WO2017125830A1 - Chimeric antigen receptors targeting epidermal growth factor receptor variant iii - Google Patents

Chimeric antigen receptors targeting epidermal growth factor receptor variant iii Download PDF

Info

Publication number
WO2017125830A1
WO2017125830A1 PCT/IB2017/050108 IB2017050108W WO2017125830A1 WO 2017125830 A1 WO2017125830 A1 WO 2017125830A1 IB 2017050108 W IB2017050108 W IB 2017050108W WO 2017125830 A1 WO2017125830 A1 WO 2017125830A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
egfrvlll
cancer
cells
cell
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/IB2017/050108
Other languages
English (en)
French (fr)
Inventor
Oi Kwan WONG
Joyce Ching CHOU
Mathilde Brunnhilde DUSSEAUX
Julianne Smith
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Pfizer Inc
Original Assignee
Pfizer Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to ES17701190T priority Critical patent/ES2942362T3/es
Priority to RU2018130088A priority patent/RU2751662C2/ru
Priority to AU2017208834A priority patent/AU2017208834B2/en
Priority to PH1/2018/501473A priority patent/PH12018501473B1/en
Priority to UAA201808794A priority patent/UA125252C2/uk
Priority to EA201891641A priority patent/EA201891641A1/ru
Priority to NZ744821A priority patent/NZ744821A/en
Priority to SG11201805872SA priority patent/SG11201805872SA/en
Priority to DK17701190.5T priority patent/DK3405481T5/da
Priority to JP2018538085A priority patent/JP6823659B2/ja
Priority to MX2018008978A priority patent/MX2018008978A/es
Application filed by Pfizer Inc filed Critical Pfizer Inc
Priority to MYPI2018702481A priority patent/MY192474A/en
Priority to KR1020187023865A priority patent/KR102479606B1/ko
Priority to EP17701190.5A priority patent/EP3405481B1/en
Priority to CN201780012883.XA priority patent/CN108699124A/zh
Priority to BR112018014585A priority patent/BR112018014585A2/pt
Publication of WO2017125830A1 publication Critical patent/WO2017125830A1/en
Priority to SA518392058A priority patent/SA518392058B1/ar
Priority to IL260666A priority patent/IL260666B2/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2863Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/14Blood; Artificial blood
    • A61K35/17Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4748Tumour specific antigens; Tumour rejection antigen precursors [TRAP], e.g. MAGE
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/7051T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/10Cells modified by introduction of foreign genetic material
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/567Framework region [FR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/33Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies

Definitions

  • the invention relates to chimeric antigen receptors (CAR).
  • CARs are able to redirect immune cell specificity and reactivity toward a selected target exploiting the ligand-binding domain properties.
  • the invention relates to CARs that specifically bind to Epidermal Growth Factor Receptor Variant III (EGFRvlll specific CARs).
  • EGFRvlll specific CARs Epidermal Growth Factor Receptor Variant III
  • the invention further relates to polynucleotides encoding EGFRvlll specific CAR and isolated cells expressing EGFRvlll specific CARs at their surface.
  • the invention further relates to methods for engineering immune cells expressing EGFRvlll specific CARs at their surface.
  • the invention is particularly useful for the treatment of solid tumors such as glioblastoma multiforme (GBM), non-small cell lung cancer, head and neck cancer, breast cancer, ovarian cancer, and prostate cancer.
  • the invention further relates to immune cells comprising the EGFRvlll specific CARs (EGFRvlll specific CAR-T cells), compositions comprising the EGFRvlll specific CAR-T cells, and methods of using the EGFRvlll specific CAR-T cells for treating EGFRvlll-mediated pathologies.
  • EGFR variant III (EGFRvlll), a tumor specific mutant of EGFR, is a product of genomic rearrangement which is often associated with wild-type EGFR gene
  • EGFRvlll is formed by an in-frame deletion of exons 2-7, leading to deletion of 267 amino acids with a glycine substitution at the junction.
  • the truncated receptor loses its ability to bind ligands but acquires constitutive kinase activity.
  • EGFRvlll always co-expresses with full length wild-type EGFR in the same tumor cells. Moreover, EGFRvlll expressing cells exhibit increased proliferation, invasion, angiogenesis and resistance to apoptosis.
  • EGFRvlll is most often found in glioblastoma multiforme (GBM). It is estimated that 25-35% of GBM carries this truncated receptors. Moreover, its expression often reflects a more aggressive phenotype and poor prognosis. Besides GBM, expression of EGFRvlll has also been reported in other solid tumors such as non-small cell lung cancer, head and neck cancer, breast cancer, ovarian cancer and prostate cancer. In contrast, EGFRvlll is not expressed in healthy tissues. The lack of expression in normal tissues makes EGFRvlll an ideal target for developing tumor specific targeted therapy.
  • GBM glioblastoma multiforme
  • T cells can be genetically modified to express chimeric antigen receptors (CARs), which are fusion proteins comprised of an antigen recognition moiety and T cell activation domains (see, e.g., Eshhar et al., Proc. Natl. Acad. Sci. USA, 90(2): 720-724 (1993), and Sadelain et al., Curr. Opin.
  • CARs chimeric antigen receptors
  • Chimeric antigen receptors that bind to EGFRvlll are provided. It is demonstrated that certain EGFRvlll specific CARs are effective when expressed in T cells to activate T cells upon contact with EGFRvlll.
  • the EGFRvlll specific CARs provided herein bind human EGFRvlll.
  • the EGFRvlll specific CAR-T cells provided herein exhibit degranulation activity, increased interferon gamma production, and/or cytotoxic activity upon contact with EGFRvlll- expressing cells.
  • the invention provides an EGFRvlll specific CAR comprising an extracellular ligand-binding domain, a first transmembrane domain, and an intracellular signaling domain, wherein the extracellular ligand-binding domain comprises (a) a heavy chain variable (VH) region comprising (i) a VH complementarity determining region one (CDR1 ) comprising the sequence shown in SEQ ID NO: 62, 63, 64, 74, 75, 76, 80, 81 , 82, 88, 89, 90, 109, 1 10, 1 1 1 1 , 1 15, 1 16, 1 17, 121 , 122, 123, 137, 138, or 139; (ii) a VH CDR2 comprising the sequence shown in SEQ ID NO: 70, 71 , 77, 78, 83, 84, 86, 87, 91 , 92, 1 12, 1 13, 1 18, 1 19, 124, 125, 127, 128, 140, or 141 ;
  • the invention provides an EGFRvlll specific CAR comprising an extracellular ligand-binding domain, a first transmembrane domain, and an intracellular signaling domain, wherein the extracellular ligand-binding domain comprises a single chain Fv fragment (scFv) comprising a heavy chain variable (VH) region comprising three CDRs from the VH region comprising the sequence shown in SEQ ID NO: 5, 9, 1 1 , 13, 15, 37, 39, 41 , 43, or 48; and/or a light chain variable (VL) region comprising three CDRs from the VL region comprising the sequence shown in SEQ ID NO: 6, 10, 12, 14, 16, 38, 40, 42, or 49.
  • scFv single chain Fv fragment
  • VH heavy chain variable
  • VL light chain variable
  • the VH region can comprise the sequence shown in SEQ ID NO: 5, 9, 1 1 , 13, 15, 37, 39, 41 , 43, or 48, or a variant thereof with one or several conservative amino acid substitutions in residues that are not within a CDR and/or the VL region can comprise the amino acid sequence shown in SEQ ID NO: 6, 10, 12, 14, 16, 38, 40, 42, or 49, or a variant thereof with one or several amino acid substitutions in amino acids that are not within a CDR.
  • the VH or VL region of the scFv can comprise an amino acid sequence described above or a variant thereof with no more than 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 conservative substitutions in residues that are not within a CDR.
  • the invention provides an EGFRvlll specific CAR comprising an extracellular ligand-binding domain, a first transmembrane domain, and an intracellular signaling domain, wherein the extracellular ligand-binding domain comprises a single chain Fv fragment (scFv) comprising a heavy chain variable (VH) region comprising the sequence shown in SEQ ID NO: 1 1 , 15, 30, 37, or 41 ; and/or a light chain variable (VL) region comprising the sequence shown in SEQ ID NO: 12, 16, 31 , 38, or 42.
  • the VH comprises the sequence shown in SEQ ID NO: 1 1
  • the VL comprises the sequence shown in SEQ ID NO: 12.
  • the VH comprises the sequence shown in SEQ ID NO: 15 and the VL comprises the sequence shown in SEQ ID NO: 16. In some embodiments, the VH comprises the sequence shown in SEQ ID NO: 30 and the VL comprises the sequence shown in SEQ ID NO: 31. In some embodiments, the VH comprises the sequence shown in SEQ ID NO: 37 and the VL comprises the sequence shown in SEQ ID NO: 38. In some embodiments, the VH comprises the sequence shown in SEQ ID NO: 41 and the VL comprises the sequence shown in SEQ ID NO: 42.
  • the intracellular signaling domain comprises a CD3zeta signaling domain. In some embodiments, the intracellular signaling domain comprises a 4-1 BB signaling domain. In some embodiments, the CAR can further comprise a second intracellular signaling domain. In some embodiments, the second intracellular signaling domain can comprise a 4-1 BB signaling domain. In some embodiments the first intracellular signaling domain comprises a CD3zeta signaling domain and the second intracellular signaling domain comprises a 4-1 BB signaling domain.
  • the CAR can comprise a stalk domain between the extracellular ligand-binding domain and the first transmembrane domain.
  • the stalk domain can be selected from the group consisting of: a human CD8a hinge, a human CD28 hinge, an lgG1 hinge, and an FcYRIIIa hinge.
  • the first transmembrane domain can comprise a CD8a chain transmembrane domain.
  • the CAR can comprise another extracellular ligand- binding domain which is not specific for EGFRvlll.
  • the extracellular ligand-binding domain(s), the first transmembrane domain, and intracellular signaling domain(s) are on a single polypeptide.
  • the CAR can comprise a second transmembrane domain, wherein the first transmembrane domain and the extracellular ligand-binding domain(s) are on a first polypeptide, and wherein the second transmembrane domain and the intracellular signaling domain(s) are on a second polypeptide, wherein the first transmembrane domain comprises a transmembrane domain from the a chain of the high-affinity IgE receptor (FcsRI) and the second transmembrane domain comprises a transmembrane domain from the ⁇ or ⁇ chain of FcsRI.
  • FcsRI high-affinity IgE receptor
  • the CAR can comprise a third polypeptide comprising a third transmembrane domain fused to an intracellular signaling domain from a co-stimulatory molecule, wherein the third transmembrane domain comprises a transmembrane domain from the ⁇ or ⁇ chain of FceRI.
  • the invention provides an isolated polynucleotide comprising a nucleic acid sequence encoding an EGFRvlll specific CAR as described herein. In another aspect, the invention provides an expression vector comprising a nucleic acid sequence encoding an EGFRvlll specific CAR antibody as described herein.
  • the invention provides an engineered immune cell expressing at its cell surface membrane an EGFRvlll specific CAR as described herein.
  • the engineered immune cell can comprise another CAR which is not specific for EGFRvlll.
  • the engineered immune cell can comprise a polynucleotide encoding a suicide polypeptide.
  • the suicide polypeptide is RQR8.
  • the polynucleotide encoding the suicide polypeptide is in a different nucleic acid molecule than the polynucleotide comprising a nucleic acid sequence encoding the EGFRvlll specific CAR.
  • the polynucleotide encoding the suicide polypeptide is part of the same nucleic acid molecule as the polynucleotide comprising a nucleic acid sequence encoding the EGFRvlll specific CAR.
  • an engineered immune cell containing an EGFRvlll-specific CAR can comprise a suicide polypeptide in a separate polypeptide chain from the polypeptide chain of the EGFRvlll-specific CAR.
  • an EGFRvlll specific CAR as described herein also comprises a suicide polypeptide in the same polypeptide chain as the CAR.
  • the suicide polypeptide may be between the scFv and hinge sequence of the CAR.
  • a suicide polypeptide in a CAR may have the R2 format as provided herein.
  • a suicide polypeptide comprises an epitope that is recognized by rituximab.
  • Also provided herein is a polynucleotide encoding an EGFRvlll specific CAR which also encodes a suicide polypeptide in the CAR.
  • the immune cell can be derived from an inflammatory T- lymphocyte, a cytotoxic T-lymphocyte, a regulatory T- lymphocyte, a memory T- lymphocyte, a helper T-lymphocyte, a natural killer T-lymphocyte, or a natural killer cell.
  • the engineered immune cell can comprise a disruption in one or more endogenous genes, wherein the endogenous gene encodes TCRa, TCRp, CD52, glucocorticoid receptor (GR), deoxycytidine kinase (dCK), or an immune checkpoint protein such as for example programmed death-1 (PD-1 ).
  • the immune cell is obtained from a healthy donor. In some embodiments, the immune cell is obtained from a patient.
  • the invention provides an engineered immune cell expressing at its cell surface membrane an EGFRvlll specific CAR as described herein for use as a medicament.
  • the medicament is for use in treatment of an EGFRvlll related cancer (e.g., any cancer with EGFRvlll expression) selecting from the group consisting of glioblastoma multiform, anaplastic astrocytoma, giant cell glioblastoma, gliosarcoma, anaplastic oligodendroglioma, anaplastic ependymoma, anaplastic oligoastrocytoma, choroid plexus carcinoma, anaplastic ganglioglioma, pineoblastoma, pineocytoma, meningioma, medulloepithelioma, ependymoblastoma, medulloblastoma, supraentorial primitive neuroectodermal tumor, atypical teratoid
  • the invention provides a method of engineering an immune cell comprising: providing an immune cell; and expressing at the surface of the cell at least one EGFRvlll specific CAR as described herein.
  • the method comprises: providing an immune cell; introducing into the cell at least one polynucleotide encoding said EGFRvlll specific CAR; and expressing said polynucleotide into the cell.
  • the method comprises providing an immune cell; introducing into the cell at least one polynucleotide encoding said EGFRvlll specific CAR; and introducing at least one other CAR which is not specific for EGFRvlll.
  • the invention provides a method of treating a subject suffering from a condition associated with malignant cells, the method comprising: providing an immune cell expressing at the surface an EGFRvlll specific CAR as described herein; and administering said immune cells to said patient.
  • the invention provides a pharmaceutical composition comprising an engineered immune cell as described herein.
  • the invention provides a method of treating a condition associated with malignant cells expressing EGFRvlll in a subject comprising administering to a subject in need thereof an effective amount of a pharmaceutical composition of claim comprising an engineered immune cell as described herein.
  • the condition is a cancer.
  • the cancer is an EGFRvlll related cancer selecting from the group consisting of glioblastoma multiform, anaplastic astrocytoma, giant cell glioblastoma, gliosarcoma, anaplastic oligodendroglioma, anaplastic ependymoma, anaplastic oligoastrocytoma, choroid plexus carcinoma, anaplastic ganglioglioma, pineoblastoma, pineocytoma, meningioma, medulloepithelioma, ependymoblastoma, medulloblastoma, supraentorial primitive neuroectodermal tumor, atypical teratoid/rhabdoid tumor, mixed glioma, head and neck cancer, non-small cell lung cancer, breast cancer, ovarian cancer, prostate cancer, medullobastoma, colorectal cancer, anal cancer, renal cancer, cervical cancer
  • the invention provides a method of inhibiting tumor growth or progression in a subject who has malignant cells expressing EGFRvlll, comprising administering to the subject in need thereof an effective amount of a pharmaceutical composition comprising an engineered immune cell as described herein.
  • the invention provides a method of inhibiting metastasis of malignant cells expressing EGFRvlll in a subject, comprising administering to the subject in need thereof an effective amount of a pharmaceutical composition comprising an engineered immune cell as described herein.
  • the invention provides a method inducing tumor regression in a subject who has malignant cells expressing EGFRvlll, comprising administering to the subject in need thereof an effective amount of a pharmaceutical composition comprising an engineered immune cell as described herein.
  • FIG. 1A, FIG. 1 B, and FIG. 1 C show examples of FACS binding histograms of three EGFRvlll antibodies: mAb 42G9 (FIG. 1A), 32A10 (FIG. 1 B) and 32G8 (FIG. 1 C), to three F98 cell lines: F98 (EGFR negative), F98-EGFRwt, and F98-EGFRvlll.
  • the X- axis is fluorescence intensity; the Y-axis is percentage of maximum / normalized to mode.
  • FIG. 2A shows a bar graph summarizing EGFRvlll specific CAR expression for CARs containing different EGFRvlll specific clones.
  • FIG. 2B shows a bar graph summarizing the percentage of EGFRvlll specific CAR T cells that bound to recombinant EGFR-mFc and EGFRvlll-mFc.
  • FIG. 2C shows a bar graph summarizing the expression of CARs containing 10 different EGFRvlll specific clones in CAR T cells.
  • FIG. 3 shows a bar graph summarizing degranulation activities of EGFRvlll specific CAR T cells expressing different EGFRvlll specific clones, alone or upon co- culture with various cell lines: cells that do not express any EGFR protein (NCI-H522 and U87-KO), cells express high level of wild-type EGFR (U87-KO-EGFRwt), or cells that express low (NCI-H522-EGFRvlll) and high (U87-KO-EGFRvlll) levels of EGFRvlll.
  • FIG. 4 shows a bar graph summarizing IFNy secretion by EGFRvlll specific CAR
  • T cells expressing different EGFRvlll specific clones alone or upon co-culture with various cell lines: cells that do not express any EGFR protein (NCI-H522 and U87-KO), cells express high level of wild-type EGFR (U87-KO-EGFRwt), or cells that express low (NCI-H522-EGFRvlll) and high (U87-KO-EGFRvlll) levels of EGFRvlll.
  • FIG. 5 shows a bar graph comparing the cytotoxicity of EGFRvlll specific CAR T cells expressing different EGFRvlll specific clones towards a wild-type EGFR expressing cell line (U87-KO-EGFRwt) vs high (U87-KO-EGFRvlll) and low EGFRvlll (NCI-H522-EGFRvlll) expressing cell lines.
  • FIG. 6 shows a graph summarizing the anti-tumor activities of EGFRvlll specific CAR T cells expressing different EGFRvlll specific clones against GBM cells in a subcutaneous GBM xenograft model.
  • FIG. 7 shows a bar graph summarizing the CAR expression by CAR T cells expressing four different EGFRvlll specific clones in the CAR and carrying the intra- CAR suicide sequence R2 in the CAR on Day 4, Day 9/10, and Day 14/15 post-T cell transduction.
  • FIG. 8 shows a bar graph summarizing the CAR expression by CAR T cells expressing four different EGFRvlll specific clones in the CAR and carrying the intra- CAR suicide sequence R2 on Day 4 and Day 14/15 post-T cell transduction.
  • FIG. 9 shows a bar graph summarizing the cytotoxicity of CAR T cells expressing four different EGFRvlll specific clones and carrying the intra-CAR suicide sequence R2 against a high level (U87-KO-EGFRvlll) and a low level EGFRvlll (NCI-H522-EGFRvlll) expressing cell line.
  • the invention disclosed herein provides chimeric antigen receptors (CARs) and immune cells comprising CARs (e.g. CAR-T cells) that specifically bind to EGFRvlll (e.g., human EGFRvlll).
  • CARs chimeric antigen receptors
  • the invention also provides polynucleotides encoding these CARs, compositions comprising these CAR-T cells, and methods of making and using these CARs and CAR-T cells.
  • the invention also provides methods for treating a condition associated with EGFRvlll-mediated pathologies in a subject, such as cancer.
  • extracellular ligand-binding domain refers to an oligo- or polypeptide that is capable of binding a ligand.
  • the domain will be capable of interacting with a cell surface molecule.
  • the extracellular ligand-binding domain may be chosen to recognize a ligand that acts as a cell surface marker on target cells associated with a particular disease state.
  • stalk domain or "hinge domain” are used interchangeably herein to refer to any oligo- or polypeptide that functions to link the transmembrane domain to the extracellular ligand- binding domain.
  • stalk domains are used to provide more flexibility and accessibility for the extracellular ligand-binding domain.
  • intracellular signaling domain refers to the portion of a protein which transduces the effector function signal and directs the cell to perform a specialized function.
  • a "co-stimulatory molecule” as used herein refers to the cognate binding partner on a T cell that specifically binds with a co-stimulatory ligand, thereby mediating a co- stimulatory response by the cell, such as, but not limited to proliferation.
  • Co-stimulatory molecules include, but are not limited to an MHC class I molecule, BTLA and Toll ligand receptor.
  • costimulatory molecules examples include CD27, CD28, CD8, 4-1 BB (CD137), OX40, CD30, CD40, PD-1 , ICOS, lymphocyte function-associated antigen-1 (LFA-1 ), CD2, CD7, LIGHT, NKG2C, B7-H3 and a ligand that specifically binds with CD83 and the like.
  • a "co-stimulatory ligand” refers to a molecule on an antigen presenting cell that specifically binds a cognate co-stimulatory signal molecule on a T cell, thereby providing a signal which, in addition to the primary signal provided by, for instance, binding of a TCR/CD3 complex with an MHC molecule loaded with peptide, mediates a T cell response, including, but not limited to, proliferation activation, differentiation, cytokine production, and the like.
  • a co-stimulatory ligand can include but is not limited to CD7, B7-1 (CD80), B7-2 (CD86), PD-L1 , PD-L2, 4-1 BBL, OX40L, inducible costimulatory igand (ICOS-L), intercellular adhesion molecule (ICAM, CD30L, CD40, CD70, CD83, HLA-G, MICA, M1 CB, HVEM, lymphotoxin ⁇ receptor, 3/TR6, ILT3, ILT4, an agonist or antibody that binds Toll ligand receptor and a ligand that specifically binds with B7-H3.
  • a co-stimulatory ligand also encompasses, inter alia, an antibody that specifically binds with a co-stimulatory molecule present on a T cell, such as but not limited to, CD27, CD28, 4-1 BB, OX40, CD30, CD40, PD-1 , ICOS, lymphocyte function- associated antigen-1 (LFA-1 ), CD2, CD7, LIGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83.
  • an antibody that specifically binds with a co-stimulatory molecule present on a T cell such as but not limited to, CD27, CD28, 4-1 BB, OX40, CD30, CD40, PD-1 , ICOS, lymphocyte function- associated antigen-1 (LFA-1 ), CD2, CD7, LIGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83.
  • an “antibody” is an immunoglobulin molecule capable of specific binding to a target, such as a carbohydrate, polynucleotide, lipid, polypeptide, etc., through at least one antigen recognition site, located in the variable region of the immunoglobulin molecule.
  • a target such as a carbohydrate, polynucleotide, lipid, polypeptide, etc.
  • the term encompasses not only intact polyclonal or monoclonal antibodies, but also antigen binding fragments thereof (such as Fab, Fab', F(ab') 2 , Fv), single chain (scFv) and domain antibodies (including, for example, shark and camelid antibodies), and fusion proteins comprising an antibody, and any other modified configuration of the immunoglobulin molecule that comprises an antigen recognition site.
  • An antibody includes an antibody of any class, such as IgG, IgA, or IgM (or sub-class thereof), and the antibody need not be of any particular class.
  • immunoglobulins can be assigned to different classes. There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), e.g., lgG1 , lgG2, lgG3, lgG4, lgA1 and lgA2.
  • the heavy-chain constant regions that correspond to the different classes of immunoglobulins are called alpha, delta, epsilon, gamma, and mu, respectively.
  • the subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known.
  • antigen binding fragment or "antigen binding portion” of an antibody, as used herein, refers to one or more fragments of an intact antibody that retain the ability to specifically bind to a given antigen (e.g., EGFRvlll). Antigen binding functions of an antibody can be performed by fragments of an intact antibody.
  • binding fragments encompassed within the term "antigen binding fragment" of an antibody include Fab; Fab'; F(ab')2; an Fd fragment consisting of the VH and CH1 domains; an Fv fragment consisting of the VL and VH domains of a single arm of an antibody; a single domain antibody (dAb) fragment (Ward et al., Nature 341 :544-546, 1989), and an isolated complementarity determining region (CDR).
  • An antibody, an antibody conjugate, or a polypeptide that "preferentially binds” or “specifically binds” (used interchangeably herein) to a target is a term well understood in the art, and methods to determine such specific or preferential binding are also well known in the art.
  • a molecule is said to exhibit "specific binding” or “preferential binding” if it reacts or associates more frequently, more rapidly, with greater duration and/or with greater affinity with a particular cell or substance than it does with alternative cells or substances.
