonist anti-ALK7-antibody binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table 1A. In some embodiments, the administered antagonist anti-ALK7-antibody cross-blocks or competes for binding ALK7 with an antibody having a VH and a VL pair disclosed in Table IB or Table 3. In some embodiments, the administered antagonist anti-ALK7-antibody binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table IB or Table 3. In some embodiments, the subject is overweight (e.g., pre-obese).
  • the subject has a body mass index (BMI) of 25 kg/m 2 or greater. In further embodiments, the subject has a BMI of 25 kg/m 2 to 29.9 kg/m 2 , 30 kg/m 2 to 39.9 mkg/m 2 , 25 kg/m 2 to 39.9 kg/m 2 , or 25 kg/m 2 to 50 kg/m 2 . In some embodiments, the subject is obese. In some embodiments, the subject has a BMI of 30 kg/m 2 or greater (e.g., 30 to 39.9 kg/m 2 or 30 kg/m 2 to 50 kg/m 2 ). In some embodiments, the subject is morbidly obese.
  • BMI body mass index
  • the subject has a BMI of 40 kg/m 2 or greater. In further embodiments, the subject has a BMI of 40 kg/m 2 to 45 kg/m 2 , or 40 kg/m 2 to 50 kg/m 2 .
  • the subject has central obesity (e.g., excess adiposity in the abdominal region, including belly fat and/or visceral fat).
  • the subject has a waist/hip circumference ratio (WHR) of 0.85 or greater.
  • WHR waist/hip circumference ratio
  • the subject has peripheral obesity (e.g., excess adiposity on the hips).
  • the subject has type 2 diabetes mellitus.
  • the ALK7-binding protein is administered alone or as a combination therapy. In some embodiments, the administration is an adjunct to diet and/or exercise.
  • the disclosure provides a method of treating, ameliorating, and/or preventing type 2 diabetes mellitus or a disease or condition associated with diabetes comprising administering to a subject having type 2 diabetes mellitus, or at risk of developing type 2 diabetes, an effective amount of an ALK7- binding protein (e.g., an antagonist antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment).
  • an ALK7-binding protein e.g., an antagonist antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment.
  • the ALK7-binding protein is an antibody disclosed herein.
  • the ALK7-binding protein is an ALK7 antagonist antibody.
  • the administered antagonist anti- ALK7-antibody cross-blocks or competes for binding ALK7 with an antibody having a VH and a VL pair disclosed in Table 1A.
  • the administered antagonist anti-ALK7-antibody binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table 1A. In some embodiments, the administered antagonist anti-ALK7-antibody cross-blocks or competes for binding ALK7 with an antibody having a VH and a VL pair disclosed in Table IB or Table 3. In some embodiments, the administered antagonist anti-ALK7-antibody binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table IB or Table 3. In some embodiments, the subject has a body mass index BMI of 30 kg/m 2 or greater (e.g., 30 to 39.9 kg/m 2 ).
  • the subject has a BMI of at least 40 kg/m 2 .
  • the subj ect has central obesity (e.g., excess adiposity in the abdominal region, including belly fat and/or visceral fat).
  • the subject has a WHR of 0.85 or greater.
  • the subject has peripheral obesity (e.g., excess adiposity on the hips).
  • the ALK7-binding protein is administered alone or as a combination therapy. In some embodiments, the administration is an adjunct to diet and/or exercise.
  • Also provided is a method of treating, ameliorating or preventing a disease or condition associated with diabetes comprising administering to a subject having diabetes, an effective amount of an ALK7-binding protein (e.g., an antagonist antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment).
  • an ALK7-binding protein e.g., an antagonist antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment.
  • the administered ALK7-binding protein e.g., an antagonist antibody
  • the administered ALK7-binding protein binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table 1 A.
  • the administered ALK7- binding protein (e.g., an antagonist antibody) cross-blocks or competes for binding ALK7 with an antibody having a VH and a VL pair disclosed in Table IB or Table 3.
  • the administered ALK7-binding protein e.g., an antagonist antibody
  • the treated or prevented disease or condition is a member selected from the group consisting of: dyslipidemia, hyperlipidemia (total cholesterol level >240 mg/dL), hypercholesterolemia (e.g., total cholesterol level of >200 mg/dL, >220 mg/dL, >240 mg/dL, >250 mg/dL, or >275 mg/dL), low HDL serum level (e.g., ⁇ 40mg/dL, ⁇ 45 mg/dL, or ⁇ 50 mg/dL), high LDL serum level (e.g., > 100 mg/dL, > 130 mg/dL, > 160 mg/dL, or > 190 mg/dL), and hypertriglyceridemia (e.g., a fasting TG level of > 150 mg/dL, > 175 mg/dL, > 200 mg/dL, > 300 mg/dL, > 400 mg/dL, or > 499 mg/dL).
  • dyslipidemia total cholesterol level >240 mg/dL
  • the treated or prevented disease or condition is cardiovascular disease.
  • the treated or prevented disease or condition is hypertension (high blood pressure), myocardial infarction, stroke, peripheral artery disease, vasoregulatoin dysfunction, or arteriosclerosis.
  • the treated or prevented disease or condition is inflammation (e.g., systemic inflammation, inflammation of the liver, and inflammation of adipose tissue).
  • the treated or prevented disease or condition is a member selected from the group: atherosclerosis, retinopathy, bowel disease, ulcerative colitis, asthma, inflammation of the liver, and/or inflammation of adipose tissue).
  • the treated or prevented disease or condition is liver disease.
  • the treated or prevented disease or condition is a member selected from the group: fatty liver disease, Steatohepatitis, steatosis, and/or cirrhosis.
  • the treated or prevented disease or condition is a member selected from the group consisting of: cataract, macular degeneration, obstructive sleep apnea, phlebitis, gout, osteoarthritis, gallbladder disease, high cholesterol, pulmonary disease (e.g., asthma, and/or hypoventilation syndrome), neuropathy, retinopathy, vasculopathy microangiopathy, nephropathy, renal failure, and/or cancer (e.g., ovarian, breast, endometrial, liver, kidney, pancreatic, and/or colon cancer), and cancer metastasis (e.g., lymphatic metastasis, bloodstream metastasis, and/or tumor growth and invasion).
  • the treated or prevented disease or condition is infection or a nonhealing wound.
  • the disclosure also provides a method for improving the blood-lipid profile in a subject, comprising administering to a subject in need of such treatment an effective amount of an ALK7-binding protein (e.g., an antagonist (neutralizing) antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment).
  • an ALK7-binding protein e.g., an antagonist (neutralizing) antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment.
  • the antagonist ALK7-binding protein is an antibody disclosed herein.
  • the ALK7-binding protein is an antibody disclosed herein.
  • the ALK7-binding protein is an ALK7 antagonist antibody.
  • the administered antagonist anti-ALK7-antibody cross-blocks or competes for binding ALK7 with an antibody having a VH and a VL pair disclosed in Table 1 A.
  • the administered antagonist anti-ALK7-antibody binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table 1A.
  • the ALK7-binding protein is an ALK7 antagonist antibody.
  • the administered antagonist anti-ALK7-antibody cross-blocks or competes for binding ALK7 with an antibody having a VH and a VL pair disclosed in Table IB or Table 3.
  • the administered antagonist anti-ALK7-antibody binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table IB or Table 3.
  • the disclosure provides a method for reducing levels of LDL cholesterol or increasing levels of HDL-cholesterol.
  • the subject has dyslipidemia.
  • the subject has elevated serum lipids (e.g., cholesterol (hypercholesterolemia) and/or triglycerides (e.g., hypertriglyceridemia).
  • the subject has an LDL-C > 100 mg/dL, > 130 mg/dL, or > 160 mg/dL).
  • the subject has a TG > 150 mg/dL, > 160 mg/dL, > 170 mg/dL).
  • the subject has elevated plasma insulin levels (hyperinsulinemia; e.g., fasting insulin level of >20 ug/ml can exceed 100).
  • the subject has type II diabetes.
  • the disclosure provides a method of treating or preventing a metabolic disease or disorder or a condition associated with a metabolic disease or disorder, comprising administering an ALK7-binding protein (e.g., an antagonist antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment) to a subject in need thereof.
  • an ALK7-binding protein e.g., an antagonist antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment
  • the treated metabolic disease, disorder, or condition is hyperglycemia (e.g., > 130 mg/dL in the fasting state or following glucose administration during an oral glucose tolerance test).
  • the treated metabolic disease, disorder, or condition is a lipid metabolism disease, disorder, or condition.
  • the treated metabolic disease, disorder, or condition is dislipidemia.
  • the lipid metabolism disease, disorder, or condition is a member selected from: low HDL levels, high LDL levels, high triglyceride levels, hyperlipidemia, and a lipoprotein aberration.
  • the subject to which the ALK-7 binding protein is administered has a total cholesterol level of >200 mg/dL, >220 mg/dL, >240 mg/dL, >250 mg/dL, or >275 mg/dL.
  • the subject to which the ALK-7 binding protein is administered has a HDL serum level of ⁇ 40mg/dL, ⁇ 45 mg/dL, or ⁇ 50 mg/dL).
  • the subject to which the ALK-7 binding protein is administered has a LDL serum level > 100 mg/dL, > 130 mg/dL, > 160 mg/dL, or > 190 mg/dL. In one embodiment, the subject to which the ALK-7 binding protein is administered has, fasting TG level of > 150 mg/dL, > 175 mg/dL, > 200 mg/dL, > 300 mg/dL, > 400 mg/dL, or > 499 mg/dL.
  • the treated metabolic disease, disorder, or condition is a glucose metabolism disease, disorder, or condition. In a further embodiment, the glucose metabolism disease, disorder, or condition is a member selected from: glucose intolerance, insulin resistance, impaired glucose tolerance (IGT), impaired fasting glucose (IFG).
  • the treated metabolic disease, disorder, or condition is a member selected from the group consisting of: high uric acid levels, NAFLD, fatty liver, NASH, and polycystic ovarian syndrome.
  • the treated subject has hyperinsulinemia.
  • the treated subject is obese (e.g., the subject has visceral or abdominal obesity).
  • the treated subject has type II diabetes.
  • Metabolic syndrome is a condition involving a set of disorders that enhances the risk of heart disease.
  • the major components of metabolic syndrome are excess weight, the cardiovascular parameters (high blood pressure, dyslipidemia, high levels of triglycerides and/or low levels of HDL in the blood), atherosclerosis, diabetes, and/or insulin resistance.
  • a subject having several of these components, i.e. metabolic syndrome is highly prone to heart disease, though each component is a risk factor.
  • the disclosure also provides a method for treating or preventing 1, 2, 3, or more of the above components of metabolic syndrome, comprising administering to a subject in need of treatment an effective amount of an ALK7-binding protein (e.g., an antagonist antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment).
  • an ALK7-binding protein e.g., an antagonist antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment.
  • a method of treating, preventing or ameliorating a cardiovascular disease or condition comprising administering an ALK7-binding protein (e.g., an antagonist antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment) to a subject in need thereof.
  • an ALK7-binding protein e.g., an antagonist antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment
  • the treated, prevented, or ameliorated cardiovascular disease or condition is atherosclerosis.
  • the treated, prevented, or ameliorated cardiovascular disease or condition is hypertension (e.g., blood pressure >130/80 mmHg or >140/90 mmHg, in a resting state).
  • the cardiovascular disease or condition is peripheral vascular disease, a microvascular or microvascular complication, stroke, and/or retinopathy.
  • the cardiovascular disease is atherosclerosis (coronary heart disease disease).
  • the disclosure provides a method for treating and/or ameliorating an inflammatory disease or condition that comprises administering an ALK7-binding protein (e.g., an antagonist antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment) to a subject in need thereof.
  • the inflammatory disease or condition is chronic inflammation.
  • the inflammatory disease or condition is inflammation of adipose tissue.
  • the disease or condition is inflammation of the liver.
  • the disease or condition is NAFLD.
  • the disease or condition is fatty liver.
  • the disease or condition is steatosis (e.g., nonalcoholic Steatohepatitis (NASH).
  • NASH nonalcoholic Steatohepatitis
  • This disclosure also provides a method of improving glycemic control, comprising administering to a subject in need of treatment an effective amount of an ALK7-binding protein (e.g., an antagonist antibody that specifically binds ALK7 or an antagonist ALK7- binding antibody fragment).
  • an ALK7-binding protein e.g., an antagonist antibody that specifically binds ALK7 or an antagonist ALK7- binding antibody fragment.
  • the subject to which the ALK7-binding protein is administered has a fasting blood sugar level of >130, >135, >140, >145, or >150 mg/dL.
  • the subject to which the ALK7-binding protein is administered has a postprandial blood sugar level of >180, >185, >190, >195, or >200 mg/dL 2 hours after eating.
  • the administration is an adjunct to diet and/or exercise.
  • the administration can also reduce body weight or treat obesity.
  • the subject has type 2 diabetes mellitus.
  • the subject has a BMI of 27 to 40 kg/m2.
  • the subject has a BMI of 30 to 39.9 kg/m2.
  • the subject has a BMI of at least 40.
  • the subject is overweight.
  • the subject is obese.
  • An improvement in glycemic control can be assessed using techniques known in the art such as a mixed-meal test.
  • compositions and methods for treating, preventing or ameliorating hyperglycemia or a condition associated with hyperglycemia in a subject comprising administering to a subject in need of such treatment an effective amount of an ALK7-binding protein (e.g., an antagonist anti-ALK7 antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment).
  • an ALK7-binding protein e.g., an antagonist anti-ALK7 antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment.
  • the subject to which the ALK7-binding protein is administered has a fasting blood sugar level of >130, >135, >140, >145, or >150 mg/dL.
  • the subject to which the ALK7-binding protein is administered has a postprandial blood sugar level of >180, >185, >190, >195, or >200 mg/dL 2 hours after eating.
  • the result of the treatment, prevention or amelioration is a member selected from the group consisting of: a decrease in serum levels of glucose, a decrease in serum levels of triglycerides, a decrease in serum levels of insulin, and/or a decrease in serum levels of non-esterified fatty acids, as compared to serum levels in the subject prior to treatment.
  • the result of the treatment, prevention or amelioration is an increase in body temperature of about 0.4°C to 1°C as compared to body temperature of the subject prior to treatment.
  • the ALK7-binding protein is an antagonist anti- ALK7 protein. In some embodiments, the ALK7-binding protein is an antagonist anti- ALK7 antibody or an ALK7-binding fragment thereof. In some embodiments, the ALK7-binding protein is an antagonist anti-ALK7 antibody or an ALK7-binding fragment thereof disclosed herein. In some embodiments, the administered antagonist anti-ALK7-antibody cross-blocks or competes for binding ALK7 with an antibody having a VH and a VL pair disclosed in Table 1A. In some embodiments, the administered antagonist anti-ALK7-antibody binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table 1A.
  • the administered antagonist anti-ALK7-antibody cross-blocks or competes for binding ALK7 with an antibody having a VH and a VL pair disclosed in Table IB or Table 3. In some embodiments, the administered antagonist anti-ALK7-antibody binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table IB or Table 3. In some embodiments, the administration also reduces body weight of the subject.
  • the disclosure provides a method of decreasing plasma insulin levels in a subject, comprising administering an effective amount of an ALK7- binding protein (e.g., an antagonist anti-ALK7 antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment) to a subject in need of such treatment.
  • an ALK7-binding protein e.g., an antagonist anti-ALK7 antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment
  • the subject to which the ALK7-binding protein is administered has a fasting blood sugar level of >130, >135, >140, >145, or >150 mg/dL.
  • the subject to which the ALK7-binding protein is administered has a postprandial blood sugar level of >180, >185, >190, >195, or >200 mg/dL 2 hours after eating.
  • the subject is overweight.
  • the subject is obese. In another embodiment, the subject has type 2 diabetes.
  • the ALK7- binding protein is an antagonist anti-ALK7 protein. In some embodiments, the ALK7- binding protein is an antagonist anti-ALK7 antibody or an ALK7-binding fragment thereof. In some embodiments, the ALK7-binding protein is an antagonist anti-ALK7 antibody or an ALK7-binding fragment thereof disclosed herein. In some embodiments, the administered antagonist anti-ALK7-antibody cross-blocks or competes for binding ALK7 with an antibody having a VH and a VL pair disclosed in Table 1A.
  • the administered antagonist anti-ALK7-antibody binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table 1A. In some embodiments, the administered antagonist anti-ALK7-antibody cross-blocks or competes for binding ALK7 with an antibody having a VH and a VL pair disclosed in Table IB or Table 3. In some embodiments, the administered antagonist anti-ALK7-antibody binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table IB or Table 3
  • compositions and methods for treating, preventing or ameliorating hyperglycemia or a condition associated with hyperglycemia in a subject comprising administering to a subject in need of such treatment an effective amount of an ALK7-binding protein (e.g., an antagonist anti-ALK7 antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment).
  • an ALK7-binding protein e.g., an antagonist anti-ALK7 antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment.
  • the subject to which the ALK7-binding protein is administered has a fasting blood sugar level of >130, >135, >140, >145, or >150 mg/dL.
  • the subject to which the ALK7-binding protein is administered has a postprandial blood sugar level of >180, >185, >190, >195, or >200 mg/dL 2 hours after eating.
  • the result of the treatment, prevention or amelioration is a member selected from the group consisting of: a decrease in serum levels of glucose, a decrease in serum levels of triglycerides, a decrease in serum levels of insulin, and/or a decrease in serum levels of non-esterified fatty acids, as compared to serum levels in the subject prior to treatment.
  • the result of the treatment, prevention or amelioration is an increase in body temperature of about 0.4°C to 1°C as compared to body temperature of the subject prior to treatment.
  • the ALK7-binding protein is an antagonist anti- ALK7 protein. In some embodiments, the ALK7-binding protein is an antagonist anti- ALK7 antibody or an ALK7-binding fragment thereof. In some embodiments, the ALK7-binding protein is an antagonist anti-ALK7 antibody or an ALK7-binding fragment thereof disclosed herein. In some embodiments, the administered antagonist anti-ALK7-antibody cross-blocks or competes for binding ALK7 with an antibody having a VH and a VL pair disclosed in Table 1A. In some embodiments, the administered antagonist anti-ALK7-antibody binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table 1A.
  • the administered antagonist anti-ALK7-antibody cross-blocks or competes for binding ALK7 with an antibody having a VH and a VL pair disclosed in Table IB or Table 3.
  • the administered antagonist anti-ALK7-antibody binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table IB or Table 3
  • the administration also reduces body weight of the subject.
  • the disclosure provides a method of decreasing plasma insulin levels in a subject, comprising administering an effective amount of an ALK7- binding protein (e.g., an antagonist anti-ALK7 antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment) to a subject in need of such treatment.
  • an ALK7-binding protein e.g., an antagonist anti-ALK7 antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment
  • the subject to which the ALK7-binding protein is administered has a fasting blood sugar level of >130, >135, >140, >145, or >150 mg/dL.
  • the subject to which the ALK7-binding protein is administered has a postprandial blood sugar level of >180, >185, >190, >195, or >200 mg/dL 2 hours after eating.
  • the subject is overweight.
  • the subject is obese. In another embodiment, the subject has type 2 diabetes.
  • the ALK7- binding protein is an antagonist anti-ALK7 protein. In some embodiments, the ALK7- binding protein is an antagonist anti-ALK7 antibody or an ALK7-binding fragment thereof. In some embodiments, the ALK7-binding protein is an antagonist anti-ALK7 antibody or an ALK7-binding fragment thereof disclosed herein. In some embodiments, the administered antagonist anti-ALK7-antibody cross-blocks or competes for binding ALK7 with an antibody having a VH and a VL pair disclosed in Table 1A.
  • the administered antagonist anti-ALK7-antibody binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table 1A. In some embodiments, the administered antagonist anti-ALK7-antibody cross-blocks or competes for binding ALK7 with an antibody having a VH and a VL pair disclosed in Table IB or Table 3. In some embodiments, the administered antagonist anti-ALK7-antibody binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table IB or Table 3.
  • the disclosure provides a method of treating, preventing, or ameliorating liver disease in a subject, comprising administering an effective amount of an ALK7-binding protein (e.g., an antagonist anti-ALK7 antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment) to a subject having a liver disease.
  • an ALK7-binding protein e.g., an antagonist anti-ALK7 antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment
  • the subject has inflammation of the liver.
  • the subject has NAFLD.
  • the subject has fatty liver.
  • the subject has NASH.
  • the treated, prevented or ameliorated liver disease is fibrosis, scarring, cirrhosis, or liver failure.
  • the treated, prevented or ameliorated liver disease is liver cancer.
  • the subject is overweight.
  • the subject is obese. In another embodiment, the subject has type 2 diabetes.
  • the ALK7- binding protein is an antagonist anti-ALK7 protein. In some embodiments, the ALK7- binding protein is an antagonist anti-ALK7 antibody or an ALK7-binding fragment thereof. In some embodiments, the ALK7-binding protein is an antagonist anti-ALK7 antibody or an ALK7-binding fragment thereof disclosed herein. In some embodiments, the administered antagonist anti-ALK7-antibody cross-blocks or competes for binding ALK7 with an antibody having a VH and a VL pair disclosed in Table 1A.
  • the administered antagonist anti-ALK7-antibody binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table 1A. In some embodiments, the administered antagonist anti-ALK7-antibody cross-blocks or competes for binding ALK7 with an antibody having a VH and a VL pair disclosed in Table IB or Table 3. In some embodiments, the administered antagonist anti-ALK7-antibody binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table IB or Table 3.
  • the disclosure provides methods of treating and/or ameliorating cancer or a condition associated with cancer, that comprises administering an ALK7-binding protein (e.g., an anti-ALK7 antibody or ALK7-binding fragment thereof) to a subject in need thereof.
  • an ALK7-binding protein e.g., an anti-ALK7 antibody or ALK7-binding fragment thereof.
  • the ALK7-binding protein is an anti-ALK7 antibody or an ALK7-binding fragment thereof.
  • the subject has a cancer selected from the group consisting of a myeloma (e.g., multiple myeloma, plasmacytoma, localized myeloma, or extramedullar myeloma), or an ovarian, breast, colon, endometrial, liver, kidney, pancreatic, gastric, uterine or colon cancer.
  • ALK7-binding protein is administered to treat or prevent lymphatic metastasis, bloodstream metastasis, tumor growth, or tumor invasion,
  • the disclosure provides a method of treating cancer that comprises contacting a cancer cell, tumor associated-stromal cell, or endothelial cell expressing ALK7 with an ALK7-binding protein (e.g., an antagonist anti-ALK7 antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment).
  • the cancer cell is a myeloma (e.g., multiple myeloma, plasmacytoma, localized myeloma, or extramedullary myeloma), ovarian, breast, colon, endometrial, liver, kidney, pancreatic, gastric, uterine and/or colon cancer cell.
  • the contacted cell is from a cancer line.
  • the cancer cell is contacted in vivo.
  • the disclosure provides a method of for increasing lipolysis comprising contacting a white adipocyte or adipose tissue with an antagonist ALK7- binding protein (e.g., an antagonist anti-ALK7 antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment).
  • an antagonist ALK7- binding protein e.g., an antagonist anti-ALK7 antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment.
  • the ALK-7 binding protein increases lipolysis by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in adipose cells by 5% to 100%, 10% to 80%, or 10% to 60%.
  • the ALK7-binding protein increase lipolysis in a lipolysis assay by 5% to 100%), 10% to 80%, or 10% to 60%.
  • the lipolysis assay is performed in the presence of one or more ALK7 ligands selected from the group consisting of: GDF1, GDF3, GDF8, activin B, activin A/B, and Nodal.
  • the antagonist ALK7 binding protein is an antibody.
  • the antagonist anti-ALK7-antibody comprises an antibody provided herein.
  • the antagonist antibody cross-blocks or competes for binding ALK7 with an antibody having a VH and a VL pair disclosed in Table 1A.
  • the antagonist anti-ALK7-antibody binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table 1A.
  • the administered antagonist anti-ALK7-antibody cross-blocks or competes for binding ALK7 with an antibody having a VH and a VL pair disclosed in Table IB or Table 3.
  • the administered antagonist anti-ALK7- antibody binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table IB or Table 3.
  • the white adipose cell or adipose tissue is contacted in vitro.
  • the differentiated white adipose cell or adipose tissue is contacted in vivo.
  • the method is carried out in vivo, for example, in a mammalian subject ⁇ e.g., an animal model).
  • the subject is a human.
  • the method leads to increased glycerol production.
  • the method leads to increased glycerol and/or free fatty acid in an adipocyte culture.
  • the method leads to decreased triglyceride (TG) content m the adipose cell or tissue
  • the method leads to a decreased plasma TG level in a subject.
  • the disclosure provides a method of increasing adrenergic receptor- ⁇ (ADRB) signaling in an adipose cell or tissue.
  • the method comprises contacting a differentiated white adipocyte or adipose tissue with an antagonist ALK7- binding protein ⁇ e.g., an antagonist anti-ALK7 antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment) in an amount sufficient to increase ADRB signaling.
  • the antagonist ALK7 binding protein is an antibody.
  • the antagonist anti-ALK7-antibody comprises an antibody provided herein.
  • the antagonist antibody cross-blocks or competes for binding ALK7 with an antibody having a VH and a VL pair disclosed in Table 1A.
  • the antagonist anti-ALK7-antibody binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table 1A.
  • the administered antagonist anti-ALK7-antibody cross-blocks or competes for binding ALK7 with an antibody having a VH and a VL pair disclosed in Table IB or Table 3.
  • the administered antagonist anti-ALK7- antibody binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table IB or Table 3.
  • the differentiated white adipocyte or adipose tissue is contacted in vitro. In some embodiments the differentiated white adipocyte or adipose tissue is contacted in vivo. In one embodiment, the method is carried out in vivo, for example, in a mammalian subject ⁇ e.g., an animal model). In a further embodiment, the subject is a human. In some embodiments, the method leads to increased glycerol production. In further embodiments, the method leads to increased glycerol and/or free fatty acid in an adipocyte culture. In some embodiments, the method leads to decreased TG content in the adipose cell or tissue. In some embodiments, the method leads to a decreased plasma TG level in a subject. In some embodiments, the method leads to an increased ADRB signaling in an adipocyte or adipose tissue during nutrient overload.
  • the disclosure provides a method of decreasing peroxisome proliferator-activated receptor-gamma (PPAR gamma) signaling in an adipose cell or adipose tissue (e.g., differentiated white adipocytes).
  • the method includes contacting a differentiated white adipocyte or adipose tissue with an antagonist ALK7- binding protein (e.g., an antagonist anti-ALK7 antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment) in an amount effective to decrease PPAR gamma activity.
  • the antagonist ALK7 binding protein is an antibody.
  • the antagonist anti-ALK7-antibody comprises an antibody provided herein.
  • the antagonist antibody cross-blocks or competes for binding ALK7 with an antibody having a VH and a VL pair disclosed in Table 1A.
  • the antagonist anti-ALK7-antibody binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table 1A.
  • the administered antagonist anti-ALK7-antibody cross-blocks or competes for binding ALK7 with an antibody having a VH and a VL pair disclosed in Table IB or Table 3.
  • the administered antagonist anti-ALK7- antibody binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table IB or Table 3.
  • the differentiated white adipocyte or adipose tissue is contacted in vitro. In some embodiments the differentiated white adipocyte or adipose tissue is contacted in vivo. In one embodiment, the method is carried out in vivo, for example, in a mammalian subject (e.g., an animal model). In a further embodiment, the subject is a human. In some embodiments, the method leads to increased glycerol production. In further embodiments, the method leads to increased glycerol and/or free fatty acid in an adipocyte culture. In some embodiments, the method leads to decreased TG content in the adipose cell or tissue. In some embodiments, the method leads to a decreased plasma TG level in a subject.
  • the disclosure provides a method of decreasing insulin resistance in an adipose cell or adipose tissue (e.g., differentiated white adipocytes).
  • the method includes contacting an adipocyte or adipose tissue with an antagonist ALK7- binding protein (e.g., an antagonist anti-ALK7 antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment) in an amount effective to reduce insulin resistance.
  • the antagonist ALK7 binding protein is an antibody.
  • the antagonist anti-ALK7-antibody comprises an antibody provided herein.
  • the antagonist antibody cross-blocks or competes for binding ALK7 with an antibody having a VH and a VL pair disclosed in Table 1 A.
  • the antagonist anti-ALK7-antibody binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table 1A.
  • the administered antagonist anti-ALK7-antibody cross-blocks or competes for binding ALK7 with an antibody having a VH and a VL pair disclosed in Table IB or Table 3.
  • the administered antagonist anti-ALK7-antibody binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table IB or Table 3.
  • the differentiated white adipocyte or adipose tissue is contacted in vitro. In some embodiments the differentiated white adipocyte or adipose tissue is contacted in vivo. In one embodiment, the method is carried out in vivo, for example, in a mammalian subject ⁇ e.g., an animal model). In a further embodiment, the subject is a human.
  • the disclosure provides a method of increasing the metabolic rate of an adipose cell or tissue.
  • the method includes contacting an adipocyte or adipose tissue with an antagonist ALK7-binding protein ⁇ e.g., an antagonist anti-ALK7 antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment) in an amount effective to increase metabolism of the adipocyte or tissue.
  • the antagonist ALK7 binding protein is an antibody.
  • the antagonist anti-ALK7-antibody comprises an antibody provided herein.
  • the antagonist antibody cross-blocks or competes for binding ALK7 with an antibody having a VH and a VL pair disclosed in Table 1A.
  • the antagonist anti-ALK7-antibody binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table 1 A.
  • the administered antagonist anti-ALK7-antibody cross-blocks or competes for binding ALK7 with an antibody having a VH and a VL pair disclosed in Table IB or Table 3.
  • the administered antagonist anti-ALK7-antibody binds to the same epitope of ALK7 as an antibody having a VH and a VL pair disclosed in Table IB or Table 3.
  • the differentiated white adipocyte or adipose tissue is contacted in vitro.
  • the differentiated white adipocyte or adipose tissue is contacted in vivo.
  • the method is carried out in vivo, for example, in a mammalian subject ⁇ e.g., an animal model).
  • the subject is a human.
  • the disclosure provides methods that comprise administering a therapeutically effective amount of a ALK7-binding protein ⁇ e.g., an antagonist anti-ALK7 antibody that specifically binds ALK7 or an antagonist ALK7-binding antibody fragment), alone or in combination with one or more additional therapies ⁇ e.g., one or more additional therapeutic agents) to a subject having, or at risk for developing, an ALK7-mediated disease and/or condition such as, obesity ⁇ e.g., abdominal or visceral obesity); overweight; insulin resistance; metabolic syndrome and other metabolic diseases or conditions; a lipid disorder such as, low HDL levels, high LDL levels, hyperlipidemia, hypertriglyceridemia or dyslipidemia; lipoprotein aberrations; decreased triglycerides; inflammation ⁇ e.g., liver inflammation and/or inflammation of adipose tissue), fatty liver disease; non-alcoholic fatty liver disease; hyperglycemia; impaired glucose tolerance (IGT); hyperinsulinemia; high cholesterol ⁇ e.g., high
  • an ALK7-binding protein provided herein for diagnostic monitoring of protein levels ⁇ e.g., ALK7 levels) in blood or tissue as part of a clinical testing procedure, e.g., to determine the efficacy of a given treatment regimen.
  • detection can be facilitated by coupling an ALK7-binding protein to a detectable substance.
  • detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent materials, and/or radioactive materials.
  • suitable enzymes include horseradish peroxidase, alkaline phosphatase, ⁇ -galactosidase, or acetylcholinesterase;
  • suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin;
  • suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin;
  • an example of a luminescent material includes luminol;
  • bioluminescent materials include luciferase, luciferin, and aequorin; and examples of
  • suitable radioactive material include I, I, S, or H.
  • ALK7-binding protein Methods of preparing and administering an ALK7-binding protein to a subject in need thereof are known to or are readily determined by those of ordinary skill in the art.
  • the route of administration of the ALK7-binding proteins can be, for example, oral, parenteral, by inhalation or topical.
  • parenteral includes, e.g., intravenous, intraarterial, intraperitoneal, intramuscular, intraocular, subcutaneous, rectal, or vaginal administration. While all these forms of administration are clearly contemplated as being within the scope of the disclosure, another example of a form for administration would be a solution for injection, in particular for intravenous or intraarterial injection or drip.
  • a suitable pharmaceutical composition can comprise a buffer (e.g., acetate, phosphate or citrate buffer), a surfactant (e.g., polysorbate), optionally a stabilizer agent (e.g., human albumin), etc.