  • an antibody “specifically binds” or “preferentially binds” to a target if it binds with greater affinity, avidity, more readily, and/or with greater duration than it binds to other substances.
  • an antibody that specifically or preferentially binds to an EGFRvlll epitope is an antibody that binds this epitope with greater affinity, avidity, more readily, and/or with greater duration than it binds to other EGFRvlll epitopes or non- EGFRvlll epitopes.
  • an antibody (or moiety or epitope) that specifically or preferentially binds to a first target may or may not specifically or preferentially bind to a second target.
  • “specific binding” or “preferential binding” does not necessarily require (although it can include) exclusive binding. Generally, but not necessarily, reference to binding means preferential binding.
  • variable region of an antibody refers to the variable region of the antibody light chain or the variable region of the antibody heavy chain, either alone or in combination.
  • variable regions of the heavy and light chain each consist of four framework regions (FR) connected by three complementarity determining regions (CDRs) also known as hypervariable regions.
  • FR framework regions
  • CDRs complementarity determining regions
  • the CDRs in each chain are held together in close proximity by the FRs and, with the CDRs from the other chain, contribute to the formation of the antigen binding site of antibodies.
  • a CDR may refer to CDRs defined by either approach or by a combination of both approaches.
  • a "CDR" of a variable domain are amino acid residues within the variable region that are identified in accordance with the definitions of the Kabat, Chothia, the accumulation of both Kabat and Chothia, AbM, contact, and/or conformational definitions or any method of CDR determination well known in the art.
  • Antibody CDRs may be identified as the hypervariable regions originally defined by Kabat et al. See, e.g., Kabat et al., 1992, Sequences of Proteins of Immunological Interest, 5th ed., Public Health Service, NIH, Washington D.C. The positions of the CDRs may also be identified as the structural loop structures originally described by Chothia and others.
  • CDR identification includes the "AbM definition,” which is a compromise between Kabat and Chothia and is derived using Oxford Molecular's AbM antibody modeling software (now Accelrys®), or the "contact definition" of CDRs based on observed antigen contacts, set forth in MacCallum et al., J. Mol. Biol., 262:732-745, 1996.
  • the positions of the CDRs may be identified as the residues that make enthalpic contributions to antigen binding.
  • a CDR may refer to CDRs defined by any approach known in the art, including combinations of approaches. The methods used herein may utilize CDRs defined according to any of these approaches. For any given embodiment containing more than one CDR, the CDRs may be defined in accordance with any of Kabat, Chothia, extended, AbM, contact, and/or conformational definitions.
  • monoclonal antibody refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally-occurring mutations that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic site. Furthermore, in contrast to polyclonal antibody preparations, which typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen.
  • the modifier "monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
  • the monoclonal antibodies to be used in accordance with the invention may be made by the hybridoma method first described by Kohler and Milstein, Nature 256:495, 1975, or may be made by recombinant DNA methods such as described in U.S. Pat. No. 4,816,567.
  • the monoclonal antibodies may also be isolated from phage libraries generated using the techniques described in McCafferty et al., Nature 348:552-554, 1990, for example.
  • humanized antibody refers to forms of non-human (e.g. murine) antibodies that are chimeric immunoglobulins, immunoglobulin chains, or fragments thereof (such as Fv, Fab, Fab', F(ab') 2 or other antigen binding subsequences of antibodies) that contain minimal sequence derived from non-human immunoglobulin.
  • humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a complementarity determining region (CDR) of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat, or rabbit having the desired specificity, affinity, and capacity.
  • CDR complementarity determining region
  • Fv framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues.
  • the humanized antibody may comprise residues that are found neither in the recipient antibody nor in the imported CDR or framework sequences, but are included to further refine and optimize antibody performance.
  • the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence.
  • the humanized antibody optimally also will comprise at least a portion of an immunoglobulin constant region or domain (Fc), typically that of a human immunoglobulin.
  • CDR L1 , CDR L2, CDR L3, CDR H 1 , CDR H2, or CDR H3 are altered with respect to the original antibody, which are also termed one or more CDRs "derived from" one or more CDRs from the original antibody.
  • human antibody means an antibody having an amino acid sequence corresponding to that of an antibody produced by a human and/or which has been made using any of the techniques for making human antibodies known to those skilled in the art or disclosed herein.
  • This definition of a human antibody includes antibodies comprising at least one human heavy chain polypeptide or at least one human light chain polypeptide.
  • One such example is an antibody comprising murine light chain and human heavy chain polypeptides.
  • Human antibodies can be produced using various techniques known in the art. In one embodiment, the human antibody is selected from a phage library, where that phage library expresses human antibodies (Vaughan et al., Nature Biotechnology, 14:309-314, 1996; Sheets et al., Proc. Natl. Acad.
  • Human antibodies can also be made by immunization of animals into which human immunoglobulin loci have been transgenically introduced in place of the endogenous loci, e.g., mice in which the endogenous immunoglobulin genes have been partially or completely inactivated. This approach is described in U.S. Pat. Nos. 5,545,807; 5,545,806; 5,569,825; 5,625, 126; 5,633,425; and 5,661 ,016.
  • the human antibody may be prepared by immortalizing human B lymphocytes that produce an antibody directed against a target antigen (such B lymphocytes may be recovered from an individual or from single cell cloning of the cDNA, or may have been immunized in vitro). See, e.g., Cole et al. Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77, 1985; Boerner et al., J. Immunol., 147 (1 ):86-95, 1991 ; and U.S. Pat. No. 5,750,373.
  • chimeric antibody is intended to refer to antibodies in which the variable region sequences are derived from one species and the constant region sequences are derived from another species, such as an antibody in which the variable region sequences are derived from a mouse antibody and the constant region sequences are derived from a human antibody.
  • polypeptide oligopeptide
  • peptide protein
  • chain may be relatively short (e.g., 10-100 amino acids), or longer.
  • the chain may be linear or branched, it may comprise modified amino acids, and/or may be interrupted by non-amino acids.
  • the terms also encompass an amino acid chain that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation with a labeling component.
  • polypeptides containing one or more analogs of an amino acid including, for example, unnatural amino acids, etc.
  • polypeptides can occur as single chains or associated chains.
  • a "monovalent antibody” comprises one antigen binding site per molecule (e.g., IgG or Fab). In some instances, a monovalent antibody can have more than one antigen binding sites, but the binding sites are from different antigens.
  • bivalent antibody comprises two antigen binding sites per molecule (e.g., IgG). In some instances, the two binding sites have the same antigen specificities. However, bivalent antibodies may be bispecific.
  • bispecific or dual-specific is a hybrid antibody having two different antigen binding sites.
  • the two antigen binding sites of a bispecific antibody bind to two different epitopes, which may reside on the same or different protein targets.
  • a “Afunctional” is an antibody having identical antigen binding sites (i.e., identical amino acid sequences) in the two arms but each binding site can recognize two different antigens.
  • Antibodies of the invention can be produced using techniques well known in the art, e.g., recombinant technologies, phage display technologies, synthetic technologies or combinations of such technologies or other technologies readily known in the art (see, for example, Jayasena, S.D., Clin. Chem., 45: 1628-50, 1999 and Fellouse, F.A., et al, J. Mol. Biol., 373(4):924-40, 2007).
  • polynucleotide or “nucleic acid,” as used interchangeably herein, refer to chains of nucleotides of any length, and include DNA and RNA.
  • the nucleotides can be deoxyribonucleotides, ribonucleotides, modified nucleotides or bases, and/or their analogs, or any substrate that can be incorporated into a chain by DNA or RNA polymerase.
  • a polynucleotide may comprise modified nucleotides, such as methylated nucleotides and their analogs. If present, modification to the nucleotide structure may be imparted before or after assembly of the chain.
  • the sequence of nucleotides may be interrupted by non-nucleotide components.
  • a polynucleotide may be further modified after polymerization, such as by conjugation with a labeling component.
  • Other types of modifications include, for example, "caps", substitution of one or more of the naturally occurring nucleotides with an analog, internucleotide modifications such as, for example, those with uncharged linkages (e.g., methyl phosphonates, phosphotriesters, phosphoamidates, carbamates, etc.) and with charged linkages (e.g., phosphorothioates, phosphorodithioates, etc.), those containing pendant moieties, such as, for example, proteins (e.g., nucleases, toxins, antibodies, signal peptides, poly-L-lysine, etc.), those with intercalators (e.g., acridine, psoralen, etc.), those containing chelators (e.g., metal
  • any of the hydroxyl groups ordinarily present in the sugars may be replaced, for example, by phosphonate groups, phosphate groups, protected by standard protecting groups, or activated to prepare additional linkages to additional nucleotides, or may be conjugated to solid supports.
  • the 5' and 3' terminal OH can be phosphorylated or substituted with amines or organic capping group moieties of from 1 to 20 carbon atoms.
  • Other hydroxyls may also be derivatized to standard protecting groups.
  • Polynucleotides can also contain analogous forms of ribose or deoxyribose sugars that are generally known in the art, including, for example, 2'-0-methyl-, 2'-0-allyl, 2'-fluoro- or 2'-azido-ribose, carbocyclic sugar analogs, alpha- or beta-anomeric sugars, epimeric sugars such as arabinose, xyloses or lyxoses, pyranose sugars, furanose sugars, sedoheptuloses, acyclic analogs and abasic nucleoside analogs such as methyl riboside.
  • One or more phosphodiester linkages may be replaced by alternative linking groups.
  • linking groups include, but are not limited to, embodiments wherein phosphate is replaced by P(0)S("thioate”), P(S)S ("dithioate”), (0)NR 2 ("amidate”), P(0)R, P(0)OR', CO or CH 2 ("formacetal”), in which each R or R' is independently H or substituted or unsubstituted alkyl (1 -20 C) optionally containing an ether (-0-) linkage, aryl, alkenyl, cycloalkyl, cycloalkenyl or araldyl. Not all linkages in a polynucleotide need be identical. The preceding description applies to all polynucleotides referred to herein, including RNA and DNA.
  • a "constant region" of an antibody refers to the constant region of the antibody light chain or the constant region of the antibody heavy chain, either alone or in combination.
  • substantially pure refers to material which is at least 50% pure (i.e., free from contaminants), more preferably, at least 90% pure, more preferably, at least 95% pure, yet more preferably, at least 98% pure, and most preferably, at least 99% pure.
  • a "host cell” includes an individual cell or cell culture that can be or has been a recipient for vector(s) for incorporation of polynucleotide inserts.
  • Host cells include progeny of a single host cell, and the progeny may not necessarily be completely identical (in morphology or in genomic DNA complement) to the original parent cell due to natural, accidental, or deliberate mutation.
  • a host cell includes cells transfected in vivo with a polynucleotide(s) of this invention.
  • immune cell refers to a cell of hematopoietic origin functionally involved in the initiation and/or execution of innate and/or adaptative immune response.
  • the term "Fc region” is used to define a C-terminal region of an immunoglobulin heavy chain.
  • the "Fc region” may be a native sequence Fc region or a variant Fc region.
  • the human IgG heavy chain Fc region is usually defined to stretch from an amino acid residue at position Cys226, or from Pro230, to the carboxyl- terminus thereof.
  • the numbering of the residues in the Fc region is that of the EU index as in Kabat. Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md., 1991.
  • the Fc region of an immunoglobulin generally comprises two constant regions, CH2 and CH3.
  • Fc receptor and “FcR” describe a receptor that binds to the Fc region of an antibody.
  • the preferred FcR is a native sequence human FcR.
  • a preferred FcR is one which binds an IgG antibody (a gamma receptor) and includes receptors of the FcyRI, FcyRII, and FcyRIII subclasses, including allelic variants and alternatively spliced forms of these receptors.
  • FcyRII receptors include FcyRIIA (an “activating receptor”) and FcyRIIB (an “inhibiting receptor”), which have similar amino acid sequences that differ primarily in the cytoplasmic domains thereof.
  • FcRs are reviewed in Ravetch and Kinet, Ann. Rev. Immunol., 9:457-92, 1991 ; Capel et al., Immunomethods, 4:25-34, 1994; and de Haas et al., J. Lab. Clin. Med., 126:330-41 , 1995.
  • FcR also includes the neonatal receptor, FcRn, which is responsible for the transfer of maternal IgGs to the fetus (Guyer et al., J. Immunol., 1 17:587, 1976; and Kim et al., J. Immunol., 24:249, 1994).
  • Compet means that a first antibody, or an antigen binding fragment (or portion) thereof, binds to an epitope in a manner sufficiently similar to the binding of a second antibody, or an antigen binding portion thereof, such that the result of binding of the first antibody with its cognate epitope is detectably decreased in the presence of the second antibody compared to the binding of the first antibody in the absence of the second antibody.
  • the alternative, where the binding of the second antibody to its epitope is also detectably decreased in the presence of the first antibody can, but need not be the case. That is, a first antibody can inhibit the binding of a second antibody to its epitope without that second antibody inhibiting the binding of the first antibody to its respective epitope.
  • each antibody detectably inhibits the binding of the other antibody with its cognate epitope or ligand, whether to the same, greater, or lesser extent, the antibodies are said to "cross-compete" with each other for binding of their respective epitope(s).
  • Both competing and cross-competing antibodies are encompassed by the invention. Regardless of the mechanism by which such competition or cross-competition occurs (e.g., steric hindrance, conformational change, or binding to a common epitope, or portion thereof), the skilled artisan would appreciate, based upon the teachings provided herein, that such competing and/or cross-competing antibodies are encompassed and can be useful for the methods disclosed herein.
  • autologous means that cells, a cell line, or population of cells used for treating patients are originating from said patient or from a Human Leucocyte Antigen (HLA) compatible donor.
  • HLA Human Leucocyte Antigen
  • allogeneic means that cells or population of cells used for treating patients are not originating from said patient but from a donor.
  • beneficial or desired clinical results include, but are not limited to, one or more of the following: reducing the proliferation of (or destroying) neoplastic or cancerous cells, inhibiting metastasis of neoplastic cells, shrinking or decreasing the size of EGFRvlll expressing tumor, remission of an EGFRvlll associated disease (e.g., cancer), decreasing symptoms resulting from an EGFRvlll associated disease (e.g., cancer), increasing the quality of life of those suffering from an EGFRvlll associated disease (e.g., cancer), decreasing the dose of other medications required to treat an EGFRvlll associated disease (e.g., cancer), delaying the progression of an EGFRvlll associated disease (e.g., cancer), curing an EGFRvlll associated disease (e.g., cancer), and/or prolong survival of patients having an EGFRvlll associated disease (e.g.
  • “Ameliorating” means a lessening or improvement of one or more symptoms as compared to not administering an EGFRvlll specific CAR. “Ameliorating” also includes shortening or reduction in duration of a symptom.
  • an "effective dosage” or “effective amount” of drug, compound, or pharmaceutical composition is an amount sufficient to effect any one or more beneficial or desired results.
  • beneficial or desired results include eliminating or reducing the risk, lessening the severity, or delaying the outset of the disease, including biochemical, histological and/or behavioral symptoms of the disease, its complications and intermediate pathological phenotypes presenting during development of the disease.
  • beneficial or desired results include clinical results such as reducing incidence or amelioration of one or more symptoms of various EGFRvlll associated diseases or conditions (such as for example glioblastoma multiform), decreasing the dose of other medications required to treat the disease, enhancing the effect of another medication, and/or delaying the progression of the EGFRvlll associated disease of patients.
  • An effective dosage can be administered in one or more administrations.
  • an effective dosage of drug, compound, or pharmaceutical composition is an amount sufficient to accomplish prophylactic or therapeutic treatment either directly or indirectly.
  • an effective dosage of a drug, compound, or pharmaceutical composition may or may not be achieved in conjunction with another drug, compound, or pharmaceutical composition.
  • an "effective dosage" may be considered in the context of administering one or more therapeutic agents, and a single agent may be considered to be given in an effective amount if, in conjunction with one or more other agents, a desirable result may be or is achieved.
  • mammals are mammals, more preferably, a human. Mammals also include, but are not limited to primates, horses, dogs, cats, mice and rats.
  • vector means a construct, which is capable of delivering, and, preferably, expressing, one or more gene(s) or sequence(s) of interest in a host cell.
  • vectors include, but are not limited to, viral vectors, naked DNA or RNA expression vectors, plasmid, cosmid or phage vectors, DNA or RNA expression vectors associated with cationic condensing agents, DNA or RNA expression vectors encapsulated in liposomes, and certain eukaryotic cells, such as producer cells.
  • expression control sequence means a nucleic acid sequence that directs transcription of a nucleic acid.
  • An expression control sequence can be a promoter, such as a constitutive or an inducible promoter, or an enhancer.
  • the expression control sequence is operably linked to the nucleic acid sequence to be transcribed.
  • pharmaceutically acceptable carrier or “pharmaceutical acceptable excipient” includes any material which, when combined with an active ingredient, allows the ingredient to retain biological activity and is non-reactive with the subject's immune system.
  • Examples include, but are not limited to, any of the standard pharmaceutical carriers such as a phosphate buffered saline solution, water, emulsions such as oil/water emulsion, and various types of wetting agents.
  • Preferred diluents for aerosol or parenteral administration are phosphate buffered saline (PBS) or normal (0.9%) saline.
  • Compositions comprising such carriers are formulated by well known conventional methods (see, for example, Remington's Pharmaceutical Sciences, 18th edition, A. Gennaro, ed., Mack Publishing Co., Easton, PA, 1990; and Remington, The Science and Practice of Pharmacy 21 st Ed. Mack Publishing, 2005).
  • k on or "k a ", as used herein, refers to the rate constant for association of an antibody to an antigen.
  • the rate constants (k on/ k a and koff/k d ) and equilibrium dissociation constants may be measured using, for example, full-length antibodies and/or Fab antibody fragments and corresponding antigen.
  • k 0ff or "kd”, as used herein, refers to the rate constant for dissociation of an antibody from the antibody/antigen complex.
  • K D refers to the equilibrium dissociation constant of an antibody-antigen interaction.
  • Determinations of the association and dissociation rate constants, k on and k 0 ff respectively, may be made using a surface plasmon resonance-based biosensor to characterize an analyte/ligand interaction under conditions where the analyte is monovalent with respect to binding a ligand that is immobilized at low capacity onto a sensor surface via a capture reagent.
  • the analysis is performed using a kinetic titration methodology as described in Karlsson et al., Anal. Biochem 349, 136-147, 2006.
  • the sensor chip, capturing reagent, and assay buffer employed for a given assay are chosen to give stable capture of ligand onto the sensor surface, minimize non-specific binding of the analyte to the surfaces, and yield analyte-binding responses that are appropriate for kinetic analysis, per the recommendations in Myszka, J. Mol. Recognit 12, 279-284, 1999.
  • the analyte-binding responses per analyte/ligand interaction are double referenced and fit to a 1 : 1 Langmuir "mass transport limited model" with k a , k d and R max as global parameters as described in Myszka & Morton et al., Biophys. Chem 64, 127-137 (1997).
  • references to "about” a value or parameter herein includes (and describes) embodiments that are directed to that value or parameter per se.
  • description referring to "about X” includes description of "X.”
  • Numeric ranges are inclusive of the numbers defining the range.
  • the term “about” refers to the indicated value of the variable and to all values of the variable that are within the experimental error of the indicated value (e.g. within the 95% confidence interval for the mean) or within 10 percent of the indicated value, whichever is greater.