  • a buffer e.g., acetate, phosphate or citrate buffer
  • a surfactant e.g., polysorbate
  • a stabilizer agent e.g., human albumin
  • ALK7-binding proteins as provided herein can be delivered directly to the organ and/or site of a fibrosis or tumor, thereby increasing the exposure of the diseased tissue to therapeutic agent.
  • the administration is directly to the airway, e.g., by inhalation or intranasal administration.
  • ALK7-binding proteins can be administered in a pharmaceutically effective amount for the in vivo treatment of ALK7-mediated diseases and conditions such as, obesity, diabetes, metabolic disease, dyslipidemia; cardiovascular disease, type 2 diabetes, inflammation, or a cardiovascular, pulmonary, fatty liver disease, neurologic, and hepatic, or renal disease, and and/cancer.
  • ALK7-mediated diseases and conditions such as, obesity, diabetes, metabolic disease, dyslipidemia; cardiovascular disease, type 2 diabetes, inflammation, or a cardiovascular, pulmonary, fatty liver disease, neurologic, and hepatic, or renal disease, and and/cancer.
  • the disclosed ALK7-binding proteins can be formulated so as to facilitate administration and promote stability of the active agent.
  • Pharmaceutical compositions in accordance with the disclosure can comprise a pharmaceutically acceptable, non-toxic, sterile carrier such as physiological saline, non-toxic buffers, preservatives and the like.
  • a pharmaceutically effective amount of a ALK7-binding protein, conjugated or unconjugated means an amount sufficient to achieve effective binding to ALK7 and to achieve a benefit, e.g., to ameliorate symptoms of a disease or condition or to detect a substance or a cell.
  • Suitable formulations for use in therapeutic methods disclosed herein are described in Remington's Pharmaceutical Sciences (Mack Publishing Co.) 16th ed. (1980).
  • compositions provided herein can be orally administered in an acceptable dosage form including, e.g., capsules, tablets, aqueous suspensions or solutions. Certain pharmaceutical compositions also can be administered by nasal aerosol or inhalation. Such compositions can be prepared as solutions in saline, employing benzyl alcohol or other suitable preservatives, absorption promoters to enhance bioavailability, and/or other conventional solubilizing or dispersing agents.
  • ALK7-binding protein e.g., an antibody that specifically binds
  • ALK7 that can be combined with carrier materials to produce a single dosage form will vary depending upon the subject treated and the particular mode of administration.
  • the composition can be administered as a single dose, multiple doses or over an established period of time in an infusion. Dosage regimens also can be adjusted to provide the optimum desired response (e.g., a therapeutic or prophylactic response).
  • ALK7-binding proteins provided herein can be administered to a human or other subject in accordance with the aforementioned methods of treatment in an amount sufficient to produce a therapeutic effect.
  • the ALK7-binding proteins provided herein can be administered to such human or other animal in a conventional dosage form prepared by combining the ALK7-binding proteins with a conventional pharmaceutically acceptable carrier or diluent according to known techniques.
  • the form and character of the pharmaceutically acceptable carrier or diluent can be dictated by the amount of active ingredient with which it is to be combined, the route of administration and other well- known variables.
  • a cocktail comprising one or more different ALK7-binding proteins can also be used.
  • ALK7-mediated disease or condition such as, obesity, diabetes, metabolic disease, dyslipidemia; cardiovascular disease, type 2 diabetes, inflammation, or a cardiovascular, pulmonary, fatty liver disease, neurologic, and hepatic, or renal disease and/or cancer, vary depending upon many different factors, including means of administration, target site, physiological state of the subject, whether the subject is human or an animal, other medications administered, and whether treatment is prophylactic or therapeutic.
  • the subject is a human, but non-human mammals including transgenic mammals can also be treated. Treatment dosages can be titrated using routine methods known to those of ordinary skill in the art to optimize safety and efficacy.
  • ALK7-binding protein to ameliorate the symptoms of a particular disease or condition by administration of an ALK7-binding protein refers to any lessening, whether permanent or temporary, lasting or transient that can be attributed to or associated with administration of the ALK7-binding.
  • the disclosure also provides for the use of an ALK7-binding protein, such as, an anti-ALK7 antibody in the manufacture of a medicament for example, for treating, preventing or ameliorating obesity, diabetes, metabolic disease, dyslipidemia; cardiovascular disease, type 2 diabetes, inflammation, or a cardiovascular, pulmonary, fatty liver disease, neurologic, and hepatic, or renal disease and/or cancer.
  • an ALK7-binding protein such as, an anti-ALK7 antibody
  • an ALK7-binding protein e.g., an anti-ALK7 antibody such as, a full-length ALK7-antibody and an ALK7-binding antibody fragment, or a variant or derivative thereof
  • therapies include additional therapeutic agents as well as other medical interventions.
  • Exemplary therapeutic agents that can be administered in combination with the ALK7-binding proteins provided herein include, but are not limited to, anti-SDI- fibrotics, corticosteroids, anti-inflammatories, angiotensin converting enzyme inhibitors, angiotensin receptor blockers, diuretics, antidiabetics, immune suppressants, chemotherapeutic agents, anti-metabolites, and/or immunomodulators.
  • an ALK7-binding protein is administered to a subject before, during, and/or after a surgical excision/removal procedure.
  • an ALK7-binding protein e.g., an anti-ALK7 antibody such as, a full-length ALK7-antibody and an ALK7-binding antibody fragment, or a variant or derivative thereof
  • an ALK7-binding protein is administered in combination with one or more (a) biguanides (e.g., buformin, metformin, phenformin), (b) insulin, (c) somatostatin, (d) alpha-glucosidase inhibitors (e.g., voglibose, miglitol, acarbose), (e) DPP-IV inhibitors, such as sitagliptin, vildagliptin, alogliptin, saxagliptin (e.g., as disclosed in U.S.
  • biguanides e.g.
  • LXR modulators e.g., insulin secretagogues (e.g., acetohexamide, carbutamide, chlorpropamide, glibornuride, gliclazide, glimerpiride, glipizide, gliquidine, glisoxepid, glyburide, glyhexamide, glypinamide, phenbutamide, tolazamide, tolbutamide, tolcyclamide, nateglinide and/or repaglinide), (k) CB 1 inhibitors, such as, rimonabant, taranabant, and compounds disclosed in Intl. Appl. Publ. Nos.
  • insulin secretagogues e.g., acetohexamide, carbutamide, chlorpropamide, glibornuride, gliclazide, glimerpiride, glipizide, gliquidine, glisoxepid, glyburide, glyhexamide, glypinamide,
  • WO03/077847A2 and WO05/000809 Al or (i). sibutramine, topiramate, orlistat, Qnexa, mevastatin, simvastatin, ezetimibe, atorvastatin, naltrexone, bupriopion, phentermine, hydrochlorothiazide, or losartan.
  • the disclosure also provides a diagnostic method useful during diagnosis of
  • ALK7-mediated diseases and conditions such as, obesity (e.g., abdominal or visceral obesity); overweight; insulin resistance; metabolic syndrome and/or other metabolic diseases or conditions; a lipid disorder such as, low HDL levels, high LDL levels, hyperlipidemia, hypertriglyceridemia or dyslipidemia; lipoprotein aberrations; decreased triglycerides; inflammation (e.g., liver inflammation and/or inflammation of adipose tissue), fatty liver disease; non-alcoholic fatty liver disease; hyperglycemia; impaired glucose tolerance (IGT); hyperinsulinemia; high cholesterol (e.g., high LDL levels and/or hypercholesterolemia); cardiovascular disease such as, heart disease including coronary heart disease, congestive heart failure, stroke, peripheral vascular disease, atherosclerosis; arteriosclerosis, and/or hypertension; Syndrome X; vascular restenosis; neuropathy; retinopathy; neurodegenerative disease; endothelial dysfunction, respiratory dysfunction, renal disease (e.g., nephropathy); pan
  • the ALK7-binding proteins provided herein such as, anti-ALK7 antibodies (e.g., full-length ALK7-antibodies and ALK7-binding antibody fragment, and variants and derivatives thereof) can be used to assay ALK7 levels in a biological sample using classical immunohistological methods known to those of skill in the art (see, e.g., Jalkanen, et al, J. Cell. Biol. 707:976-985 (1985); Jalkanen et al, J. Cell Biol. 105:3087- 3096 (1987)).
  • Other antibody-based methods useful for detecting ALK7 protein expression include immunoassays, such as the enzyme linked immunosorbent assay (ELISA), immunoprecipitation, or Western blotting.
  • ELISA enzyme linked immunosorbent assay
  • ALK7 protein expression level in a first biological sample is intended qualitatively or quantitatively measuring or estimating the level of ALK7 protein in a first biological sample either directly (e.g., by determining or estimating absolute protein level) or relatively (e.g., by comparing to the disease associated polypeptide level in a second biological sample).
  • the ALK7 protein expression level in the first biological sample can be measured or estimated and compared to a standard ALK7 protein level, the standard being taken from a second biological sample obtained from an individual not having the disorder or being determined by averaging levels from a population of individuals not having the disorder.
  • the standard ALK7 protein level is known, it can be used repeatedly as a standard for comparison.
  • biological sample any biological sample obtained from an individual, cell line, tissue culture, or other source of cells potentially expressing ALK7. Methods for obtaining tissue biopsies and body fluids from mammals are known in the art.
  • Kits comprising ALK7-binding proteins
  • kits that include an ALK7-binding protein (e.g., an antibody that specifically binds ALK7 such as, a full-length ALK7-antibody and an ALK7-binding antibody fragment, and variants and derivatives thereof) in suitable packaging, and written material and that can be used to perform the methods described herein.
  • the written material can include any of the following information: instructions for use, discussion of clinical studies, listing of side effects, scientific literature references, package insert materials, clinical trial results, and/or summaries of these and the like.
  • the written material can indicate or establish the activities and/or advantages of the composition, and/or describe dosing, administration, side effects, drug interactions, or other information useful to the health care provider.
  • the kit can further contain another therapy ⁇ e.g., another agent) and/or written material such as that described above that serves to provide information regarding the other therapy ⁇ e.g., the other agent).
  • another therapy e.g., another agent
  • written material such as that described above that serves to provide information regarding the other therapy ⁇ e.g., the other agent
  • kits comprises at least one purified ALK7-binding protein in one or more containers.
  • the kits contain all of the components necessary and/or sufficient to perform a detection assay, including all controls, directions for performing assays, and/or any necessary software for analysis and presentation of results.
  • ALK7-binding proteins ⁇ e.g., antibodies that specifically bind ALK7and
  • ACTRIIA/B-binding fragments of antibodies that specifically bind ALK7, and variants, or derivatives thereof) can be assayed for immunospecific binding by any method known in the art.
  • the immunoassays that can be used include, but are not limited to, competitive and non-competitive assay systems using techniques such as Western blots, radioimmunoassays (REA), ELISA (enzyme linked immunosorbent assay), "sandwich” immunoassays, immunoprecipitation assays, precipitin reactions, gel diffusion precipitin reactions, immunodiffusion assays, agglutination assays, complement-fixation assays, immunoradiometric assays, fluorescent immunoassays, or protein A immunoassays.
  • REA radioimmunoassays
  • ELISA enzyme linked immunosorbent assay
  • "sandwich” immunoassays immunoprecipitation assays
  • precipitin reactions precipitin reactions
  • ALK7-binding proteins ⁇ e.g., antibodies that specifically binds ALK7 and an
  • ActRII receptor ⁇ e.g., ActRIIA or ActRIIB)-binding fragments of antibodies that specifically bind ALK7, and variants, or derivatives thereof) provided herein can be employed histologically, as in immunofluorescence, immunoelectron microscopy or non- immunological assays, for in situ detection of ALK7 or conserved variants or peptide fragments thereof. In situ detection can be accomplished according to methods known in the art. Those of ordinary skill in the art will be able to determine operative and optimal assay conditions for each determination by employing routine experimentation. Methods suitable for determination of binding characteristics of an ALK7-binding protein are described herein or otherwise known in the art. Equipment and software designed for such kinetic analyses are commercially available ⁇ e.g., BIACORE®, BIAevaluation® software, GE Healthcare; KINEXA® Software, Sapidyne Instruments).
  • Human ALK7-Fc comprising protein was biotinylated using the EZ-Link Sulfo-
  • ALK7antibodies were captured on custom made FAB chip.
  • a concentration series of ALK7-Fc comprising protein was injected over the flow cells at a flow rate of 50 ⁇ /ml.
  • the equilibrium binding constant KD was determined by the ratio of binding rate constants kd/ka.
  • yeast cells ( ⁇ 10 10 cells/library) were incubated with 3 ml of 10 nM biotinylated ALK7-Fc comprising protein for 15 minute at room temperature in FACS wash buffer (phosphate-buffered saline (PBS)/0.1% bovine serum albumin (BSA)). After washing once with 50 ml ice-cold wash buffer, the cell pellet was resuspended in 40 mL wash buffer, and Streptavidin MicroBeads (500 ⁇ ) were added to the yeast and incubated for 15 minutes at 4°C. Next, the yeast were pelleted, resuspended in 5 mL wash buffer, and loaded onto a Miltenyi LS column.
  • FACS wash buffer phosphate-buffered saline (PBS)/0.1% bovine serum albumin (BSA)
  • PBS phosphate-buffered saline
  • BSA bovine serum albumin
  • the column was washed 3 times with 3 ml FACS wash buffer. The column was then removed from the magnetic field, and the yeast were eluted with 5 mL of growth media and then grown overnight. The following rounds of sorting were performed using flow cytometry. Approximately 1 x 10 yeast were pelleted, washed three times with wash buffer, and incubated with decreasing concentrations of biotinylated ALK7-Fc comprising protein (100 to 1 nM) under equilibrium conditions at room temperature.
  • Yeast were then washed twice and stained with LC-FITC (diluted 1 : 100) and either SA-633 (diluted 1 :500) or EA-PE (diluted 1 :50) secondary reagents for 15 minutes at 4°C. After washing twice with ice-cold wash buffer, the cell pellets were resuspended in 0.4 mL wash buffer and transferred to strainer-capped sort tubes. Sorting was performed using a FACS ARIA sorter (BD Biosciences) and sort gates were assigned to select for specific binders relative to a background control.
  • LC-FITC diluted 1 : 100
  • SA-633 diluted 1 :500
  • EA-PE diluted 1 :50
  • yeast clones were grown to saturation and then induced for 48 h at 30°C with shaking. After induction, yeast cells were pelleted and the supernatants were harvested for purification. IgGs were purified using a Protein A column and eluted with acetic acid, pH 2.0. Fab fragments were generated by papain digestion and purified over KappaSelect (GE Healthcare LifeSciences).
  • ForteBio affinity measurements of selected antibodies were performed generally as previously described (see, e.g., Estep et al., Mabs, 5(2):270-278 (2013)). Briefly, ForteBio affinity measurements were performed by loading IgGs on-line onto AHQ sensors. Sensors were equilibrated off-line in assay buffer for 30 minutes and then monitored on-line for 60 seconds for baseline establishment. Sensors with loaded IgGs were exposed to 100 nM antigen for 5 minutes, afterwards they were transferred to assay buffer for 5 minutes for off-rate measurement. Kinetics were analyzed using the 1 : 1 binding model. Octet Red384 Epitope Binning/ligand blocking
  • Epitope binning/ligand blocking of selected antibodies was performed using a standard sandwich format cross-blocking assay. Control anti-target IgG was loaded onto AHQ sensors and unoccupied Fc-binding sites on the sensor were blocked with an irrelevant human IgGl antibody. The sensors were then exposed to 100 nM target antigen followed by a second anti-target antibody or ligand. Data was processed using ForteBio's Data Analysis Software 7.0. Additional binding by the second antibody or ligand after antigen association indicates an unoccupied epitope (non-competitor), while no binding indicates epitope blocking (competitor or ligand blocking).
  • a TSKgel SuperSW mAb HTP column (22855) was used for fast SEC analysis of yeast-produced mAbs at 0.4 mL/minute with a cycle time of 6 min/run. 200 mM Sodium Phosphate and 250 mM Sodium Chloride was used as the mobile phase.
  • Exemplary ALK7-binding proteins generated according to the previous example were further characterized by sequence, SPR, and cell-based lipolysis inhibition assay analyses.
  • VH CDR1 SYAIS (SEQ ID NO: 1)
  • VH FR2 WVRQAPGQGLEWMG (SEQ ID NO:7)
  • VH CDR2 GIIPIFGTASYAQKFQG (SEQ ID NO:2)
  • VH FR3 RVTITADESTSTAYMELSSLRSEDTAVYYCAR (SEQ ID NO:8)
  • VH CDR3 TPYYDSSGYLDV (SEQ ID NO:3)
  • VH FR4 WGQGTMVTVSS (SEQ ID NO:9)
  • VH ABRs ABR1 GTFSSYAIS (SEQ ID NO:73)
  • ABR2 GIIPIFGTASYAQKFQG (SEQ ID NO:74)
  • ABR3 ARTPYYDSSGYLDV (SEQ ID NO:75)
  • VL FRl DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO: 15)
  • VL CDRl QASQDISNYLN (SEQ ID NO: 10)
  • VL FR2 WYQQKPGKAPKLLIY (SEQ ID NO: 16)
  • VL CDR2 DASNLAT (SEQ ID NO: 11)
  • VL FR3 GVPSRFSGSGSGTDFTFTISSLQPEDIATYYC (SEQ ID NO: 17)
  • VL CDR3 QQSLDLPPT (SEQ ID NO: 12)
  • VL FR4 FGGGTKVEIK (SEQ ID NO: 18)

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Diabetes (AREA)
  • Immunology (AREA)
  • Obesity (AREA)
  • Hematology (AREA)
  • Cardiology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Child & Adolescent Psychology (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Neurosurgery (AREA)
  • Neurology (AREA)
  • Biomedical Technology (AREA)
  • Endocrinology (AREA)
  • Urology & Nephrology (AREA)
  • Hospice & Palliative Care (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Vascular Medicine (AREA)
  • Emergency Medicine (AREA)
  • Ophthalmology & Optometry (AREA)
  • Psychiatry (AREA)
  • Pulmonology (AREA)
  • Reproductive Health (AREA)
PCT/US2017/028952 2016-04-22 2017-04-21 Alk7 binding proteins and uses thereof Ceased WO2017185037A1 (en)

Priority Applications (9)

Application Number Priority Date Filing Date Title
CN202310225072.5A CN116217731B (zh) 2016-04-22 2017-04-21 Alk7结合蛋白及其用途
EP17786759.5A EP3445394A4 (en) 2016-04-22 2017-04-21 ALK7-BINDING PROTEINS AND THEIR USE
CA3018272A CA3018272A1 (en) 2016-04-22 2017-04-21 Alk7 binding proteins and uses thereof
AU2017252574A AU2017252574B2 (en) 2016-04-22 2017-04-21 ALK7 binding proteins and uses thereof
CN201780029770.0A CN109219446B (zh) 2016-04-22 2017-04-21 Alk7结合蛋白及其用途
CN202511960418.1A CN121851175A (zh) 2016-04-22 2017-04-21 Alk7结合蛋白及其用途
JP2018555460A JP7103950B2 (ja) 2016-04-22 2017-04-21 Alk7結合性タンパク質及びその使用
KR1020187032416A KR102405278B1 (ko) 2016-04-22 2017-04-21 Alk7 결합 단백질 및 이들의 용도
KR1020227018313A KR20220080015A (ko) 2016-04-22 2017-04-21 Alk7 결합 단백질 및 이들의 용도