  • the term “about” is used within the context of a time period (years, months, weeks, days etc.)
  • the term “about” means that period of time plus or minus one amount of the next subordinate time period (e.g. about 1 year means 1 1 -13 months; about 6 months means 6 months plus or minus 1 week; about 1 week means 6-8 days; etc.), or within 10 per cent of the indicated value, whichever is greater.
  • the invention encompasses not only the entire group listed as a whole, but each member of the group individually and all possible subgroups of the main group, but also the main group absent one or more of the group members.
  • the invention also envisages the explicit exclusion of one or more of any of the group members in the claimed invention.
  • the invention provides CARs that bind to EGFRvll l (e.g. , human EGFRvl l l (e.g. ,
  • EGFRvl ll specific CARs provided herein include single chain CARS and multichain CARs.
  • the CARs have the ability to redirect T cell specificity and reactivity toward EGFRvll l in a non-MHC-restricted manner, exploiting the antigen-binding properties of monoclonal antibodies.
  • the non-MHC-restricted antigen recognition gives T cells expressing CARs the ability to recognize an antigen independent of antigen processing, thus bypassing a major mechanism of tumor escape.
  • CARs provided herein comprise an extracellular ligand- binding domain (e.g., a single chain variable fragment (scFv)), a transmembrane domain, and an intracellular signaling domain.
  • the extracellular ligand-binding domain, transmembrane domain, and intracellular signaling domain are in one polypeptide, i.e., in a single chain. Multichain CARs and polypeptides are also provided herein.
  • the multichain CARs comprise: a first polypeptide comprising a transmembrane domain and at least one extracellular ligand- binding domain, and a second polypeptide comprising a transmembrane domain and at least one intracellular signaling domain, wherein the polypeptides assemble together to form a multichain CAR.
  • an EGFRvll l specific multichain CAR is based on the high affinity receptor for IgE (FCERI).
  • FCERI high affinity receptor for IgE
  • the Fc RI expressed on mast cells and basophiles triggers allergic reactions.
  • FcsRI is a tetrameric complex composed of a single a subunit, a single ⁇ subunit, and two disulfide-linked ⁇ subunits.
  • the a subunit contains the IgE-binding domain.
  • the ⁇ and ⁇ subunits contain ITAMs that mediate signal transduction.
  • the extracellular domain of the FcRa chain is deleted and replaced by an EGFRvl ll specific extracellular ligand-binding domain.
  • the multichain EGFRvl ll specific CAR comprises an scFv that binds specifically to EGFRvll l, the CD8a hinge, and the ITAM of the FcRp chain.
  • the CAR may or may not comprise the FcRy chain.
  • the extracellular ligand-binding domain comprises an scFv comprising the light chain variable (VL) region and the heavy chain variable (VH) region of a target antigen specific monoclonal antibody joined by a flexible linker.
  • Single chain variable region fragments are made by linking light and/or heavy chain variable regions by using a short linking peptide (Bird et al., Science 242:423-426, 1988).
  • linking peptide is the GS linker having the amino acid sequence (GGGGS) 4 (SEQ ID NO: 202), which bridges approximately 3.5 nm between the carboxyl terminus of one variable region and the amino terminus of the other variable region.
  • Linkers of other sequences have been designed and used (Bird et al., 1988, supra).
  • linkers can be short, flexible polypeptides and preferably comprised of about 20 or fewer amino acid residues.
  • Linkers can in turn be modified for additional functions, such as attachment of drugs or attachment to solid supports.
  • the single chain variants can be produced either recombinantly or synthetically. For synthetic production of scFv, an automated synthesizer can be used.
  • a suitable plasmid containing polynucleotide that encodes the scFv can be introduced into a suitable host cell, either eukaryotic, such as yeast, plant, insect or mammalian cells, or prokaryotic, such as E. coli.
  • a suitable host cell either eukaryotic, such as yeast, plant, insect or mammalian cells, or prokaryotic, such as E. coli.
  • Polynucleotides encoding the scFv of interest can be made by routine manipulations such as ligation of polynucleotides.
  • the resultant scFv can be isolated using standard protein purification techniques known in the art.
  • the extracellular ligand-binding domain comprises (a) a VH region comprising (i) a VH complementarity determining region one (CDR1 ) comprising the sequence shown in SEQ ID NO: 62, 63, 64, 74, 75, 76, 80, 81 , 82, 88, 89, 90, 93, 94, 95, 99, 100, 101 , 109, 1 10, 1 1 1 , 1 15, 1 16, 1 17, 121 , 122, 123, 132, 133,134, 137, 138, 139, 143, 144, or 145; (ii) a VH CDR2 comprising the sequence shown in SEQ ID NO: 65, 66, 68, 69, 70, 71 , 77, 78, 83, 84, 86, 87, 91 , 92, 96, 97, 98, 102, 103, 105, 106, 1 12, 1 13, 1 18, 1 19, 124,
  • the extracellular ligand-binding domain comprises (a) a
  • VH region comprising (i) a VH complementarity determining region one (CDR1 ) comprising the sequence shown in SEQ ID NO: 62, 63, 64, 74, 75, 76, 80, 81 , 82, 88, 89, 90, 109, 1 10, 1 1 1 , 1 15, 1 16, 1 17, 121 , 122, 123, 137, 138, or 139; (ii) a VH CDR2 comprising the sequence shown in SEQ ID NO: 70, 71 , 77, 78, 83, 84, 86, 87, 91 , 92, 1 12, 1 13, 1 18, 1 19, 124, 125, 127, 128, 140, or 141 ; and iii) a VH CDR3 comprising the sequence shown in SEQ ID NO: 73, 79, 85, 1 14, 120, 126, 129, or 142, and/or (b) a VL region comprising (i) a VL CDR1 compris
  • CAR which specifically binds to EGFRvlll
  • the CAR comprises an extracellular ligand-binding domain comprising: a VH region comprising a VH CDR1 , VH CDR2, and VH CDR3 of the VH sequence shown in SEQ ID NO: 1 , 3, 5, 7, 9, 1 1 , 13, 15, 17, 19, 21 , 23, 25, 27, 30, 32, 34, 35, 37, 39, 41 , 43, 44, 46, 48, or 50; and/or a VL region comprising VL CDR1 , VL CDR2, and VL CDR3 of the VL sequence shown in SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 29, 31 , 33, 36, 38, 40, 42, 45, 47, 49, or 51.
  • the VH and VL are linked together by a flexible linker.
  • a flexible linker comprises the amino acid sequence shown in SEQ ID NO: 202.
  • the CAR comprises an extracellular ligand-binding domain comprising: a VH region comprising a VH CDR1 , VH CDR2, and VH CDR3 of the VH sequence shown in SEQ ID NO: 5, 9, 1 1 , 13, 15, 37, 39, 41 , 43, or 48; and/or a VL region comprising VL CDR1 , VL CDR2, and VL CDR3 of the VL sequence shown in SEQ ID NO: 6, 10, 12, 14, 16, 38, 40, 42, or 49.
  • the VH and VL are linked together by a flexible linker.
  • a flexible linker comprises the amino acid sequence shown in SEQ ID NO: 202.
  • a CAR of the invention comprises an extracellular ligand- binding domain having any one of partial light chain sequence as listed in Table 1 and/or any one of partial heavy chain sequence as listed in Table 1.
  • the underlined sequences are CDR sequences according to Kabat and in bold according to Chothia.
  • the different mAbs of Table 1 may also be referred to herein as different anti- EGFRvlll antibody "clones”.
  • RVSQSI G AN LAWYQ Q KF GQ A P R SGFSLSNARMGVSWIRQPPGKAL
  • GTEFSLTISSLQSEDFAVYFCQQ SKDTSKSQVVLTMTNMDPVDTAT YKDWPFTFGPGTKVEIK (SEQ ID YYCARDSSNYEGYFDYWGQGILV NO: 16) TVSS (SEQ ID NO: 15)
  • VSS SEQ ID NO: 19
  • VSS (SEQ ID NO: 23)
  • VTVSS (SEQ ID NO: 39)
  • VTVSS (SEQ ID NO: 43)
  • VTVSS (SEQ ID NO: 44)
  • CDR portions of extracellular ligand-binding domains of CARs to EGFRvlll including Chothia, Kabat CDRs, and CDR contact regions. Determination of CDR regions is well within the skill of the art. It is understood that in some embodiments, CDRs can be a combination of the Kabat and Chothia CDR (also termed “combined CRs" or “extended CDRs”). In some embodiments, the CDRs are the Kabat CDRs. In other embodiments, the CDRs are the Chothia CDRs. In other words, in embodiments with more than one CDR, the CDRs may be any of Kabat, Chothia, combination CDRs, or combinations thereof. Table 2 provides examples of CDR sequences provided herein.
  • GYTFTDYTLH (SEQ I D NO: ID NO: 69) (Chothia) 64) (extended)
  • GYTFTDYTLH (SEQ I D NO: ID NO: 71) (Chothia) 64) (extended)
  • GYTFTDYTLH (SEQ I D NO: ID NO: 71) (Chothia) 64) (extended)
  • E10 SNARMGVS (SEQ ID NO: 80) HIFSTDEKSIRRSLRS DSSNYEGYFDYH6 (Kabat); (SEQ ID NO: 83) (SEQ ID NO: 85)
  • GFTFSD (SEQ ID NO: 110) (SEQ ID NO: 112) (Chothia); (Kabat)
  • GFTFSDAWMS SEQ ID NO: RI KSKTDGGTTDY
  • GFTFSY AWMS (SEQ I D NO: ID NO: 119) (Chothia) 117) (extended)
  • GFTFSY AWMS (SEQ I D NO: ID NO: 128) (Chothia) 117) (extended)
  • GFTFSYAWMS SEQ I D NO: (SEQ ID NO: 131 117) (extended) (Chothia)
  • GDTFSS (SEQ ID NO: 138) (Kabat) NO: 142)
  • GDTFSSNAIS SEQ ID NO: 141) (Chothia)
  • GFTFSNYAMS SEQ ID NO: ID NO: 147) (Chothia) 145) (extended)
  • the invention encompasses modifications to the CARs and polypeptides of the invention variants shown in Table 1 , including functionally equivalent CARs having modifications which do not significantly affect their properties and variants which have enhanced or decreased activity and/or affinity.
  • the amino acid sequence may be mutated to obtain an antibody with the desired binding affinity to EGFRvlll.
  • Modification of polypeptides is routine practice in the art and need not be described in detail herein. Examples of modified polypeptides include polypeptides with conservative substitutions of amino acid residues, one or more deletions or additions of amino acids which do not significantly deleteriously change the functional activity, or which mature (enhance) the affinity of the polypeptide for its ligand, or use of chemical analogs.
  • Amino acid sequence insertions include amino- and/or carboxy I -terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues.
  • terminal insertions include an antibody with an N-terminal methionyl residue or the antibody fused to an epitope tag.
  • Other insertional variants of the antibody molecule include the fusion to the N- or C-terminus of the antibody of an enzyme or a polypeptide which increases the half-life of the antibody in the blood circulation.
  • substitution variants have at least one amino acid residue in the antibody molecule removed and a different residue inserted in its place.
  • the sites of greatest interest for substitutional mutagenesis include the hypervariable regions, but FR alterations are also contemplated.
  • Conservative substitutions are shown in Table 3 under the heading of "conservative substitutions.” If such substitutions result in a change in biological activity, then more substantial changes, denominated "exemplary substitutions" in Table 3, or as further described below in reference to amino acid classes, may be introduced and the products screened.
  • substitution variants of antibodies provided herein have no more than 15, 14, 13, 12, 1 1 , 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 conservative substitution in the VH or VL region as compared to the reference parent antibody. In some embodiments, the substitutions are not within a CDR of the VH or VL region.
  • the invention provides a CAR comprising an extracellular ligand-binding domain that binds to EGFRvlll and competes for binding to EGFRvlll with the antibodies described herein or the CARs described herein (e.g., Table 5A), including m62G7, h62G7, h62G7-H14/L1 -DV, h62G7-L6/EQ, 42G9, 32A10, 20B9, 14C1 1 , 21 E1 1 , 49B1 1 , 46E10, 12H6, 19A9, 21 E7, 1 1 B1 1 , 12B2, 1 1 F10, 17G1 1 , 29D5, 30D8, 20E12, 26B9, 32G8, 34E7, 20G5, C6, and B5.
  • the invention provides CARs comprising CDR portions of antibodies to EGFRvlll antibodies based on CDR contact regions.
  • CDR contact regions are regions of an antibody that imbue specificity to the antibody for an antigen.
  • CDR contact regions include the residue positions in the CDRs and Vernier zones which are constrained in order to maintain proper loop structure for the antibody to bind a specific antigen. See, e.g., Makabe et al., J. Biol. Chem., 283: 1 156-1 166, 2007. Determination of CDR contact regions is well within the skill of the art.
  • EGFRvlll (such as human EGFRvlll (e.g., (SEQ ID NO: 201 )) can be about 0.001 to about 5000 nM.
  • the binding affinity is about any of 5000 nM, 4500 nM, 4000 nM, 3500 nM, 3000 nM, 2500 nM, 2000 nM, 1789 nM, 1583 nM, 1540 nM, 1500 nM, 1490 nM, 1064 nM, 1000 nM, 933 nM, 894 nM, 750 nM, 705 nM, 678 nM, 532 nM, 500 nM, 494 nM, 400 nM, 349 nM, 340 nM, 353 nM, 300 nM, 250 nM, 244 nM, 231 nM, 225 nM, 207 nM, 200 nM, 186 nM,
  • the binding affinity is less than about any of 5000 nM, 4000 nM, 3000 nM, 2000 nM, 1000 nM, 900 nM, 800 nM, 250 nM, 200 nM, 100 nM, 50 nM, 30 nM, 20 nM, 10 nM, 7.5 nM, 7 nM, 6.5 nM, 6 nM, 5 nM, 4.5 nM, 4 nM, 3.5 nM, 3 nM, 2.5 nM, 2 nM, 1.5 nM, 1 nM, or 0.5 nM.
  • the intracellular signaling domain of a CAR is responsible for intracellular signaling following the binding of extracellular ligand-binding domain to the target resulting in the activation of the immune cell and immune response.
  • the intracellular signaling domain has the ability to activate of at least one of the normal effector functions of the immune cell in which the CAR is expressed.
  • the effector function of a T cell can be a cytolytic activity or helper activity including the secretion of cytokines.
  • an intracellular signaling domain for use in a CAR can be the cytoplasmic sequences of, for example without limitation, the T cell receptor and co- receptors that act in concert to initiate signal transduction following antigen receptor engagement, as well as any derivative or variant of these sequences and any synthetic sequence that has the same functional capability.
  • Intracellular signaling domains comprise two distinct classes of cytoplasmic signaling sequences: those that initiate antigen-dependent primary activation, and those that act in an antigen-independent manner to provide a secondary or co-stimulatory signal.
  • Primary cytoplasmic signaling sequences can comprise signaling motifs which are known as immunoreceptor tyrosine-based activation motifs of ITAMs.
  • ITAMs are well defined signaling motifs found in the intracytoplasmic tail of a variety of receptors that serve as binding sites for syk/zap70 class tyrosine kinases.
  • ITAM used in the invention can include as non limiting examples those derived from ⁇ , FcRy, FcR ⁇ , FcR , CD3y, CD35, CD3s, CD5, CD22, CD79a, CD79b and CD66d.
  • the intracellular signaling domain of the CAR can comprise the CD3 ⁇ (zeta) signaling domain which has amino acid sequence with at least about 70%, preferably at least 80%, more preferably at least 90%, 95%, 97%, or 99% sequence identity with an amino acid sequence shown in SEQ. ID NO: 205.
  • the intracellular signaling domain of the CAR of the invention comprises a domain of a co-stimulatory molecule.
  • the intracellular signaling domain of a CAR of the invention comprises a part of co-stimulatory molecule selected from the group consisting of a fragment of 41 BB (GenBank: AAA53133.) and CD28 (NP_006130.1 ).
  • the intracellular signaling domain of the CAR of the invention comprises amino acid sequence which comprises at least 70%, preferably at least 80%, more preferably at least 90%, 95%, 97%, or 99% sequence identity with an amino acid sequence shown in SEQ. ID NO: 213 (CD28 signaling domain) or SEQ. ID NO: 204 (4- 1 BB signaling domain).
  • the CAR can comprise a transmembrane domain.
  • Suitable transmembrane domains for a CAR disclosed herein have the ability to (a) be expressed at the surface of a cell, preferably an immune cell such as, for example without limitation, lymphocyte cells or Natural killer (NK) cells, and (b) interact with the ligand-binding domain and intracellular signaling domain for directing cellular response of immune cell against a predefined target cell.
  • the transmembrane domain can be derived either from a natural or from a synthetic source.
  • the transmembrane domain can be derived from any membrane-bound or transmembrane protein.
  • the transmembrane polypeptide can be a subunit of the T cell receptor such as ⁇ , ⁇ , ⁇ or ⁇ , polypeptide constituting CD3 complex, IL-2 receptor p55 (a chain), p75 ( ⁇ chain) or ⁇ chain, subunit chain of Fc receptors, in particular Fey receptor III or CD proteins.
  • the transmembrane domain can be synthetic and can comprise predominantly hydrophobic residues such as leucine and valine.
  • said transmembrane domain is derived from the human CD8a chain (e.g., NP_001 139345.1 ).
  • the CAR can further comprise a stalk domain between the extracellular ligand-binding domain and said transmembrane domain.
  • a stalk domain may comprise up to 300 amino acids, preferably 10 to 100 amino acids and most preferably 25 to 50 amino acids.
  • Stalk region may be derived from all or part of naturally occurring molecules, such as from all or part of the extracellular region of CD8, CD4, or CD28, or from all or part of an antibody constant region.
  • the stalk domain may be a synthetic sequence that corresponds to a naturally occurring stalk sequence, or may be an entirely synthetic stalk sequence.
  • said stalk domain is a part of human CD8a chain (e.g., NP_001 139345.1 ).
  • transmembrane and hinge domains comprise a part of human CD8a chain, preferably which comprise at least 70%, preferably at least 80%, more preferably at least 90%, 95%, 97%, or 99% sequence identity with the amino acid sequence shown in SEQ ID NO: 210 and SEQ ID NO: 208, respectively.
  • CARs disclosed herein can comprise an extracellular ligand-binding domain that specifically binds EGFRvlll, CD8a human hinge and transmembrane domains, the ⁇ 3 ⁇ signaling domain, and the 4-1 BB signaling domain.
  • Table 4 provides exemplary sequences of domains which can be used in the
  • FcsRI a-TM-IC FFIPLLVVILFAVDTGLFISTQQQVTFLLKI KRTRKGFRLLNPH PKPNPKN 211 (FcsRI a chain N
  • FceRi -AITAM MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHT 212 (FcsRI ⁇ chain WLTVLKKEQEFLGVTQI LTAMICLCFGTVVCSVLDISH IEGDIFSSFKAG without ITAM) YPFWGAIFFSISGMLSIISERRNATYLVRGSLGANTASSIAGGTGITILIIN
  • 41BB-IC 41BB co- KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL 204 signaling domain
  • CD28-IC CD28 co- RSKRSRGGHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS 213 signaling domain
  • FcsRIy-SP signal MIPAVVLLLLLLVEQAAA 214 peptide
  • GSG-P2A GSGATNFSLLKQAGDVEENPGP 216 ribosomal skip
  • GSG-T2A GSGEGRGSLLTCGDVEENPGP 217 ribosomal skip
  • Table 5A provides amino acid sequences of exemplary EGFRvlll specific CARs of the present invention.
  • the signal/leader peptide sequence is in bold, and GS linker [(GGGGS) 4 (SEQ ID NO: 202)] is underlined.
  • Table 5A Amino acid sequences of exemplary EGFRvlll specific CARs
  • CD3zeta signa ling CAR CAR Amino Acid Sequence Components (in order, N-terminus to C-terminus) domain
  • Table 5B provides nucleic acid sequences of exemplary scFvs of EGFRvlll specific CARs of the present invention.
  • the sequence encoding the CD8 signal/leader peptide is underlined.
  • Table 5C provides exemplary nucleic acid sequences of exemplary EGFRvlll specific CARs of the present invention.
  • CTGCTGCTGCACGCAGCAAGGCCAGAGGTGAACCTGGTG GAGTCCGGCGGCGGCCTGGTGAAGCCTGGCGGATCCCTG 32G8 VH (Ta ble 1, SEQ AGGCTGTCTTGCGAGGCAAGCGGCTTCACCTTCAGCTAC ID NO: 43);
  • the EGFRvlll specific CAR can comprise one or more additional extracellular ligand-binding domains, to simultaneously bind different elements in target thereby augmenting immune cell activation and function.
  • the extracellular ligand-binding domains can be placed in tandem on the same transmembrane polypeptide, and optionally can be separated by a linker.
  • said different extracellular ligand- binding domains can be placed on different transmembrane polypeptides composing the CAR.
  • the invention relates to a population of CARs, each CAR comprising a different extracellular ligand-binding domain.
  • the invention relates to a method of engineering immune cells comprising providing an immune cell and expressing at the surface of the cell a population of CARs, each CAR comprising different extracellular ligand-binding domains.
  • the invention relates to a method of engineering an immune cell comprising providing an immune cell and introducing into the cell polynucleotides encoding polypeptides composing a population of CARs each one comprising different extracellular ligand-binding domains.
  • population of CARs it is meant at least two, three, four, five, six or more CARs each one comprising different extracellular ligand-binding domains.
  • the different extracellular ligand-binding domains according to the invention can preferably simultaneously bind different elements in target thereby augmenting immune cell activation and function.
  • the invention also relates to an isolated immune cell which comprises a population of CARs each one comprising different extracellular ligand-binding domains.
  • the invention provides polynucleotides encoding any of the
  • the invention provides compositions (such as a pharmaceutical compositions) comprising any of the cells of the invention.
  • the composition comprises a cell comprising a polynucleotide encoding any of the CARs described herein.
  • the invention provides a method of making any of the polynucleotides described herein.
  • Polynucleotides complementary to any such sequences are also encompassed by the invention.
  • Polynucleotides may be single-stranded (coding or antisense) or double-stranded, and may be DNA (genomic, cDNA or synthetic) or RNA molecules.
  • RNA molecules include HnRNA molecules, which contain introns and correspond to a DNA molecule in a one-to-one manner, and mRNA molecules, which do not contain introns. Additional coding or non-coding sequences may, but need not, be present within a polynucleotide of the invention, and a polynucleotide may, but need not, be linked to other molecules and/or support materials.
  • Polynucleotides may comprise a native sequence (i.e., an endogenous sequence that encodes an antibody or a portion thereof) or may comprise a variant of such a sequence.
  • Polynucleotide variants contain one or more substitutions, additions, deletions and/or insertions such that the immunoreactivity of the encoded polypeptide is not diminished, relative to a native immunoreactive molecule. The effect on the immunoreactivity of the encoded polypeptide may generally be assessed as described herein.
  • Variants preferably exhibit at least about 70% identity, more preferably, at least about 80% identity, yet more preferably, at least about 90% identity, and most preferably, at least about 95% identity to a polynucleotide sequence that encodes a native antibody or a portion thereof.