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201662326313P 2016-04-22 2016-04-22
US62/326,313 2016-04-22

Publications (1)

Publication Number Publication Date
WO2017185037A1 true WO2017185037A1 (en) 2017-10-26

Family

ID=60089402

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2017/028952 Ceased WO2017185037A1 (en) 2016-04-22 2017-04-21 Alk7 binding proteins and uses thereof

Country Status (8)

Country Link
US (4) US10501547B2 (https=)
EP (1) EP3445394A4 (https=)
JP (1) JP7103950B2 (https=)
KR (2) KR20220080015A (https=)
CN (3) CN116217731B (https=)
AU (1) AU2017252574B2 (https=)
CA (1) CA3018272A1 (https=)
WO (1) WO2017185037A1 (https=)

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2019084249A1 (en) * 2017-10-25 2019-05-02 Acceleron Pharma Inc. ALK7 BINDING PROTEINS AND USES THEREOF
US10501547B2 (en) 2016-04-22 2019-12-10 Acceleron Pharma Inc. ALK7 binding proteins and uses thereof
WO2020243443A1 (en) * 2019-05-30 2020-12-03 Acceleron Pharma Inc. Alk7 binding proteins and uses thereof
WO2022076634A1 (en) 2020-10-08 2022-04-14 The Trustees Of Dartmouth College Methods and agents for treating, preventing, diagnosing, and evaluating therapy for fibrotic, autoimmune, and inflammatory conditions

Families Citing this family (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11236156B2 (en) 2016-02-11 2022-02-01 The Johns Hopkins University Compositions and methods for targeting activin signaling to treat cancer
US11525002B2 (en) 2017-10-11 2022-12-13 Board Of Regents, The University Of Texas System Human PD-L1 antibodies and methods of use therefor
EP4501355A3 (en) 2018-03-23 2025-04-30 Board Of Regents, The University Of Texas System Dual specificity antibodies to pd-l1 and pd-l2 and methods of use therefor
CN119101158A (zh) 2018-03-23 2024-12-10 得克萨斯州大学系统董事会 人pd-l2抗体及其使用方法
SG11202009258RA (en) 2018-03-23 2020-10-29 Univ Texas Dual specificity antibodies to human pd-l1 and pd-l2 and methods of use therefor

Citations (63)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0229246A2 (de) 1986-01-15 1987-07-22 ANT Nachrichtentechnik GmbH Verfahren zum Dekodieren von Binärsignalen sowie Viterbi-Dekoder und Anwendungen
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4946778A (en) 1987-09-21 1990-08-07 Genex Corporation Single polypeptide chain binding molecules
WO1990014424A1 (en) 1989-05-16 1990-11-29 Scripps Clinic And Research Foundation Method for isolating receptors having a preselected specificity
WO1990014443A1 (en) 1989-05-16 1990-11-29 Huse William D Co-expression of heteromeric receptors
WO1990014430A1 (en) 1989-05-16 1990-11-29 Scripps Clinic And Research Foundation A new method for tapping the immunological repertoire
WO1992001047A1 (en) 1990-07-10 1992-01-23 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5545807A (en) 1988-10-12 1996-08-13 The Babraham Institute Production of antibodies from transgenic animals
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
US5569825A (en) 1990-08-29 1996-10-29 Genpharm International Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
WO1997011971A1 (en) 1995-09-28 1997-04-03 Alexion Pharmaceuticals, Inc. Porcine cell interaction proteins
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5639641A (en) 1992-09-09 1997-06-17 Immunogen Inc. Resurfacing of rodent antibodies
US5641870A (en) 1995-04-20 1997-06-24 Genentech, Inc. Low pH hydrophobic interaction chromatography for antibody purification
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5714352A (en) 1996-03-20 1998-02-03 Xenotech Incorporated Directed switch-mediated DNA recombination
US5723323A (en) 1985-03-30 1998-03-03 Kauffman; Stuart Alan Method of identifying a stochastically-generated peptide, polypeptide, or protein having ligand binding property and compositions thereof
US5750373A (en) 1990-12-03 1998-05-12 Genentech, Inc. Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants
US5763192A (en) 1986-11-20 1998-06-09 Ixsys, Incorporated Process for obtaining DNA, RNA, peptides, polypeptides, or protein, by recombinant DNA technique
US5766886A (en) 1991-12-13 1998-06-16 Xoma Corporation Modified antibody variable domains
US5811245A (en) * 1994-10-20 1998-09-22 Carlos F. Ibanez Antibodies that specifically bind to ALK-7, a novel serine threonine kinase receptor
US5885793A (en) 1991-12-02 1999-03-23 Medical Research Council Production of anti-self antibodies from antibody segment repertoires and displayed on phage
US6172197B1 (en) 1991-07-10 2001-01-09 Medical Research Council Methods for producing members of specific binding pairs
US6204023B1 (en) 1985-11-01 2001-03-20 Xoma Ltd. Modular assembly of antibody genes, antibodies prepared thereby and use
US6300064B1 (en) 1995-08-18 2001-10-09 Morphosys Ag Protein/(poly)peptide libraries
US6413746B1 (en) 1986-03-14 2002-07-02 Lonza Group, Ag Production of proteins by cell culture
US6423538B1 (en) 1996-05-31 2002-07-23 Board Of Trustees Of The University Of Illinois Yeast cell surface display of proteins and uses thereof
US20020177170A1 (en) 2001-04-17 2002-11-28 Peizhi Luo Structure-based selection and affinity maturation of antibody library
US20030170753A1 (en) 1997-06-12 2003-09-11 Research Corporation Technologies, Inc. Artificial antibody polypeptides
WO2003074679A2 (en) 2002-03-01 2003-09-12 Xencor Antibody optimization
WO2003077847A2 (en) 2002-03-12 2003-09-25 Merck & Co., Inc. Substituted amides
US6653068B2 (en) 1999-07-02 2003-11-25 Morphosys Ag Generation of specific binding partners binding to (poly)peptides encoded by genomic DNA fragments or ESTs
WO2004009823A1 (en) 2002-07-18 2004-01-29 Lonza Biologics Plc. Method of expressing recombinant protein in cho cells
US6696251B1 (en) 1996-05-31 2004-02-24 Board Of Trustees Of The University Of Illinois Yeast cell surface display of proteins and uses thereof
US6699871B2 (en) 2001-07-06 2004-03-02 Merck & Co., Inc. Beta-amino heterocyclic dipeptidyl peptidase inhibitors for the treatment or prevention of diabetes
US6706484B1 (en) 1995-08-18 2004-03-16 Morphosys Ag Protein/(poly)peptide libraries
US20040202659A1 (en) * 1997-06-06 2004-10-14 Asat Ag Applied Science & Technology Recombinant anti-GPIIb/IIIa antibodies
WO2005000809A1 (en) 2003-06-11 2005-01-06 Merck & Co., Inc. Substituted 3-alkyl and 3-alkenyl azetidine derivatives
US20070148167A1 (en) 2005-02-14 2007-06-28 Strohl William R Non-immunostimulatory antibody and compositions containing the same
WO2007106585A1 (en) 2006-03-15 2007-09-20 Alexion Pharmaceuticals, Inc. Treatment of paroxysmal nocturnal hemoglobinuria patients by an inhibitor of complement
US7342110B2 (en) 2002-11-07 2008-03-11 Immunogen Inc. Anti-CD33 antibodies and method for treatment of acute myeloid leukemia using the same
US20080177048A1 (en) 2007-01-09 2008-07-24 Bio-Rad Laboratories, Inc. Enhanced capacity and purification of antibodies by mixed mode chromatography in the presence of aqueous-soluble nonionic organic polymers
US20080187954A1 (en) 2004-03-10 2008-08-07 Lonza Ltd. Method For Producing Antibodies
US20080312425A1 (en) 2004-08-30 2008-12-18 Lonza Biologics Plc. Ion Exchange Chromatography and Purification of Antibodies
WO2009036379A2 (en) 2007-09-14 2009-03-19 Adimab, Inc. Rationally designed, synthetic antibody libraries and uses therefor
US7538195B2 (en) 2002-06-14 2009-05-26 Immunogen Inc. Anti-IGF-I receptor antibody
US20090155275A1 (en) 2007-07-31 2009-06-18 Medimmune, Llc Multispecific epitope binding proteins and uses thereof
US20090187005A1 (en) 2008-01-18 2009-07-23 Gagnon Peter S Enhanced purification of antibodies and antibody fragments by apatite chromatography
US20090252733A1 (en) * 2005-10-12 2009-10-08 Morphosys Ag Generation and Profiling of Fully Human Gold-Derived Therapeutic Antibodies Specific for Human CD38
WO2010105256A1 (en) 2009-03-13 2010-09-16 Adimab, Inc. Rationally designed, synthetic antibody libraries and uses therefor
WO2012009568A2 (en) 2010-07-16 2012-01-19 Adimab, Llc Antibody libraries
US20120014954A1 (en) * 2008-12-05 2012-01-19 Abraxis Bioscience, Llc Sparc binding scfvs
WO2014179363A1 (en) 2013-04-29 2014-11-06 Adimab, Llc Polyspecificity reagents, methods for their preparation and use
WO2015091935A2 (en) * 2013-12-19 2015-06-25 Arsanis Biosciences Gmbh Antibodies directed against the lukgh (lukab) toxin of staphylococcus aureus and antibody sequences
US9105939B2 (en) 2008-03-10 2015-08-11 Nissan Motor Co., Ltd. Battery with battery electrode and method of manufacturing same
US9109630B2 (en) 2013-01-15 2015-08-18 Jtekt Corporation Rolling bearing unit
US20150266975A1 (en) * 2014-03-18 2015-09-24 Korea Advanced Institute Of Science And Technology Rna-specific binding antibody
US9401234B2 (en) 2013-03-22 2016-07-26 Polytronics Technology Corp. Over-current protection device
US9618978B2 (en) 2013-10-03 2017-04-11 Acer Incorporated Methods for controlling a touch panel and portable computers using the same
US9816280B1 (en) 2016-11-02 2017-11-14 Matthew Reitnauer Portable floor

Family Cites Families (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20120049214A (ko) * 2009-06-08 2012-05-16 악셀레론 파마 인코포레이티드 발열성 지방세포를 증가시키는 방법
CN104936980B (zh) * 2012-12-31 2019-06-07 生物控股有限公司 用于治疗和预防多瘤病毒相关的疾病的重组人抗体
WO2017177013A1 (en) 2016-04-06 2017-10-12 Acceleron Pharma Inc. Alk7 antagonists and uses thereof
WO2017185037A1 (en) 2016-04-22 2017-10-26 Acceleron Pharma Inc. Alk7 binding proteins and uses thereof
BR112020007751A2 (pt) 2017-10-25 2020-10-20 Acceleron Pharma Inc. proteínas de ligação de alk7 e usos das mesmas