  • Two polynucleotide or polypeptide sequences are said to be “identical” if the sequence of nucleotides or amino acids in the two sequences is the same when aligned for maximum correspondence as described below. Comparisons between two sequences are typically performed by comparing the sequences over a comparison window to identify and compare local regions of sequence similarity.
  • a “comparison window” as used herein refers to a segment of at least about 20 contiguous positions, usually 30 to about 75, or 40 to about 50, in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned.
  • the "percentage of sequence identity” is determined by comparing two optimally aligned sequences over a window of comparison of at least 20 positions, wherein the portion of the polynucleotide or polypeptide sequence in the comparison window may comprise additions or deletions (i.e., gaps) of 20 percent or less, usually 5 to 15 percent, or 10 to 12 percent, as compared to the reference sequences (which does not comprise additions or deletions) for optimal alignment of the two sequences.
  • the percentage is calculated by determining the number of positions at which the identical nucleic acid bases or amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the reference sequence (i.e. the window size) and multiplying the results by 100 to yield the percentage of sequence identity.
  • Variants may also, or alternatively, be substantially homologous to a native gene, or a portion or complement thereof.
  • Such polynucleotide variants are capable of hybridizing under moderately stringent conditions to a naturally occurring DNA sequence encoding a native antibody (or a complementary sequence).
  • Suitable “moderately stringent conditions” include prewashing in a solution of 5 X SSC, 0.5% SDS, 1.0 mM EDTA (pH 8.0); hybridizing at 50°C-65°C, 5 X SSC, overnight; followed by washing twice at 65°C for 20 minutes with each of 2X, 0.5X and 0.2X SSC containing 0.1 % SDS.
  • highly stringent conditions or “high stringency conditions” are those that: (1 ) employ low ionic strength and high temperature for washing, for example 0.015 M sodium chloride/0.0015 M sodium citrate/0.1 % sodium dodecyl sulfate at 50°C; (2) employ during hybridization a denaturing agent, such as formamide, for example, 50% (v/v) formamide with 0.1 % bovine serum albumin/0.1 % Ficoll/0.1 % polyvinylpyrrolidone/50 mM sodium phosphate buffer at pH 6.5 with 750 mM sodium chloride, 75 mM sodium citrate at 42°C; or (3) employ 50% formamide, 5 x SSC (0.75 M NaCI, 0.075 M sodium citrate), 50 mM sodium phosphate (pH 6.8), 0.1 % sodium pyrophosphate, 5 x Denhardt's solution, sonicated salmon sperm DNA (50 pg/ml), 0.1 % SDS,
  • formamide for example
  • Alleles are endogenous genes that are altered as a result of one or more mutations, such as deletions, additions and/or substitutions of nucleotides.
  • the resulting mRNA and protein may, but need not, have an altered structure or function. Alleles may be identified using standard techniques (such as hybridization, amplification and/or database sequence comparison).
  • polynucleotides of this invention can be obtained using chemical synthesis, recombinant methods, or PCR. Methods of chemical polynucleotide synthesis are well known in the art and need not be described in detail herein. One of skill in the art can use the sequences provided herein and a commercial DNA synthesizer to produce a desired DNA sequence.
  • a polynucleotide comprising a desired sequence can be inserted into a suitable vector, and the vector in turn can be introduced into a suitable host cell for replication and amplification, as further discussed herein.
  • Polynucleotides may be inserted into host cells by any means known in the art. Cells are transformed by introducing an exogenous polynucleotide by direct uptake, endocytosis, transfection, F-mating or electroporation. Once introduced, the exogenous polynucleotide can be maintained within the cell as a non-integrated vector (such as a plasmid) or integrated into the host cell genome. The polynucleotide so amplified can be isolated from the host cell by methods well known within the art.
  • PCR allows reproduction of DNA sequences.
  • PCR technology is well known in the art and is described in U.S. Patent Nos. 4,683, 195, 4,800, 159, 4,754,065 and 4,683,202, as well as PCR: The Polymerase Chain Reaction, Mullis et al. eds., Birkauswer Press, Boston, 1994.
  • RNA can be obtained by using the isolated DNA in an appropriate vector and inserting it into a suitable host cell. When the cell replicates and the DNA is transcribed into RNA, the RNA can then be isolated using methods well known to those of skill in the art, as set forth in Sambrook et al., 1989, supra, for example.
  • Suitable cloning vectors may be constructed according to standard techniques, or may be selected from a large number of cloning vectors available in the art. While the cloning vector selected may vary according to the host cell intended to be used, useful cloning vectors will generally have the ability to self-replicate, may possess a single target for a particular restriction endonuclease, and/or may carry genes for a marker that can be used in selecting clones containing the vector.
  • Suitable examples include plasmids and bacterial viruses, e.g., pUC18, pUC19, Bluescript (e.g., pBS SK+) and its derivatives, mp18, mp19, pBR322, pMB9, ColE1 , pCR1 , RP4, phage DNAs, and shuttle vectors such as pSA3 and pAT28.
  • Bluescript e.g., pBS SK+
  • shuttle vectors such as pSA3 and pAT28.
  • Expression vectors generally are replicable polynucleotide constructs that contain a polynucleotide according to the invention. It is implied that an expression vector must be replicable in the host cells either as episomes or as an integral part of the chromosomal DNA. Suitable expression vectors include but are not limited to plasmids, viral vectors, including adenoviruses, adeno-associated viruses, retroviruses, cosmids, and expression vector(s) disclosed in PCT Publication No. WO 87/04462.
  • Vector components may generally include, but are not limited to, one or more of the following: a signal sequence; an origin of replication; one or more marker genes; suitable transcriptional controlling elements (such as promoters, enhancers and terminator). For expression (i.e., translation), one or more translational controlling elements are also usually required, such as ribosome binding sites, translation initiation sites, and stop codons.
  • the vectors containing the polynucleotides of interest can be introduced into the host cell by any of a number of appropriate means, including electroporation, transfection employing calcium chloride, rubidium chloride, calcium phosphate, DEAE- dextran, or other substances; microprojectile bombardment; lipofection; and infection (e.g., where the vector is an infectious agent such as vaccinia virus).
  • electroporation employing calcium chloride, rubidium chloride, calcium phosphate, DEAE- dextran, or other substances
  • microprojectile bombardment e.g., where the vector is an infectious agent such as vaccinia virus.
  • infection e.g., where the vector is an infectious agent such as vaccinia virus.
  • the choice of introducing vectors or polynucleotides will often depend on features of the host cell.
  • a polynucleotide encoding an EGFRvlll specific CAR disclosed herein may exist in an expression cassette or expression vector (e.g., a plasmid for introduction into a bacterial host cell, or a viral vector such as a baculovirus vector for transfection of an insect host cell, or a plasmid or viral vector such as a lentivirus for transfection of a mammalian host cell).
  • a polynucleotide or vector can include a nucleic acid sequence encoding ribosomal skip sequences such as, for example without limitation, a sequence encoding a 2A peptide.
  • 2A peptides which were identified in the Aphthovirus subgroup of picornaviruses, causes a ribosomal "skip” from one codon to the next without the formation of a peptide bond between the two amino acids encoded by the codons (see (Donnelly and Elliott 2001 ; Atkins, Wills et al. 2007; Doronina, Wu et al. 2008)).
  • codon is meant three nucleotides on an mRNA (or on the sense strand of a DNA molecule) that are translated by a ribosome into one amino acid residue.
  • two polypeptides can be synthesized from a single, contiguous open reading frame within an imRNA when the polypeptides are separated by a 2A oligopeptide sequence that is in frame.
  • Such ribosomal skip mechanisms are well known in the art and are known to be used by several vectors for the expression of several proteins encoded by a single messenger RNA.
  • a secretory signal sequence (also known as a signal peptide, leader sequence, prepro sequence or pre sequence) is provided in a polynucleotide sequence or vector sequence.
  • the secretory signal sequence is operably linked to the transmembrane nucleic acid sequence, i.e., the two sequences are joined in the correct reading frame and positioned to direct the newly synthesized polypeptide into the secretory pathway of the host cell.
  • Secretory signal sequences are commonly positioned 5' to the nucleic acid sequence encoding the polypeptide of interest, although certain secretory signal sequences may be positioned elsewhere in the nucleic acid sequence of interest (see, e.g., Welch et al., U.S. Patent No. 5,037,743; Holland et al., U.S. Patent No. 5,143,830).
  • the signal peptide comprises the amino acid sequence shown in SEQ ID NO: 206 or 214.
  • nucleic acid sequences of the invention are codon-optimized for expression in mammalian cells, preferably for expression in human cells.
  • Codon-optimization refers to the exchange in a sequence of interest of codons that are generally rare in highly expressed genes of a given species by codons that are generally frequent in highly expressed genes of such species, such codons encoding identical amino acids as the codons that are being exchanged.
  • the methods comprise introducing a CAR according to the invention into immune cells, and expanding the cells.
  • the invention relates to a method of engineering an immune cell comprising: providing a cell and expressing at the surface of the cell at least one CAR as described above.
  • Methods for engineering immune cells are described in, for example, PCT Patent Application Publication Nos. WO/2014/039523, WO/2014/184741 , WO/2014/191 128, WO/2014/184744, and WO/2014/184143, each of which is incorporated herein by reference in its entirety.
  • the method comprises: transforming the cell with at least one polynucleotide encoding CAR as described above, and expressing the polynucleotides in the cell.
  • the polynucleotides are present in lentiviral vectors for stable expression in the cells.
  • the method can further comprise a step of genetically modifying a cell by inactivating at least one gene expressing, for example without limitation, a component of the TCR, a target for an immunosuppressive agent, an HLA gene, and/or an immune checkpoint protein such as, for example, PDCD1 or CTLA-4.
  • a gene it is intended that the gene of interest is not expressed in a functional protein form.
  • the gene to be inactivated is selected from the group consisting of, for example without limitation, TCRa, TCR , dCK, CD52, GR, PD-1 , and CTLA-4.
  • the method comprises inactivating one or more genes by introducing into the cells a rare-cutting endonuclease able to selectively inactivate a gene by selective DNA cleavage.
  • the rare-cutting endonuclease can be, for example, a transcription activator-like effector nuclease (TALE-nuclease) or Cas9 endonuclease.
  • an additional catalytic domain is used with a rare-cutting endonuclease to enhance its capacity to inactivate targeted genes.
  • an additional catalytic domain can be a DNA end-processing enzyme.
  • DNA end-processing enzymes include 5-3' exonucleases, 3-5' exonucleases, 5-3' alkaline exonucleases, 5' flap endonucleases, helicases, hosphatase, hydrolases and template-independent DNA polymerases.
  • Non-limiting examples of such catalytic domain comprise of a protein domain or catalytically active derivate of the protein domain selected from the group consisting of hExol (EX01_HUMAN), Yeast Exol (EX01_YEAST), E. coli Exol, Human TREX2, Mouse TREX1 , Human TREX1 , Bovine TREX1 , Rat TREX1 , TdT (terminal deoxynucleotidyl transferase) Human DNA2, Yeast DNA2 (DNA2_YEAST).
  • an additional catalytic domain can have a 3'-5'-exonuclease activity, and in some embodiments, said additional catalytic domain is TREX, more preferably TREX2 catalytic domain (WO2012/058458). In some embodiments, said catalytic domain is encoded by a single chain TREX polypeptide. The additional catalytic domain may be fused to a nuclease fusion protein or chimeric protein. In some embodiments, the additional catalytic domain is fused using, for example, a peptide linker.
  • the method further comprises a step of introducing into cells an exogeneous nucleic acid comprising at least a sequence homologous to a portion of the target nucleic acid sequence, such that homologous recombination occurs between the target nucleic acid sequence and the exogeneous nucleic acid.
  • said exogenous nucleic acid comprises first and second portions which are homologous to region 5' and 3' of the target nucleic acid sequence, respectively.
  • the exogenous nucleic acid may also comprise a third portion positioned between the first and the second portion which comprises no homology with the regions 5' and 3' of the target nucleic acid sequence.
  • homologous sequences of at least about 50 bp, greater than about 100 bp, or greater than about 200 bp can be used within the donor matrix.
  • the exogenous nucleic acid can be, for example without limitation, from about 200 bp to about 6000 bp, more preferably from about 1000 bp to about 2000 bp. Shared nucleic acid homologies are located in regions flanking upstream and downstream the site of the break, and the nucleic acid sequence to be introduced is located between the two arms.
  • a nucleic acid successively comprises a first region of homology to sequences upstream of said cleavage; a sequence to inactivate a targeted gene selected from the group consisting of TCRa, TCR ⁇ , CD52, glucocorticoid receptor (GR), deoxycytidine kinase (dCK), and an immune checkpoint protein such as for example programmed death-1 (PD-1 ); and a second region of homology to sequences downstream of the cleavage.
  • the polynucleotide introduction step can be simultaneous, before or after the introduction or expression of the rare-cutting endonuclease.
  • exogenous nucleic acid can be used to knock-out a gene, e.g. when exogenous nucleic acid is located within the open reading frame of the gene, or to introduce new sequences or genes of interest. Sequence insertions by using such exogenous nucleic acid can be used to modify a targeted existing gene, by correction or replacement of the gene (allele swap as a non-limiting example), or to up- or down- regulate the expression of the targeted gene (promoter swap as non-limiting example), the targeted gene correction or replacement.
  • inactivation of a genes selected from the group consisting of TCRa, ⁇ , CD52, GR, dCK, and immune checkpoint proteins can be done at a precise genomic location targeted by a specific TALE-nuclease, wherein said specific TALE-nuclease catalyzes a cleavage and wherein the exogenous nucleic acid successively comprising at least a region of homology and a sequence to inactivate one targeted gene selected from the group consisting of TCRa, TCR , CD52, GR, dCK, immune checkpoint proteins which is integrated by homologous recombination.
  • several genes can be, successively or at the same time, inactivated by using several TALE-nucleases respectively and specifically targeting one defined gene and several specific polynucleotides for specific gene inactivation.
  • the method comprises inactivation of one or more additional genes selected from the group consisting of TCRa, TCR , CD52, GR, dCK, and immune checkpoint proteins.
  • inactivation of a gene can be accomplished by introducing into the cells at least one rare-cutting endonuclease such that the rare-cutting endonuclease specifically catalyzes cleavage in a targeted sequence of the cell genome; and optionally, introducing into the cells an exogenous nucleic acid successively comprising a first region of homology to sequences upstream of the cleavage, a sequence to be inserted in the genome of the cell, and a second region of homology to sequences downstream of the cleavage; wherein the introduced exogenous nucleic acid inactivates a gene and integrates at least one exogenous polynucleotide sequence encoding at least one recombinant protein of interest.
  • the exogenous polynucleotide can be accomplished by introducing into the cells at
  • a step of genetically modifying cells can comprise: modifying T cells by inactivating at least one gene expressing a target for an immunosuppressive agent, and; expanding the cells, optionally in presence of the immunosuppressive agent.
  • An immunosuppressive agent is an agent that suppresses immune function by one of several mechanisms of action. An immunosuppressive agent can diminish the extent and/or voracity of an immune response.
  • Non-limiting examples of immunosuppressive agents include calcineurin inhibitors, targets of rapamycin, interleukin-2 a-chain blockers, inhibitors of inosine monophosphate dehydrogenase, inhibitors of dihydrofolic acid reductase, corticosteroids, and immunosuppressive antimetabolites.
  • targets for immunosuppressive agent can be a receptor for an immunosuppressive agent such as for example without limitation CD52, glucocorticoid receptor (GR), FKBP family gene members, and cyclophilin family gene members.
  • the genetic modification of the method involves expression, in provided cells to engineer, of one rare-cutting endonuclease such that the rare-cutting endonuclease specifically catalyzes cleavage in one targeted gene thereby inactivating the targeted gene.
  • a method of engineering cells comprises at least one of the following steps: providing a T cell, such as from a cell culture or from a blood sample; selecting a gene in the T cell expressing a target for an immunosuppressive agent; introducing into the T cell a rare-cutting endonuclease able to selectively inactivate by DNA cleavage, preferably by double-strand break the gene encoding a target for the immunosuppressive agent, and expanding the cells, optionally in presence of the immunosuppressive agent.
  • the method comprises: providing a T cell, such as from a cell culture or from a blood sample; selecting a gene in the T cell wherein the gene expresses a target for an immunosuppressive agent; transforming the T cell with nucleic acid encoding a rare-cutting endonuclease able to selectively inactivate by DNA cleavage, preferably by double-strand break the gene encoding a target for the immunosuppressive agent, and expressing the rare-cutting endonucleases into the T cells; and expanding the cells, optionally in presence of the immunosuppressive agent.
  • the rare-cutting endonuclease specifically targets CD52 or GR.
  • the gene selected for inactivation encodes CD52, and the immunosuppressive treatment comprises a humanized antibody targeting CD52 antigen.
  • the gene selected for inactivation encodes GR, and the immunosuppressive treatment comprises a corticosteroid such as dexamethasone.
  • the gene selected for inactivation is a FKBP family gene member or a variant thereof and the immunosuppressive treatment comprises FK506, also known as Tacrolimus or fujimycin.
  • the FKBP family gene member is FKBP12 or a variant thereof.
  • gene selected for inactivation is a cyclophilin family gene member or a variant thereof and the immunosuppressive treatment comprises cyclosporine.
  • the rare-cutting endonuclease can be, for example, a meganuclease, a zinc finger nuclease, or a TALE-nuclease. In some embodiments, the rare-cutting endonuclease is a TALE-nuclease.
  • methods of engineering T cells suitable for immunotherapy, wherein the methods comprise: genetically modifying T cells by inactivating at least one immune checkpoint protein.
  • the immune checkpoint protein is, for example, PD-1 and/or CTLA-4.
  • methods of genetically modifying a cell comprises: modifying T cells by inactivating at least one immune checkpoint protein; and expanding the cells.
  • Immune checkpoint proteins include, but are not limited to Programmed Death 1 (PD-1 , also known as PDCD1 or CD279, accession number: NIVL005018), Cytotoxic T-Lymphocyte Antigen 4 (CTLA-4, also known as CD152, GenBank accession number AF414120.1 ), LAG3 (also known as CD223, accession number: NIVL002286.5), Tim3 (also known as HAVCR2, GenBank accession number: JX049979.1 ), BTLA (also known as CD272, accession number: NM_181780.3), BY55 (also known as CD160, GenBank accession number: CR541888.1 ), TIGIT (also known as VSTM3, accession number: NM_173799), B7H5 (also known as C10orf54, homolog of mouse vista gene, accession number: NM_ 022153.1 ), LAIR1 (also known as CD305, GenBank accession number: CR542051.1 ), SIGLEC
  • said method to engineer cells comprises at least one of the following steps: providing a T cell, such as from a cell culture or from a blood sample; introducing into the T cell a rare-cutting endonuclease able to selectively inactivate by DNA cleavage, preferably by double-strand break one gene encoding an immune checkpoint protein; and expanding the cells.
  • the method comprises: providing a T cell, such as from a cell culture or from a blood sample; transfecting said T cell with nucleic acid encoding a rare-cutting endonuclease able to selectively inactivate by DNA cleavage, preferably by double-strand break a gene encoding an immune checkpoint protein; expressing the rare-cutting endonucleases into the T cells; expanding the cells.
  • the rare- cutting endonuclease specifically targets a gene selected from the group consisting of: PD-1 , CTLA-4, LAG3, Tim3, BTLA, BY55, TIGIT, B7H5, LAIR1 , SIGLEC10, 2B4, TCRa, and TCR .
  • the rare-cutting endonuclease can be a meganuclease, a zinc finger nuclease or a TALE-nuclease.
  • the rare-cutting endonuclease is a TALE-nuclease.
  • the present invention can be particularly suitable for allogeneic immunotherapy.
  • cells may be modified by a method comprising: inactivating at least one gene encoding a component of the T cell receptor (TCR) in T cells; and expanding the T cells.
  • TCR T cell receptor
  • the genetic modification of the method relies on the expression, in provided cells to engineer, of one rare-cutting endonuclease such that the rare-cutting endonuclease specifically catalyzes cleavage in one targeted gene thereby inactivating the targeted gene.
  • said method to engineer cells comprises at least one of the following steps: providing a T cell, such as from a cell culture or from a blood sample; introducing into the T cell a rare-cutting endonuclease able to selectively inactivate by DNA cleavage, preferably by double-strand break at least one gene encoding a component of the T cell receptor (TCR), and expanding the cells.