Patent Citations (81)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US5976862A (en) 1985-03-30 1999-11-02 Ixsys Corporation Process for obtaining DNA, RNA, peptides, polypeptides, or proteins, by recombinant DNA technique
US5824514A (en) 1985-03-30 1998-10-20 Stuart A. Kauffman Process for the production of expression vectors comprising at least one stochastic sequence of polynucleotides
US5817483A (en) 1985-03-30 1998-10-06 Stuart Kauffman Process for the production of stochastically-generated peptides,polypeptides or proteins having a predetermined property
US5814476A (en) 1985-03-30 1998-09-29 Stuart Kauffman Process for the production of stochastically-generated transcription or translation products
US5723323A (en) 1985-03-30 1998-03-03 Kauffman; Stuart Alan Method of identifying a stochastically-generated peptide, polypeptide, or protein having ligand binding property and compositions thereof
US6204023B1 (en) 1985-11-01 2001-03-20 Xoma Ltd. Modular assembly of antibody genes, antibodies prepared thereby and use
EP0229246A2 (de) 1986-01-15 1987-07-22 ANT Nachrichtentechnik GmbH Verfahren zum Dekodieren von Binärsignalen sowie Viterbi-Dekoder und Anwendungen
US6660501B2 (en) 1986-03-14 2003-12-09 Lonza Group, Ag Production of proteins by cell culture
US6413746B1 (en) 1986-03-14 2002-07-02 Lonza Group, Ag Production of proteins by cell culture
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
US5763192A (en) 1986-11-20 1998-06-09 Ixsys, Incorporated Process for obtaining DNA, RNA, peptides, polypeptides, or protein, by recombinant DNA technique
US4946778A (en) 1987-09-21 1990-08-07 Genex Corporation Single polypeptide chain binding molecules
US5545807A (en) 1988-10-12 1996-08-13 The Babraham Institute Production of antibodies from transgenic animals
US5585089A (en) 1988-12-28 1996-12-17 Protein Design Labs, Inc. Humanized immunoglobulins
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5693762A (en) 1988-12-28 1997-12-02 Protein Design Labs, Inc. Humanized immunoglobulins
US5693761A (en) 1988-12-28 1997-12-02 Protein Design Labs, Inc. Polynucleotides encoding improved humanized immunoglobulins
US6180370B1 (en) 1988-12-28 2001-01-30 Protein Design Labs, Inc. Humanized immunoglobulins and methods of making the same
WO1990014424A1 (en) 1989-05-16 1990-11-29 Scripps Clinic And Research Foundation Method for isolating receptors having a preselected specificity
WO1990014443A1 (en) 1989-05-16 1990-11-29 Huse William D Co-expression of heteromeric receptors
WO1990014430A1 (en) 1989-05-16 1990-11-29 Scripps Clinic And Research Foundation A new method for tapping the immunological repertoire
US5969108A (en) 1990-07-10 1999-10-19 Medical Research Council Methods for producing members of specific binding pairs
WO1992001047A1 (en) 1990-07-10 1992-01-23 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
US5569825A (en) 1990-08-29 1996-10-29 Genpharm International Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
US5750373A (en) 1990-12-03 1998-05-12 Genentech, Inc. Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants
US6172197B1 (en) 1991-07-10 2001-01-09 Medical Research Council Methods for producing members of specific binding pairs
US6544731B1 (en) 1991-12-02 2003-04-08 Medical Research Council Production of anti-self antibodies from antibody segment repertories and displayed on phage
US5885793A (en) 1991-12-02 1999-03-23 Medical Research Council Production of anti-self antibodies from antibody segment repertoires and displayed on phage
US6593081B1 (en) 1991-12-02 2003-07-15 Medical Research Council Production of anti-self antibodies from antibody segment repertoires and displayed on phage
US6582915B1 (en) 1991-12-02 2003-06-24 Medical Research Council Production of anti-self bodies from antibody segment repertories and displayed on phage
US6555313B1 (en) 1991-12-02 2003-04-29 Medical Research Council Production of anti-self antibodies from antibody segment repertoires and displayed on phage
US6521404B1 (en) 1991-12-02 2003-02-18 Medical Research Council Production of anti-self antibodies from antibody segment repertoires and displayed on phage
US5766886A (en) 1991-12-13 1998-06-16 Xoma Corporation Modified antibody variable domains
US5639641A (en) 1992-09-09 1997-06-17 Immunogen Inc. Resurfacing of rodent antibodies
US5811245A (en) * 1994-10-20 1998-09-22 Carlos F. Ibanez Antibodies that specifically bind to ALK-7, a novel serine threonine kinase receptor
US5641870A (en) 1995-04-20 1997-06-24 Genentech, Inc. Low pH hydrophobic interaction chromatography for antibody purification
US6706484B1 (en) 1995-08-18 2004-03-16 Morphosys Ag Protein/(poly)peptide libraries
US6300064B1 (en) 1995-08-18 2001-10-09 Morphosys Ag Protein/(poly)peptide libraries
US7264963B1 (en) 1995-08-18 2007-09-04 Morphosys Ag Protein(poly)peptide libraries
WO1997011971A1 (en) 1995-09-28 1997-04-03 Alexion Pharmaceuticals, Inc. Porcine cell interaction proteins
US5714352A (en) 1996-03-20 1998-02-03 Xenotech Incorporated Directed switch-mediated DNA recombination
US6423538B1 (en) 1996-05-31 2002-07-23 Board Of Trustees Of The University Of Illinois Yeast cell surface display of proteins and uses thereof
US6696251B1 (en) 1996-05-31 2004-02-24 Board Of Trustees Of The University Of Illinois Yeast cell surface display of proteins and uses thereof
US6699658B1 (en) 1996-05-31 2004-03-02 Board Of Trustees Of The University Of Illinois Yeast cell surface display of proteins and uses thereof
US20040202659A1 (en) * 1997-06-06 2004-10-14 Asat Ag Applied Science & Technology Recombinant anti-GPIIb/IIIa antibodies
US20030170753A1 (en) 1997-06-12 2003-09-11 Research Corporation Technologies, Inc. Artificial antibody polypeptides
US6653068B2 (en) 1999-07-02 2003-11-25 Morphosys Ag Generation of specific binding partners binding to (poly)peptides encoded by genomic DNA fragments or ESTs
US20020177170A1 (en) 2001-04-17 2002-11-28 Peizhi Luo Structure-based selection and affinity maturation of antibody library
US6699871B2 (en) 2001-07-06 2004-03-02 Merck & Co., Inc. Beta-amino heterocyclic dipeptidyl peptidase inhibitors for the treatment or prevention of diabetes
WO2003074679A2 (en) 2002-03-01 2003-09-12 Xencor Antibody optimization
WO2003077847A2 (en) 2002-03-12 2003-09-25 Merck & Co., Inc. Substituted amides
US7538195B2 (en) 2002-06-14 2009-05-26 Immunogen Inc. Anti-IGF-I receptor antibody
WO2004009823A1 (en) 2002-07-18 2004-01-29 Lonza Biologics Plc. Method of expressing recombinant protein in cho cells
US7342110B2 (en) 2002-11-07 2008-03-11 Immunogen Inc. Anti-CD33 antibodies and method for treatment of acute myeloid leukemia using the same
US7557189B2 (en) 2002-11-07 2009-07-07 Immunogen Inc. Anti-CD33 antibodies and method for treatment of acute myeloid leukemia using the same
WO2005000809A1 (en) 2003-06-11 2005-01-06 Merck & Co., Inc. Substituted 3-alkyl and 3-alkenyl azetidine derivatives
US20080187954A1 (en) 2004-03-10 2008-08-07 Lonza Ltd. Method For Producing Antibodies
US20080312425A1 (en) 2004-08-30 2008-12-18 Lonza Biologics Plc. Ion Exchange Chromatography and Purification of Antibodies
US20070148167A1 (en) 2005-02-14 2007-06-28 Strohl William R Non-immunostimulatory antibody and compositions containing the same
US20090252733A1 (en) * 2005-10-12 2009-10-08 Morphosys Ag Generation and Profiling of Fully Human Gold-Derived Therapeutic Antibodies Specific for Human CD38
WO2007106585A1 (en) 2006-03-15 2007-09-20 Alexion Pharmaceuticals, Inc. Treatment of paroxysmal nocturnal hemoglobinuria patients by an inhibitor of complement
US20080177048A1 (en) 2007-01-09 2008-07-24 Bio-Rad Laboratories, Inc. Enhanced capacity and purification of antibodies by mixed mode chromatography in the presence of aqueous-soluble nonionic organic polymers
US20090155275A1 (en) 2007-07-31 2009-06-18 Medimmune, Llc Multispecific epitope binding proteins and uses thereof
WO2009036379A2 (en) 2007-09-14 2009-03-19 Adimab, Inc. Rationally designed, synthetic antibody libraries and uses therefor
US20090187005A1 (en) 2008-01-18 2009-07-23 Gagnon Peter S Enhanced purification of antibodies and antibody fragments by apatite chromatography
US9105939B2 (en) 2008-03-10 2015-08-11 Nissan Motor Co., Ltd. Battery with battery electrode and method of manufacturing same
US20120014954A1 (en) * 2008-12-05 2012-01-19 Abraxis Bioscience, Llc Sparc binding scfvs
WO2010105256A1 (en) 2009-03-13 2010-09-16 Adimab, Inc. Rationally designed, synthetic antibody libraries and uses therefor
WO2012009568A2 (en) 2010-07-16 2012-01-19 Adimab, Llc Antibody libraries
US9109630B2 (en) 2013-01-15 2015-08-18 Jtekt Corporation Rolling bearing unit
US9401234B2 (en) 2013-03-22 2016-07-26 Polytronics Technology Corp. Over-current protection device
WO2014179363A1 (en) 2013-04-29 2014-11-06 Adimab, Llc Polyspecificity reagents, methods for their preparation and use
US9618978B2 (en) 2013-10-03 2017-04-11 Acer Incorporated Methods for controlling a touch panel and portable computers using the same
WO2015091935A2 (en) * 2013-12-19 2015-06-25 Arsanis Biosciences Gmbh Antibodies directed against the lukgh (lukab) toxin of staphylococcus aureus and antibody sequences
US20150266975A1 (en) * 2014-03-18 2015-09-24 Korea Advanced Institute Of Science And Technology Rna-specific binding antibody
US9816280B1 (en) 2016-11-02 2017-11-14 Matthew Reitnauer Portable floor

Non-Patent Citations (76)

* Cited by examiner, † Cited by third party
Title
"Current Protocols in Molecular Biology", vol. 1, 1994, JOHN WILEY & SONS, INC.
"Remington's Pharmaceutical Sciences", 1980, MACK PUBLISHING CO.
ALEGRE ET AL., TRANSPLANTATION, vol. 57, 1994, pages 1537 - 1543
BAGSHAWE ET AL., ANT. IMMUN. AND RADIOPHARM., vol. 4, 1991, pages 915 - 922
BARBAS ET AL., PNAS USA, vol. 91, 1994, pages 3809 - 3813
BERZOFSKY ET AL.: "Fundamental Immunology", 1984, RAVEN PRESS, article "Antibody-Antigen Interactions"
BLAISE ET AL., GENE, vol. 342, no. 2, 2004, pages 211 - 218
BODER ET AL., NAT BIOTECHNOL., vol. 15, no. 6, 1997, pages 553 - 557
BOEMER ET AL., J. IMMUNOL., vol. 147, no. 1, 1991, pages 86 - 95
BOLT ET AL., EUR. J. IMMUNOL., vol. 23, 1993, pages 403 - 411
BRENNAN ET AL., SCIENCE, vol. 229, 1985, pages 81
BRUCKHEIMER ET AL., NEOPLASIA, vol. 11, 2009, pages 509 - 517
CARTER ET AL., PNAS USA, vol. 89, 1992, pages 4285 - 3580
CHEUNG ET AL., VIROLOGY, vol. 176, 1990, pages 546 - 552
CHOTHIA ET AL., J. MOL. BIOL., vol. 196, 1987, pages 901
CLACKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628
COLE ET AL., TRANSPLANTATION, vol. 68, 1999, pages 563 - 571
COLEALAN R. LISS ET AL., MONOCLONAL ANTIBODIES AND CANCER THERAPY, 1985, pages 77
CURR. PHARM. BIOTECH., 2004, pages 517 - 527
DATABASE UniProtKB [O] 3 October 2012 (2012-10-03), XP055433434, Database accession no. I7ZP16_ASPO3 *
DAVIS ET AL., J. RHEUMATOL., vol. 34, 2007, pages 2204 - 2210
ESTEP ET AL., MABS, vol. 5, no. 2, 2013, pages 270 - 278
GILL ET AL., CURR. OPIN. BIOTECHNOL.
GILL ET AL., CURR. OPIN. BIOTECHNOL., vol. 17, 2006, pages 653 - 658
GLUZMAN, CELL, vol. 23, 1981, pages 175
GODING: "Monoclonal Antibodies: Principles and Practice", 1986, ACADEMIC PRESS
HAYDEN-LEDBETTER ET AL., CLIN. CANCER, vol. 15, 2009, pages 2739 - 2746
HOOGENBOOMWINTER, J. MOL. BIOL., vol. 222, 1991, pages 581 - 597
HOSSE ET AL., PROTEIN SCIENCE, vol. 15, 2006, pages 14 - 27
HUSE ET AL., SCIENCE, vol. 246, 1989, pages 1275 - 1281
HUTCHINS ET AL., PNAS USA, vol. 92, 1995, pages 11980 - 11984
IDUSOGIE ET AL., J. IMMUNOL., vol. 166, 2001, pages 2571 - 2575
INNES ET AL., BR. J. CANCER, vol. 94, pages 1057 - 1065
JALKANEN ET AL., J. CELL BIOL., vol. 105, 1987, pages 3087 - 3096
JALKANEN ET AL., J. CELL. BIOL., vol. 101, 1985, pages 976 - 985
JONES ET AL., NATURE, vol. 321, 1986, pages 522 - 525
JUO, PEI-SHOW: "Concise Dictionary of Biomedicine and Molecular Biology", 2002, CRC PRESS
KIRKLAND ET AL., J. IMMUNOL., vol. 137, 1986, pages 3614 - 3619
KOHLERMILSTEIN, NATURE, vol. 256, 1975, pages 495 - 497
KUMAGAI ET AL., J. CLIN. PHARMACOL., vol. 47, pages 1489 - 1497
KURODA ET AL., BIOTECHNOL. LETT., vol. 33, no. 1, 2011, pages 1 - 9
LAUER ET AL., J. PHARM. SCI., vol. 101, no. 1, 2012, pages 102 - 15
LAZAR ET AL., PNAS USA, vol. 103, 2006, pages 4005 - 4010
LEDERMANN ET AL., INT. J. CANCER, vol. 47, 1991, pages 659 - 664
LUCKOWSUMMERS, BIOTECHNOLOGY, vol. 6, 1988, pages 47
MARKS ET AL., BIO/TECHNOLOGY, vol. 10, 1992, pages 779 - 783
MCCAFFERTY ET AL., NATURE, vol. 348, 1990, pages 552 - 554
MCEARCHERN ET AL., BLOOD, vol. 109, 2007, pages 1185 - 1192
MOLDENHAUER ET AL., SCAND. J. IMMUNOL., vol. 32, pages 77 - 82
MOREL ET AL., MOLEC. IMMUNOL., vol. 25, 1988, pages 7 - 15
MORIMOTO ET AL., BIOCHEM. BIOPHYS. METH., vol. 24, 1993, pages 107 - 117
NYGREN, FEBS J, vol. 275, 2008, pages 2668 - 2676
ORCUTT K.D.WITTRUP K.D., ANTIBODY ENGINEERING, YEAST DISPLAY AND SELECTION, 2010, pages 207 - 233
PRESTA ET AL., J. IMMUNOL., vol. 151, 1993, pages 2623
RAKESTRAW ET AL., PROTEIN ENG. DES. SEL., vol. 24, no. 6, 2011, pages 525 - 30
REDDY ET AL., J. IMMUNOL., vol. 164, 2000, pages 1925 - 1933
RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 327
ROTHE ET AL., J. MOL. BIOL., vol. 376, no. 4, 2008, pages 1182 - 1200
SAZINSKY ET AL., PNAS USA, vol. 105, 2008, pages 20167 - 20172
SCATCHARD ET AL., ANN. N.Y. ACAD. SCI., vol. 51, 1949, pages 660 - 672
SCHIER ET AL., J. MOL. BIOL., vol. 263, 1996, pages 551 - 567
See also references of EP3445394A4
SHEETS ET AL., PNAS, vol. 95, 1998, pages 6157 - 6162
SIEGEL ET AL., J. IMMUNOL. METH., vol. 286, no. 1-2, 2004, pages 141 - 153
SKERRA, CURR. OPIN. BIOTECH., vol. 18, 2007, pages 295 - 304
SKERRA, CURR. OPIN. BIOTECHNOL., vol. 18, 2007, pages 295 - 304
SKERRA, FEBS J., vol. 275, 2008, pages 2677 - 2683
STAHLI ET AL., METHODS IN ENZYMOLOGY, vol. 92, pages 242 - 253
STROHL, CURR. OP. BIOTECHNOL., vol. 20, 2009, pages 685 - 691
VAUGHAN ET AL., NAT. BIOTECH., vol. 14, 1996, pages 309 - 314
VERHOEYEN ET AL., SCIENCE, vol. 239, 1988, pages 1534 - 1536
XU ET AL., CELL IMMUNOL., vol. 200, 2000, pages 16 - 26
XU ET AL., PROTEIN ENG. DES. SEL., vol. 26, no. 10, 2013, pages 663 - 670
YOGOSAWA ET AL.: "Activin Receptor-Like Kinase 7 Suppresses Lipolysis to Accumulate Fat in Obesity Through Downregulation of Peroxisome Proliferator-Activated Receptor gamma and C/EBPalpha", DIABETES, vol. 62, no. 1, January 2013 (2013-01-01), pages 115 - 123, XP055200089 *
ZHANG, DIABETALOGIA, vol. 49, no. 3, 2006, pages 506 - 18
ZHAO ET AL., AM J PHYSIOL ENDOCRINOL METAB., vol. 303, no. 1, 2012, pages E132 - E143

Cited By (14)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11708414B2 (en) 2016-04-22 2023-07-25 Acceleron Pharma Inc. ALK7 binding proteins and uses thereof
US10501547B2 (en) 2016-04-22 2019-12-10 Acceleron Pharma Inc. ALK7 binding proteins and uses thereof
US11059894B2 (en) 2016-04-22 2021-07-13 Acceleron Pharma Inc. ALK7 binding proteins and uses thereof
CN111836642A (zh) * 2017-10-25 2020-10-27 艾科赛扬制药股份有限公司 Alk7结合蛋白及其用途
WO2019084249A1 (en) * 2017-10-25 2019-05-02 Acceleron Pharma Inc. ALK7 BINDING PROTEINS AND USES THEREOF
EP3700571A4 (en) * 2017-10-25 2021-07-28 Acceleron Pharma Inc. ALK7-BINDING PROTEINS AND USES THEREOF
AU2018354295B2 (en) * 2017-10-25 2025-08-14 Acceleron Pharma Inc. ALK7 binding proteins and uses thereof
US11981738B2 (en) 2017-10-25 2024-05-14 Acceleron Pharma Inc. ALK7 binding proteins and uses thereof
WO2020243443A1 (en) * 2019-05-30 2020-12-03 Acceleron Pharma Inc. Alk7 binding proteins and uses thereof
JP2022534514A (ja) * 2019-05-30 2022-08-01 アクセレロン ファーマ インコーポレーテッド Alk7結合タンパク質及びその使用
JP7617036B2 (ja) 2019-05-30 2025-01-17 アクセレロン ファーマ インコーポレーテッド Alk7結合タンパク質及びその使用
US12365736B2 (en) 2019-05-30 2025-07-22 Acceleron Pharma Inc. ALK7 binding proteins and uses thereof
EP4217378A4 (en) * 2020-10-08 2025-02-26 The Trustees Of Dartmouth College Methods and agents for treating, preventing, diagnosing, and evaluating therapy for fibrotic, autoimmune, and inflammatory conditions
WO2022076634A1 (en) 2020-10-08 2022-04-14 The Trustees Of Dartmouth College Methods and agents for treating, preventing, diagnosing, and evaluating therapy for fibrotic, autoimmune, and inflammatory conditions

Also Published As

Publication number Publication date
CA3018272A1 (en) 2017-10-26
US11708414B2 (en) 2023-07-25
KR20220080015A (ko) 2022-06-14
KR20190003561A (ko) 2019-01-09
US20200087406A1 (en) 2020-03-19
JP7103950B2 (ja) 2022-07-20
KR102405278B1 (ko) 2022-06-07
AU2017252574B2 (en) 2024-08-22
AU2017252574A1 (en) 2018-10-04
US20210324089A1 (en) 2021-10-21
US20230416379A1 (en) 2023-12-28
EP3445394A4 (en) 2020-02-19
US20170306028A1 (en) 2017-10-26
US11059894B2 (en) 2021-07-13
CN116217731A (zh) 2023-06-06
US10501547B2 (en) 2019-12-10
CN116217731B (zh) 2025-12-30
CN109219446A (zh) 2019-01-15
JP2019515676A (ja) 2019-06-13
EP3445394A1 (en) 2019-02-27
CN109219446B (zh) 2023-03-28
CN121851175A (zh) 2026-04-14

Similar Documents

Publication Publication Date Title
US11708414B2 (en) ALK7 binding proteins and uses thereof
US12042524B2 (en) Activin type 2 receptor binding proteins methods of making them
US20240287196A1 (en) ALK7 Binding Proteins and Uses Thereof
US20220242956A1 (en) Actrii-binding proteins and uses thereof
US12365736B2 (en) ALK7 binding proteins and uses thereof
HK40094995A (zh) Alk7结合蛋白及其用途
HK40003020B (en) Alk7 binding proteins and uses thereof
HK40003020A (en) Alk7 binding proteins and uses thereof

Legal Events

Date Code Title Description
ENP Entry into the national phase

Ref document number: 3018272

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2017252574

Country of ref document: AU

Date of ref document: 20170421

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2018555460

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 20187032416

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2017786759

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2017786759

Country of ref document: EP

Effective date: 20181122

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17786759

Country of ref document: EP

Kind code of ref document: A1

WWG Wipo information: grant in national office

Ref document number: 201827042228

Country of ref document: IN