  • a T cell such as from a cell culture or from a blood sample
  • introducing into the T cell a rare-cutting endonuclease able to selectively inactivate by DNA cleavage, preferably by double-strand break at least one gene encoding a component of the T cell receptor (TCR), and expanding the cells.
  • the method comprises: providing a T cell, such as from a cell culture or from a blood sample; transfecting said T cell with nucleic acid encoding a rare-cutting endonuclease able to selectively inactivate by DNA cleavage, preferably by double-strand break at least one gene encoding a component of the T cell receptor (TCR); expressing the rare-cutting endonucleases into the T cells; sorting the transfected T cells, which do not express TCR on their cell surface; and expanding the cells.
  • a T cell such as from a cell culture or from a blood sample
  • TCR T cell receptor
  • the rare-cutting endonuclease can be a meganuclease, a zinc finger nuclease or a TALE-nuclease. In some embodiments, the rare-cutting endonuclease is a TALE-nuclease. In some embodiments the TALE-nucleases recognize and cleave a sequence encoding TCRa or TCR . In some embodiments a TALE-nuclease comprises a polypeptide sequence selected from the amino acid sequence shown in SEQ ID NO: 218, 219, 220, 221 , 222, 223, 224, or 225. TALE-nuclease polypeptide sequences:
  • another step of genetically modifying a cell can be a method of expanding TCRa deficient T cells comprising introducing into the T cell pTa (also known as preTCRa) or a functional variant thereof and expanding the cells, optionally through stimulation of the CD3 complex.
  • the method comprises: a) transforming the cells with a nucleic acid encoding at least a fragment of pTa to support CD3 surface expression; b) expressing said pTa into the cells; and c) expanding the cells, optionally through stimulation of the CD3 complex.
  • the pTa polynucleotide sequence can be introduced randomly or by homologous recombination.
  • the insertion can be associated with the inactivation of the TCRa gene.
  • a “functional variant” of the peptide refers to a molecule substantially similar to either the entire peptide or a fragment thereof.
  • a “fragment” of the pTa or functional variant thereof refers to any subset of the molecule, that is, a shorter peptide than the full-length pTa.
  • pTa or functional variants can be, for example, full-length pTa or a C- terminal truncated pTa version. C-terminal truncated pTa lacks in C-terminal end one or more residues.
  • C-terminal truncated pTa version lacks 18, 48, 62, 78, 92, 1 10 or 1 14 residues from the C-terminus of the protein.
  • Amino acid sequence variants of the peptide can be prepared by mutations in the DNA which encodes the peptide. Such functional variants include, for example, deletions from, or insertions or substitutions of, residues within the amino acid sequence. Any combination of deletion, insertion, and substitution may also be made to arrive at the final construct, provided that the final construct possesses the desired activity, in particular the restoration of a functional CD3 complex.
  • at least one mutation is introduced in the different pTa versions as described above to affect dimerization.
  • a mutated residue can be at least W46R, D22A, K24A, R102A or R1 17A of the human pTa protein or aligned positions using CLUSTALW method on pTa family or homologue member.
  • pTa or a variant thereof as described above comprise the mutated residue W46R or the mutated residues D22A, K24A, R102A and R1 17A.
  • said pTa or variants are also fused to a signal-transducing domain such as CD28, OX40, ICOS, CD27, CD137 (4-1 BB) and CD8 as non limiting examples.
  • the extracellular domain of pTa or variants as described above can be fused to a fragment of the TCRa protein, particularly the transmembrane and intracellular domain of TCRa.
  • pTa variants can also be fused to the intracellular domain of TCRa.
  • pTa versions can be fused to an extracellular ligand- binding domain.
  • pTa or a functional variant thereof is fused to a single chain antibody fragment (scFv) comprising the light and the heavy variable fragment of a target antigen specific monoclonal antibody joined by a flexible linker.
  • scFv single chain antibody fragment
  • TCRa deficient T cell refers to an isolated T cell that lacks expression of a functional TCRa chain. This may be accomplished by different means, as non limiting examples, by engineering a T cell such that it does not express any functional TCRa on its cell surface or by engineering a T cell such that it produces very little functional TCRa chain on its surface or by engineering a T cell to express mutated or truncated form of TCRa chain. TCRa deficient cells can no longer be expanded through CD3 complex. Thus, to overcome this problem and to allow proliferation of TCRa deficient cells, pTa or functional variant thereof is introduced into the cells, thus restoring a functional CD3 complex.
  • the method further comprises introducing into said T cells rare-cutting endonucleases able to selectively inactivate by DNA cleavage one gene encoding one component of the T cell receptor (TCR).
  • the rare-cutting endonuclease is a TALE-nuclease.
  • engineered T cells obtained by the methods described herein can be contacted with bispecific antibodies.
  • the T cells can be contacted with bispecific antibodies ex vivo prior to administration to a patient, or in vivo following administration to a patient.
  • Bispecific antibodies comprise two variable regions with distinct antigen properties that facilitate bringing the engineered cells into proximity to a target antigen.
  • a bispecific antibody can be directed against a tumor marker and lymphocyte antigen, such as for example without limitation CD3, and has the potential to redirect and activate any circulating T cells against tumors.
  • polynucleotides encoding polypeptides according to the present invention can be mRNA which is introduced directly into the cells, for example by electroporation.
  • cytoPulse technology can be used to transiently permeabilize living cells for delivery of material into the cells. Parameters can be modified in order to determine conditions for high transfection efficiency with minimal mortality.
  • the method comprises: contacting a T cell with RNA and applying to the T cell an agile pulse sequence consisting of: (a) an electrical pulse with a voltage range from about 2250 to 3000 V per centimeter; (b) a pulse width of 0.1 ms; (c) a pulse interval of about 0.2 to 10 ms between the electrical pulses of step (a) and (b); (d) an electrical pulse with a voltage range from about 2250 to 3000 V with a pulse width of about 100 ms and a pulse interval of about 100 ms between the electrical pulse of step (b) and the first electrical pulse of step (c); and (e) four electrical pulses with a voltage of about 325 V with a pulse width of about 0.2 ms and a pulse interval of 2 ms between each of 4 electrical pulses.
  • an agile pulse sequence consisting of: (a) an electrical pulse with a voltage range from about 2250 to 3000 V per centimeter; (b) a pulse width of 0.1 ms; (c)
  • a method of transforming T cell comprising contacting said T cell with RNA and applying to T cell an agile pulse sequence comprising: (a) an electrical pulse with a voltage of about 2250, 2300, 2350, 2400, 2450, 2500, 2550, 2400, 2450, 2500, 2600, 2700, 2800, 2900 or 3000V per centimeter; (b) a pulse width of 0.1 ms; (c) and a pulse interval of about 0.2, 0.5, 1 , 2, 3, 4, 5, 6, 7, 8, 9 or 10 ms between the electrical pulses of step (a) and (b); (d) one electrical pulse with a voltage range from about 2250, of 2250, 2300, 2350, 2400, 2450, 2500, 2550, 2400, 2450, 2500, 2600, 2700, 2800, 2900 or 3000V with a pulse width of 100 ms and a pulse interval of 100 ms between the electrical pulse of step (b) and the first electrical pulse of step
  • Electroporation medium can be any suitable medium known in the art.
  • the electroporation medium has conductivity in a range spanning about 0.01 to about 1.0 milliSiemens.
  • an RNA encodes a rare-cutting endonuclease, one monomer of a rare-cutting endonuclease such as half-TALE- nuclease, a CAR, at least one component of a multi-chain chimeric antigen receptor, a pTa or functional variant thereof, an exogenous nucleic acid, and/or one additional catalytic domain.
  • Engineered immune cells one monomer of a rare-cutting endonuclease such as half-TALE- nuclease, a CAR, at least one component of a multi-chain chimeric antigen receptor, a pTa or functional variant thereof, an exogenous nucleic acid, and/or one additional catalytic domain.
  • the invention also provides engineered immune cells comprising any of the CAR polynucleotides described herein.
  • a CAR can be introduced into an immune cell as a transgene via a plasmid vector.
  • the plasmid vector can also contain, for example, a selection marker which provides for identification and/or selection of cells which received the vector.
  • CAR polypeptides may be synthesized in situ in the cell after introduction of polynucleotides encoding the CAR polypeptides into the cell. Alternatively, CAR polypeptides may be produced outside of cells, and then introduced into cells. Methods for introducing a polynucleotide construct into cells are known in the art. In some embodiments, stable transfection methods can be used to integrate the polynucleotide construct into the genome of the cell. In other embodiments, transient transfection methods can be used to transiently express the polynucleotide construct, and the polynucleotide construct is not integrated into the genome of the cell. In other embodiments, virus-mediated methods can be used.
  • the polynucleotides may be introduced into a cell by any suitable means such as for example, recombinant viral vectors (e.g. retroviruses, adenoviruses), liposomes, and the like.
  • Transient transfection methods include, for example without limitation, microinjection, electroporation or particle bombardment.
  • Polynucleotides may be included in vectors, such as for example plasmid vectors or viral vectors.
  • an isolated cell comprises at least one CAR as described above. In some embodiments, an isolated cell comprises a population of CARs, each CAR comprising different extracellular ligand-binding domains.
  • an immune cell obtained according to any one of the methods described above. Any immune cell capable of expressing heterologous DNAs can be used for the purpose of expressing the CAR of interest.
  • the immune cell is a T cell.
  • an immune cell can be derived from, for example without limitation, a stem cell.
  • the stem cells can be adult stem cells, non-human embryonic stem cells, more particularly non-human stem cells, cord blood stem cells, progenitor cells, bone marrow stem cells, induced pluripotent stem cells, totipotent stem cells or hematopoietic stem cells. Representative human cells are CD34+ cells.
  • the isolated cell can also be a dendritic cell, killer dendritic cell, a mast cell, a NK-cell, a B-cell or a T cell selected from the group consisting of inflammatory T-lymphocytes, cytotoxic T-lymphocytes, regulatory T-lymphocytes, memory T-lymphocytes, or helper T-lymphocytes.
  • the cell can be derived from the group consisting of CD4+ T-lymphocytes and CD8+ T-lymphocytes.
  • a source of cells can be obtained from a subject through a variety of non-limiting methods.
  • Cells can be obtained from a number of non-limiting sources, including peripheral blood mononuclear cells, bone marrow, lymph node tissue, cord blood, thymus tissue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumors.
  • any number of T cell lines available and known to those skilled in the art may be used.
  • cells can be derived from a healthy donor, from a patient diagnosed with cancer or from a patient diagnosed with an infection.
  • cells can be part of a mixed population of cells which present different phenotypic characteristics.
  • an isolated cell according to the invention comprises a polynucleotide encoding a CAR.
  • the immune cells of the invention can be activated and expanded, either prior to or after genetic modification of the T cells, using methods as generally described, for example without limitation, in U.S. Patents 6,352,694; 6,534,055; 6,905,680; 6,692,964; 5,858,358; 6,887,466; 6,905,681 ; 7,144,575; 7,067,318; 7, 172,869; 7,232,566; 7,175,843; 5,883,223; 6,905,874; 6,797,514; 6,867,041 ; and U.S. Patent Application Publication No. 20060121005.
  • T cells can be expanded in vitro or in vivo.
  • the T cells of the invention can be expanded, for example, by contact with an agent that stimulates a CD3 TCR complex and a co-stimulatory molecule on the surface of the T cells to create an activation signal for the T cell.
  • an agent that stimulates a CD3 TCR complex and a co-stimulatory molecule on the surface of the T cells to create an activation signal for the T cell.
  • chemicals such as calcium ionophore A23187, phorbol 12-myristate 13-acetate (PMA), or mitogenic lectins like phytohemagglutinin (PHA) can be used to create an activation signal for the T cell.
  • T cell populations may be stimulated in vitro by contact with, for example, an anti-CD3 antibody, or antigen-binding fragment thereof, or an anti- CD2 antibody immobilized on a surface, or by contact with a protein kinase C activator (e.g., bryostatin) in conjunction with a calcium ionophore.
  • a protein kinase C activator e.g., bryostatin
  • a ligand that binds the accessory molecule is used for co-stimulation of an accessory molecule on the surface of the T cells.
  • a population of T cells can be contacted with an anti- CD3 antibody and an anti-CD28 antibody, under conditions appropriate for stimulating proliferation of the T cells.
  • Conditions appropriate for T cell culture include an appropriate media (e.g., Minimal Essential Media or RPMI Media 1640 or, X-Vivo 15, (Lonza)) that may contain factors necessary for proliferation and viability, including serum (e.g., fetal bovine or human serum), interleukin-2 (IL-2), insulin, IFN- ⁇ , IL-4, IL-7, GM-CSF, IL-10, IL-2, IL-15, TGFp, and TNF, or any other additives for the growth of cells known to the skilled artisan.
  • Other additives for the growth of cells include, but are not limited to, surfactant, plasmanate, and reducing agents such as N-acetyl- cysteine and 2-mercaptoethanoi.
  • Media can include RPMI 1640, AIM-V, DMEM, MEM, a- MEM, F-12, X-Vivo 10, and X-Vivo 20, Optimizer, with added amino acids, sodium pyruvate, and vitamins, either serum-free or supplemented with an appropriate amount of serum (or plasma) or a defined set of hormones, and/or an amount of cytokine(s) sufficient for the growth and expansion of T cells.
  • Antibiotics e.g., penicillin and streptomycin, are included only in experimental cultures, not in cultures of cells that are to be infused into a subject.
  • the target cells are maintained under conditions necessary to support growth, for example, an appropriate temperature (e.g., 37° C) and atmosphere (e.g., air plus 5% CO2). T cells that have been exposed to varied stimulation times may exhibit different characteristics
  • the cells of the invention can be expanded by co-culturing with tissue or cells.
  • the cells can also be expanded in vivo, for example in the subject's blood after administering the cell into the subject.
  • an isolated cell according to the present invention comprises one inactivated gene selected from the group consisting of CD52, dCK, GR, PD-1 , CTLA-4, LAG3, Tim3, BTLA, BY55, TIGIT, B7H5, LAIR1 , SIGLEC10, 2B4, HLA, TCRa and TCR and/or expresses a CAR, a multi-chain CAR and/or a pTa transgene.
  • an isolated cell comprises polynucleotides encoding polypeptides comprising a multi-chain CAR.
  • the isolated cell according to the present invention comprises two inactivated genes selected from the group consisting of: CD52 and GR, CD52 and TCRa, CDR52 and TCR , GR and TCRa, GR and TCRp, TCRa and TCRp, PD-1 and TCRa, PD-1 and TCRp, CTLA-4 and TCRa, CTLA-4 and TCRp, LAG3 and TCRa, LAG3 and TCR , Tim3 and TCRa, Tim3 and TCRp, BTLA and TCRa, BTLA and TCR , BY55 and TCRa, BY55 and TCR , TIGIT and TCRa, TIGIT and TCR&, B7H5 and TCRa, B7H5 and TCR , LAIR1 and TCRa, SIGLEC10 and TCRa
  • TCR is rendered not functional in the cells according to the invention by inactivating TCRa gene and/or TCR gene(s).
  • a method to obtain modified cells derived from an individual is provided, wherein the cells can proliferate independently of the major histocompatibility complex (MHC) signaling pathway. Modified cells, which can proliferate independently of the MHC signaling pathway, and which may be obtained by this method are encompassed in the scope of the present invention.
  • MHC major histocompatibility complex
  • Modified cells disclosed herein can be used for treating patients in need thereof against Host versus Graft (HvG) rejection and Graft versus Host Disease (GvHD); therefore in the scope of the present invention is a method of treating patients in need thereof against Host versus Graft (HvG) rejection and Graft versus Host Disease (GvHD) comprising treating said patient by administering to said patient an effective amount of modified cells comprising inactivated TCRa and/or TCR genes.
  • the immune cells are engineered to be resistant to one or more chemotherapy drugs.
  • the chemotherapy drug can be, for example, a purine nucleotide analogue (PNA), thus making the immune cell suitable for cancer treatment combining adoptive immunotherapy and chemotherapy.
  • PNAs include, for example, clofarabine, fludarabine, and cytarabine, alone or in combination.
  • PNAs are metabolized by deoxycytidine kinase (dCK) into mono-, di-, and tri-phosphate PNA.
  • EGFRvlll specific CAR-T cells comprising an inactivated dCK gene.
  • the dCK knockout cells are made by transfection of T cells using polynucleotides encoding specific TAL-nuclease directed against dCK genes by, for example, electroporation of mRNA.
  • the dCK knockout EGFRvlll specific CAR-T cells are resistant to PNAs, including for example clorofarabine and/or fludarabine, and maintain T cell cytotoxic activity toward EGFRvlll- expressing cells.
  • the chemotherapy drug can be, for example, a CD52-targeting molecule, such as a monoclonal anti-CD52 antibody (e.g. alemtuzumab).
  • CD52 is a protein present on the surface of lymphocytes, and anti- CD52 antibodies can induce apoptosis and lysis of immune cells through antibody-and complement-dependent cytotoxicity, leading to lymphodepletion.
  • EGFRvlll specific CAR-T cells comprising an inactivated CD52 gene.
  • CD52 knockout cells are made by transfection of T cells using polynucleotides encoding a specific TAL-nuclease directed against the CD52 gene by, for example, electroporation of mRNA.
  • the CD52 knockout EGFRvlll specific CAR-T cells are resistant to anti-CD52 molecules, including for example alemtuzumab, and maintain T cell cytotoxic activity toward EGFRvlll-expressing cells in the presence of anti-CD52 molecules.
  • isolated cells or cell lines of the invention can comprise a pTa or a functional variant thereof.
  • an isolated cell or cell line can be further genetically modified by inactivating the TCRa gene.
  • the CAR-T cell comprises a polynucleotide encoding a suicide polypeptide, such as for example RQR8. See, e.g., WO2013153391A, which is hereby incorporated by reference in its entirety.
  • the suicide polypeptide is expressed at the surface of a CAR-T cell.
  • the suicide polypeptide comprises the amino acid sequence shown in SEQ ID NO: 226.
  • the suicide polypeptide may also comprise a signal peptide at the amino terminus.
  • binding of rituximab to the R epitopes [i.e.
  • the epitope recognized by rituximab - CPYSNPSLC (SEQ ID NO: 256)]) of the polypeptide causes lysis of the cell. More than one molecule of rituximab may bind per polypeptide expressed at the cell surface. Each R epitope of the polypeptide may bind a separate molecule of rituximab. Deletion of EGFRvlll specific CAR-T cells may occur in vivo, for example by administering rituximab to a patient. The decision to delete the transferred cells may arise from undesirable effects being detected in the patient which are attributable to the transferred cells, such as for example, when unacceptable levels of toxicity are detected.
  • a suicide polypeptide may contain one, two, three or more epitopes recognized by an antibody (e.g. rituximab).
  • a suicide polypeptide may be provided in an EGFRvlll specific CAR T cell in a polypeptide that is separate from the CAR-containing polypeptide. In some embodiments, a suicide polypeptide may be provided in an EGFRvlll specific CAR T cell in the same polypeptide chain as the CAR polypeptide. In CARs containing a suicide polypeptide, typically the suicide polypeptide is provided in the extracellular portion of the CAR.
  • the suicide polypeptide may contain, for example, one or more copies of the amino acid sequence of the epitope recognized by rituximab [CPYSNPSLC (SEQ ID NO: 256)].
  • the suicide polypeptide may be located at different positions in the CAR.
  • the suicide polypeptide may be N-terminal to the scFv or it may be C-terminal to the scFv in the CAR.
  • the suicide peptide may be between the scFv and the hinge region of the CAR.
  • a CAR may contain more than one suicide polypeptide.
  • a CAR may contain a suicide polypeptide N-terminal to the scFv and a suicide polypeptide C-terminal to the scFv. Each of these polypeptides may contain one or more copies of the epitope recognized by rituximab.
  • a CAR may contain a first suicide polypeptide at a position N-terminal to the scFv, wherein the first suicide polypeptide contains one copy of the epitope recognized by rituximab, and a second suicide polypeptide at a position C-terminal to the scFv, wherein the second suicide polypeptide contains two copies of the epitope recognized by rituximab.
  • nucleic acids encoding EGFRvlll-specific CARs that contain a suicide polypeptide sequence in the CAR.
  • a suicide polypeptide in the same polypeptide chain as an EGFRvlll specific CAR may have the sequence provided described herein as the "R2 suicide sequence”.
  • the R2 suicide sequence contains two copies of the epitope recognized by rituximab [CPYSNPSLC (SEQ ID NO: 256)].
  • CPYSNPSLC SEQ ID NO: 256
  • Such EGFRvlll-specific CARs may be referred to herein as "EGFRvlll-R2 CARs”.
  • Table 5D provides amino acid sequences of exemplary EGFRvlll-R2 CARs of the present invention.
  • Table 5D the signal/leader peptide sequence is in bold, the GS linker [(GGGGS) 4 (SEQ ID NO: 202)] is underlined, and the R2 suicide sequence is in bold and underlined.
  • Table 5E provides exemplary nucleic acid sequences encoding exemplary EGFRvlll-R2 CARs of the present invention.
  • Table 5D Amino acid sequences of exemplary EGFRvlll specific CARs with R2 suicide sequence
  • CD3zeta signa ling TATCCTG ACA ATCAG CTCCCTG CAG AG CG AG G ACTTCG CCAT CTA 1 1 1 1 1 GTC AG C AGTAC A AG G ATTG G CC ATTC ACCTTTG G domain

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • Genetics & Genomics (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Zoology (AREA)
  • Engineering & Computer Science (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • Cell Biology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Wood Science & Technology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Toxicology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • General Engineering & Computer Science (AREA)
  • Microbiology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Epidemiology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Hematology (AREA)
  • Virology (AREA)
  • Developmental Biology & Embryology (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
PCT/IB2017/050108 2016-01-21 2017-01-10 Chimeric antigen receptors targeting epidermal growth factor receptor variant iii Ceased WO2017125830A1 (en)

Priority Applications (18)

Application Number Priority Date Filing Date Title
MX2018008978A MX2018008978A (es) 2016-01-21 2017-01-10 Receptores de antigenos quimericos que se dirigen a la variante iii del receptor de factor de crecimiento epidermico.
AU2017208834A AU2017208834B2 (en) 2016-01-21 2017-01-10 Chimeric Antigen Receptors targeting Epidermal Growth Factor Receptor Variant III
PH1/2018/501473A PH12018501473B1 (en) 2016-01-21 2017-01-10 Chimeric antigen receptors targeting epidermal growth factor receptor variant iii
UAA201808794A UA125252C2 (uk) 2016-01-21 2017-01-10 Химерний антигенний рецептор, що націлений на варіант iii рецептора епідермального фактора росту
EA201891641A EA201891641A1 (ru) 2016-01-21 2017-01-10 Химерные антигенные рецепторы, нацеленные на вариант iii рецептора эпидермального фактора роста
NZ744821A NZ744821A (en) 2016-01-21 2017-01-10 Chimeric antigen receptors targeting epidermal growth factor receptor variant iii
SG11201805872SA SG11201805872SA (en) 2016-01-21 2017-01-10 Chimeric antigen receptors targeting epidermal growth factor receptor variant iii
DK17701190.5T DK3405481T5 (da) 2016-01-21 2017-01-10 Kimære antigenreceptorer målrettet epidermal vækstfaktorreceptor variant iii
MYPI2018702481A MY192474A (en) 2016-01-21 2017-01-10 Chimeric antigen receptors targeting epidermal growth factor receptor variant iii
ES17701190T ES2942362T3 (es) 2016-01-21 2017-01-10 Receptores quiméricos para el antígeno que se dirigen a la variante III del receptor del factor de crecimiento epidérmico
RU2018130088A RU2751662C2 (ru) 2016-01-21 2017-01-10 Химерные антигенные рецепторы, нацеливающиеся на вариант iii рецептора эпидермального фактора роста
JP2018538085A JP6823659B2 (ja) 2016-01-21 2017-01-10 上皮成長因子受容体変異体iiiを標的とするキメラ抗原受容体
KR1020187023865A KR102479606B1 (ko) 2016-01-21 2017-01-10 상피 성장 인자 수용체 변이체 iii을 표적화하는 키메라 항원 수용체
EP17701190.5A EP3405481B1 (en) 2016-01-21 2017-01-10 Chimeric antigen receptors targeting epidermal growth factor receptor variant iii
CN201780012883.XA CN108699124A (zh) 2016-01-21 2017-01-10 靶向表皮生长因子受体变体iii的嵌合抗原受体
BR112018014585A BR112018014585A2 (pt) 2016-01-21 2017-01-10 receptores de antígeno quiméricos que direcionam o receptor do fator de crescimento epidérmico variante iii
SA518392058A SA518392058B1 (ar) 2016-01-21 2018-07-19 مستقبلات مولد ضد خيمرية تستهدف صورة متغيرة iii لمستقبل عامل النمو البشروي
IL260666A IL260666B2 (en) 2016-01-21 2018-07-19 Chimeric antigen receptors against epidermal growth factor receptor variant iii

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201662281533P 2016-01-21 2016-01-21
US62/281,533 2016-01-21
US201662431758P 2016-12-08 2016-12-08
US62/431,758 2016-12-08

Publications (1)

Publication Number Publication Date
WO2017125830A1 true WO2017125830A1 (en) 2017-07-27

Family

ID=57868301

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/IB2017/050108 Ceased WO2017125830A1 (en) 2016-01-21 2017-01-10 Chimeric antigen receptors targeting epidermal growth factor receptor variant iii

Country Status (22)

Country Link
US (3) US10259876B2 (https=)
EP (1) EP3405481B1 (https=)
JP (2) JP6823659B2 (https=)
KR (1) KR102479606B1 (https=)
CN (1) CN108699124A (https=)
AU (1) AU2017208834B2 (https=)
BR (1) BR112018014585A2 (https=)
CA (1) CA2954014A1 (https=)
DK (1) DK3405481T5 (https=)
EA (1) EA201891641A1 (https=)
ES (1) ES2942362T3 (https=)
IL (1) IL260666B2 (https=)
MX (1) MX2018008978A (https=)
MY (1) MY192474A (https=)
NZ (1) NZ744821A (https=)
PH (1) PH12018501473B1 (https=)
RU (1) RU2751662C2 (https=)
SA (1) SA518392058B1 (https=)
SG (2) SG10202111458RA (https=)
TW (2) TWI755547B (https=)
UA (1) UA125252C2 (https=)
WO (1) WO2017125830A1 (https=)

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN109265561A (zh) * 2018-09-25 2019-01-25 山东兴瑞生物科技有限公司 抗EGFRvⅢ安全型嵌合抗原受体、其制备方法、利用其修饰的NK细胞及应用
WO2022140388A1 (en) 2020-12-21 2022-06-30 Allogene Therapeutics, Inc. Protease-activating cd45-gate car
WO2022165233A1 (en) 2021-01-29 2022-08-04 Allogene Therapeutics, Inc. KNOCKDOWN OR KNOCKOUT OF ONE OR MORE OF TAP2, NLRC5, β2m, TRAC, RFX5, RFXAP AND RFXANK TO MITIGATE T CELL RECOGNITION OF ALLOGENEIC CELL PRODUCTS
WO2024026445A1 (en) 2022-07-29 2024-02-01 Allogene Therapeutics Inc. Engineered cells with reduced gene expression to mitigate immune cell recognition
WO2025096560A1 (en) 2023-10-30 2025-05-08 Allogene Therapeutics, Inc. Engineered cells
EP4408888A4 (en) * 2021-09-29 2025-07-30 Nat Res Council Canada HUMANIZED ANTI-EGFRVIII ANTIBODIES AND ANTIGEN-BINDING FRAGMENTS THEREOF
US12565532B2 (en) 2019-07-02 2026-03-03 The United States Of America As Represented By The Secretary, Department Of Health And Human Services Monoclonal antibodies that bind EGFRvIII and their use

Families Citing this family (31)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN108472365A (zh) 2015-10-30 2018-08-31 艾丽塔生物治疗剂公司 用于肿瘤转导的组合物和方法
US10508143B1 (en) 2015-10-30 2019-12-17 Aleta Biotherapeutics Inc. Compositions and methods for treatment of cancer
CN109219618B (zh) 2016-01-21 2022-08-09 辉瑞大药厂 针对表皮生长因子受体变体iii和cd3的单特异性和双特异性抗体及其用途
TWI755547B (zh) * 2016-01-21 2022-02-21 美商輝瑞股份有限公司 靶向表皮生長因子受體變異體iii之嵌合型抗原受體
CA3045339A1 (en) 2016-12-03 2018-06-07 Juno Therapeutics, Inc. Methods and compositions for use of therapeutic t cells in combination with kinase inhibitors
WO2018119142A1 (en) 2016-12-21 2018-06-28 Amgen Inc. Anti-tnf alpha antibody formulations
AU2018275894B2 (en) 2017-06-02 2025-04-24 Juno Therapeutics, Inc. Articles of manufacture and methods for treatment using adoptive cell therapy
CA3095757A1 (en) 2018-04-06 2019-10-10 The Regents Of The University Of California Methods of treating glioblastomas
CA3096202A1 (en) * 2018-04-06 2019-10-10 The Regents Of The University Of California Methods of treating egfrviii expressing glioblastomas
US20220177524A1 (en) * 2018-07-26 2022-06-09 Nanjing Legend Biotech Co., Ltd. Nef-containing t cells and methods of producing thereof
US12331320B2 (en) 2018-10-10 2025-06-17 The Research Foundation For The State University Of New York Genome edited cancer cell vaccines
EP3883955A1 (en) * 2018-11-19 2021-09-29 Board of Regents, The University of Texas System A modular, polycistronic vector for car and tcr transduction
WO2020112796A1 (en) * 2018-12-01 2020-06-04 Allogene Therapeutics, Inc. Chimeric antigen receptors targeting b-cell maturation antigen and methods of use thereof
CR20210330A (es) * 2018-12-21 2021-07-20 Hoffmann La Roche ANTICUERPOS QUE SE UNEN A CD3 (Divisional 2021-0325)
AU2020209991B2 (en) * 2019-01-17 2024-11-14 Immunocore Limited Formulations
CN111454358A (zh) * 2019-01-18 2020-07-28 四川科伦博泰生物医药股份有限公司 一种嵌合抗原受体及其应用
CN113710697A (zh) * 2019-03-15 2021-11-26 美国政府(由卫生和人类服务部的部长所代表) 嵌合衔接子和激酶信号传导蛋白及其在免疫疗法中的用途
EP4003375A4 (en) * 2019-07-31 2023-09-06 Forty Seven, Inc. DEPLETION DIETS FOR MODIFIED T CELL OR NK CELL THERAPY
EP4031583A4 (en) * 2019-09-16 2023-11-15 Fred Hutchinson Cancer Center CHIMERIC RECEPTOR PROTEINS AND THEIR USES
BR112022006364A2 (pt) * 2019-10-01 2022-06-28 Epsilogen Ltd Anticorpo híbrido
EP4081537A1 (en) * 2019-12-23 2022-11-02 Cellectis New mesothelin specific chimeric antigen receptors (car) for solid tumors cancer immunotherapy
WO2021130535A2 (en) * 2019-12-28 2021-07-01 Shanghai Cell Therapy Group Company Co., Ltd. Cell expressing immune modulatory molecules and system for expressing immune modulatory molecules
CN111019959B (zh) * 2019-12-30 2022-09-13 北京立康生命科技有限公司 一种体外转录mRNA的核苷酸分子、呈递细胞及应用
US12589112B2 (en) 2020-01-22 2026-03-31 City Of Hope Oncolytic virus compositions including IL-15 complex and methods for the treatment of cancer
US20250121002A1 (en) * 2021-07-16 2025-04-17 Noile-Immune Biotech Inc. ANTI-EGFRviii ANTIBODY, POLYPEPTIDE, CELL CAPABLE OF EXPRESSING SAID POLYPEPTIDE, PHARMACEUTICAL COMPOSITION COMPRISING SAID CELL, METHOD FOR PRODUCING SAID CELL, AND POLYNUCLEOTIDE OR VECTOR COMPRISING NUCLEOTIDE SEQUENCE ENCODING SAID POLYPEPTIDE
AU2023319881A1 (en) * 2022-08-05 2025-03-13 Beijing Dcty Biotech Co., Ltd. Antibody targeting egfrviii and use thereof in cell immunotherapy
CN116284435A (zh) * 2022-09-19 2023-06-23 卡瑞济(北京)生命科技有限公司 EGFRvIII嵌合抗原受体及其用途
CN120936371A (zh) * 2023-03-30 2025-11-11 诺沃库勒有限责任公司 用于使用肿瘤治疗电场和嵌合抗原受体(car)免疫细胞治疗癌症的组合物、系统和方法
CN117659196B (zh) * 2023-12-12 2024-08-23 成都优赛诺生物科技有限公司 一种靶向cd7的单域抗体、嵌合抗原受体及其应用
CN119912588B (zh) * 2025-04-01 2025-08-12 浙江大学 嵌合抗原受体、人诱导多能干细胞、髓系前体细胞样巨噬细胞及其制备方法
CN120248142B (zh) * 2025-06-06 2025-09-12 上海兴瑞一达生物科技有限公司 一种共表达cd47和il-15的双靶点嵌合抗原受体、car-t细胞及其应用

Citations (39)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4683202A (en) 1985-03-28 1987-07-28 Cetus Corporation Process for amplifying nucleic acid sequences
US4683195A (en) 1986-01-30 1987-07-28 Cetus Corporation Process for amplifying, detecting, and/or-cloning nucleic acid sequences
WO1987004462A1 (en) 1986-01-23 1987-07-30 Celltech Limited Recombinant dna sequences, vectors containing them and method for the use thereof
US4754065A (en) 1984-12-18 1988-06-28 Cetus Corporation Precursor to nucleic acid probe
US4800159A (en) 1986-02-07 1989-01-24 Cetus Corporation Process for amplifying, detecting, and/or cloning nucleic acid sequences
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US5037743A (en) 1988-08-05 1991-08-06 Zymogenetics, Inc. BAR1 secretion signal
US5143830A (en) 1986-05-15 1992-09-01 Holland Ian B Process for the production of a polypeptide
US5545807A (en) 1988-10-12 1996-08-13 The Babraham Institute Production of antibodies from transgenic animals
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
US5569825A (en) 1990-08-29 1996-10-29 Genpharm International Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5750373A (en) 1990-12-03 1998-05-12 Genentech, Inc. Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants
US5858358A (en) 1992-04-07 1999-01-12 The United States Of America As Represented By The Secretary Of The Navy Methods for selectively stimulating proliferation of T cells
WO1999058572A1 (en) 1998-05-08 1999-11-18 Cambridge University Technical Services Limited Binding molecules derived from immunoglobulins which do not trigger complement mediated lysis
US6352694B1 (en) 1994-06-03 2002-03-05 Genetics Institute, Inc. Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells
US6534055B1 (en) 1988-11-23 2003-03-18 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
US6692964B1 (en) 1995-05-04 2004-02-17 The United States Of America As Represented By The Secretary Of The Navy Methods for transfecting T cells
US6797514B2 (en) 2000-02-24 2004-09-28 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US6867041B2 (en) 2000-02-24 2005-03-15 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US6905874B2 (en) 2000-02-24 2005-06-14 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US6905680B2 (en) 1988-11-23 2005-06-14 Genetics Institute, Inc. Methods of treating HIV infected subjects
US20060121005A1 (en) 2000-02-24 2006-06-08 Xcyte Therapies, Inc. Activation and expansion of cells
US7067318B2 (en) 1995-06-07 2006-06-27 The Regents Of The University Of Michigan Methods for transfecting T cells
US7175843B2 (en) 1994-06-03 2007-02-13 Genetics Institute, Llc Methods for selectively stimulating proliferation of T cells
WO2012058458A2 (en) 2010-10-27 2012-05-03 Cellectis Sa Method for increasing the efficiency of double-strand break-induced mutagenesis
WO2012138475A1 (en) * 2011-04-08 2012-10-11 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Anti-epidermal growth factor receptor variant iii chimeric antigen receptors and use of same for the treatment of cancer
WO2013153391A1 (en) 2012-04-13 2013-10-17 Ucl Business Plc Polypeptide useful in adoptive cell therapy
WO2014011988A2 (en) * 2012-07-13 2014-01-16 The Trustees Of The University Of Pennsylvania Enhancing activity of car t cells by co-introducing a bispecific antibody
WO2014039523A1 (en) 2012-09-04 2014-03-13 Cellectis Multi-chain chimeric antigen receptor and uses thereof
WO2014130657A1 (en) * 2013-02-20 2014-08-28 The Trustees Of The University Of Pennsylvania Treatment of cancer using humanized anti-egfrviii chimeric antigen receptor
WO2014184744A1 (en) 2013-05-13 2014-11-20 Cellectis Methods for engineering highly active t cell for immunotherapy
WO2014184741A1 (en) 2013-05-13 2014-11-20 Cellectis Methods for engineering allogeneic and highly active t cell for immunotheraphy
WO2014184143A1 (en) 2013-05-13 2014-11-20 Cellectis Cd19 specific chimeric antigen receptor and uses thereof
WO2014191128A1 (en) 2013-05-29 2014-12-04 Cellectis Methods for engineering t cells for immunotherapy by using rna-guided cas nuclease system
WO2015092024A2 (en) * 2013-12-20 2015-06-25 Cellectis Method of engineering multi-input signal sensitive t cell for immunotherapy
WO2016016341A1 (en) * 2014-07-29 2016-02-04 Cellectis EGFRvIII SPECIFIC CHIMERIC ANTIGEN RECEPTORS FOR CANCER IMMUNOTHERAPY

Family Cites Families (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU687010B2 (en) 1992-07-17 1998-02-19 Dana-Farber Cancer Institute Method of intracellular binding of target molecules
ATE419354T1 (de) * 2000-02-25 2009-01-15 Us Gov Health & Human Serv Scfv-moleküle gegen egfrviii mit verbesserter zytotoxizität und ausbeute, darauf basierte immuntoxine, und verfahren zur deren verwendung
WO2008045437A2 (en) 2006-10-09 2008-04-17 The General Hospital Corporation Chimeric t-cell receptors and t-cells targeting egfrviii on tumors
US9249217B2 (en) 2010-12-03 2016-02-02 Secretary, DHHS Bispecific EGFRvIII x CD3 antibody engaging molecules
PH12013501201A1 (en) 2010-12-09 2013-07-29 Univ Pennsylvania Use of chimeric antigen receptor-modified t cells to treat cancer
WO2013185010A1 (en) 2012-06-07 2013-12-12 Duke University HUMAN BISPECIFIC EGFRvIII ANTIBODY ENGAGING MOLECULES
AU2013204922B2 (en) * 2012-12-20 2015-05-14 Celgene Corporation Chimeric antigen receptors
CN105283201B (zh) 2013-03-14 2019-08-02 斯克利普斯研究所 靶向剂抗体偶联物及其用途
ES2718399T3 (es) 2013-07-09 2019-07-01 Univ Duke Moléculas que se acoplan a anticuerpos EGFRVIII biespecíficas humanas
LT3030581T (lt) 2013-08-07 2021-05-25 Affimed Gmbh Antikūno surišimo vietos specifiškos egfrviii
TWI744242B (zh) 2015-07-31 2021-11-01 德商安美基研究(慕尼黑)公司 Egfrviii及cd3抗體構築體
CN109219618B (zh) 2016-01-21 2022-08-09 辉瑞大药厂 针对表皮生长因子受体变体iii和cd3的单特异性和双特异性抗体及其用途
TWI755547B (zh) 2016-01-21 2022-02-21 美商輝瑞股份有限公司 靶向表皮生長因子受體變異體iii之嵌合型抗原受體

Patent Citations (47)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4754065A (en) 1984-12-18 1988-06-28 Cetus Corporation Precursor to nucleic acid probe
US4683202A (en) 1985-03-28 1987-07-28 Cetus Corporation Process for amplifying nucleic acid sequences
US4683202B1 (https=) 1985-03-28 1990-11-27 Cetus Corp
WO1987004462A1 (en) 1986-01-23 1987-07-30 Celltech Limited Recombinant dna sequences, vectors containing them and method for the use thereof
US4683195A (en) 1986-01-30 1987-07-28 Cetus Corporation Process for amplifying, detecting, and/or-cloning nucleic acid sequences
US4683195B1 (https=) 1986-01-30 1990-11-27 Cetus Corp
US4800159A (en) 1986-02-07 1989-01-24 Cetus Corporation Process for amplifying, detecting, and/or cloning nucleic acid sequences
US5143830A (en) 1986-05-15 1992-09-01 Holland Ian B Process for the production of a polypeptide
US5037743A (en) 1988-08-05 1991-08-06 Zymogenetics, Inc. BAR1 secretion signal
US5545807A (en) 1988-10-12 1996-08-13 The Babraham Institute Production of antibodies from transgenic animals
US5883223A (en) 1988-11-23 1999-03-16 Gray; Gary S. CD9 antigen peptides and antibodies thereto
US6887466B2 (en) 1988-11-23 2005-05-03 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
US7232566B2 (en) 1988-11-23 2007-06-19 The United States As Represented By The Secretary Of The Navy Methods for treating HIV infected subjects
US6534055B1 (en) 1988-11-23 2003-03-18 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
US7144575B2 (en) 1988-11-23 2006-12-05 The Regents Of The University Of Michigan Methods for selectively stimulating proliferation of T cells
US6905680B2 (en) 1988-11-23 2005-06-14 Genetics Institute, Inc. Methods of treating HIV infected subjects
US5569825A (en) 1990-08-29 1996-10-29 Genpharm International Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
US5750373A (en) 1990-12-03 1998-05-12 Genentech, Inc. Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants
US5858358A (en) 1992-04-07 1999-01-12 The United States Of America As Represented By The Secretary Of The Navy Methods for selectively stimulating proliferation of T cells
US7175843B2 (en) 1994-06-03 2007-02-13 Genetics Institute, Llc Methods for selectively stimulating proliferation of T cells
US6905681B1 (en) 1994-06-03 2005-06-14 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
US6352694B1 (en) 1994-06-03 2002-03-05 Genetics Institute, Inc. Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells
US6692964B1 (en) 1995-05-04 2004-02-17 The United States Of America As Represented By The Secretary Of The Navy Methods for transfecting T cells
US7172869B2 (en) 1995-05-04 2007-02-06 The United States Of America As Represented By The Secretary Of The Navy Methods for transfecting T cells
US7067318B2 (en) 1995-06-07 2006-06-27 The Regents Of The University Of Michigan Methods for transfecting T cells
WO1999058572A1 (en) 1998-05-08 1999-11-18 Cambridge University Technical Services Limited Binding molecules derived from immunoglobulins which do not trigger complement mediated lysis
US6867041B2 (en) 2000-02-24 2005-03-15 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US6905874B2 (en) 2000-02-24 2005-06-14 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US6797514B2 (en) 2000-02-24 2004-09-28 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US20060121005A1 (en) 2000-02-24 2006-06-08 Xcyte Therapies, Inc. Activation and expansion of cells
WO2012058458A2 (en) 2010-10-27 2012-05-03 Cellectis Sa Method for increasing the efficiency of double-strand break-induced mutagenesis
WO2012138475A1 (en) * 2011-04-08 2012-10-11 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Anti-epidermal growth factor receptor variant iii chimeric antigen receptors and use of same for the treatment of cancer
WO2013153391A1 (en) 2012-04-13 2013-10-17 Ucl Business Plc Polypeptide useful in adoptive cell therapy
WO2014011988A2 (en) * 2012-07-13 2014-01-16 The Trustees Of The University Of Pennsylvania Enhancing activity of car t cells by co-introducing a bispecific antibody
WO2014039523A1 (en) 2012-09-04 2014-03-13 Cellectis Multi-chain chimeric antigen receptor and uses thereof
WO2014130657A1 (en) * 2013-02-20 2014-08-28 The Trustees Of The University Of Pennsylvania Treatment of cancer using humanized anti-egfrviii chimeric antigen receptor
WO2014184744A1 (en) 2013-05-13 2014-11-20 Cellectis Methods for engineering highly active t cell for immunotherapy
WO2014184741A1 (en) 2013-05-13 2014-11-20 Cellectis Methods for engineering allogeneic and highly active t cell for immunotheraphy
WO2014184143A1 (en) 2013-05-13 2014-11-20 Cellectis Cd19 specific chimeric antigen receptor and uses thereof
WO2014191128A1 (en) 2013-05-29 2014-12-04 Cellectis Methods for engineering t cells for immunotherapy by using rna-guided cas nuclease system
WO2015092024A2 (en) * 2013-12-20 2015-06-25 Cellectis Method of engineering multi-input signal sensitive t cell for immunotherapy
WO2016016341A1 (en) * 2014-07-29 2016-02-04 Cellectis EGFRvIII SPECIFIC CHIMERIC ANTIGEN RECEPTORS FOR CANCER IMMUNOTHERAPY

Non-Patent Citations (64)

* Cited by examiner, † Cited by third party
Title
"Methods in Enzymology", ACADEMIC PRESS, INC.
"Methods in Molecular Biology", HUMANA PRESS
"Remington, The Science and Practice of Pharmacy, 21st ed.", 2005, MACK PUBLISHING
"Short Protocols in Molecular Biology", 1999, WILEY AND SONS
A. DOYLE, J.B. GRIFFITHS: "Cell and Tissue Culture: Laboratory Procedures", 1993, J. WILEY AND SONS
A. GENNARO: "Remington's Pharmaceutical Sciences, 18th ed.", 1990, MACK PUBLISHING CO.
AL-LAZIKANI ET AL., J. MOLEC. BIOL., vol. 273, 1997, pages 927 - 948
B. PHILIP ET AL: "A highly compact epitope-based marker/suicide gene for easier and safer T-cell therapy", BLOOD, vol. 124, no. 8, 21 August 2014 (2014-08-21), US, pages 1277 - 1287, XP055229811, ISSN: 0006-4971, DOI: 10.1182/blood-2014-01-545020 *
BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426
BOERNER ET AL., J. IMMUNOL., vol. 147, no. 1, 1991, pages 86 - 95
BRENNER ET AL., CURRENT OPINION IN IMMUNOLOGY, vol. 22, no. 2, 2010, pages 251 - 257
C.A. JANEWAY; P. TRAVERS: "Immunobiology", 1997
CAPEL ET AL., IMMUNOMETHODS, vol. 4, 1994, pages 25 - 34
CHOTHIA ET AL., NATURE, vol. 342, 1989, pages 877 - 883
COLE ET AL.: "Monoclonal Antibodies and Cancer Therapy", 1985, ALAN R. LISS, pages: 77
D. CATTY: "Antibodies: a practical approach", 1988, IRL PRESS
D.M. WEIR AND C.C. BLACKWELL: "Handbook of Experimental Immunology", .
DAYHOFF, M.O.: "Atlas of Protein Sequence and Structure", vol. 5, 1978, NATIONAL BIOMEDICAL RESEARCH FOUNDATION, article DAYHOFF, M.O.: "A model of evolutionary change in proteins - Matrices for detecting distant relationships", pages: 345 - 358
DE HAAS ET AL., J. LAB. CLIN. MED., vol. 126, 1995, pages 330 - 41
E. HARLOW; D. LANE: "Using antibodies: a laboratory manual", 1999, COLD SPRING HARBOR LABORATORY PRESS
ESHHAR ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, no. 2, 1993, pages 720 - 724
F.M. AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 1987
FELLOUSE, F.A. ET AL., J. MOL. BIOL., vol. 373, no. 4, 2007, pages 924 - 40
GUYER ET AL., J. IMMUNOL., vol. 117, 1976, pages 587
HEIN J.: "Methods in Enzymology", vol. 183, 1990, ACADEMIC PRESS, INC., article "Unified Approach to Alignment and Phylogenes", pages: 626 - 645
HIGGINS, D.G.; SHARP, P.M., CABIOS, vol. 5, 1989, pages 151 - 153
HOOGENBOOM; WINTER, J. MOL. BIOL., vol. 227, 1991, pages 381
J.E. CELLIS: "Cell Biology: A Laboratory Notebook", 1998, ACADEMIC PRESS
J.E. COLIGAN ET AL.: "Current Protocols in Immunology", 1991
J.M. MILLER AND M.P. CALOS: "Gene Transfer Vectors for Mammalian Cells", 1987
J.P. MATHER; P.E. ROBERTS: "Introduction to Cell and Tissue Culture", 1998, PLENUM PRESS
JAYASENA, S.D., CLIN. CHEM., vol. 45, 1999, pages 1628 - 50
JIANFENG HAN ET AL: "CAR-Engineered NK Cells Targeting Wild-Type EGFR and EGFRvIII Enhance Killing of Glioblastoma and Patient-Derived Glioblastoma Stem Cells", SCIENTIFIC REPORTS, vol. 5, 9 July 2015 (2015-07-09), pages 11483, XP055201968, DOI: 10.1038/srep11483 *
KABAT ET AL.: "Sequences of Proteins of Immunological Interest, 5th ed.", 1991, NATIONAL INSTITUTES OF HEALTH
KABAT ET AL.: "Sequences of Proteins of Immunological Interest, 5th ed.", 1992, NIH
KARLSSON ET AL., ANAL. BIOCHEM, vol. 349, 2006, pages 136 - 147
KIM ET AL., J. IMMUNOL., vol. 24, 1994, pages 249
KOHLER; MILSTEIN, NATURE, vol. 256, 1975, pages 495
M. ZANETTI AND J.D. CAPRA: "The Antibodies", 1995, HARWOOD ACADEMIC PUBLISHERS
M.J. GAIT: "Oligonucleotide Synthesis", 1984
MACCALLUM ET AL., J. MOL. BIOL., vol. 262, 1996, pages 732 - 745
MAKABE ET AL., J. BIOL. CHEM., vol. 283, 2007, pages 1156 - 1166
MAKABE ET AL., JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 283, 2008, pages 1156 - 1166
MARKS ET AL., J. MOL. BIOL., vol. 222, 1991, pages 581
MCCAFFERTY ET AL., NATURE, vol. 348, 1990, pages 552 - 554
MULLIS ET AL.: "PCR: The Polymerase Chain Reaction", 1994
MULLIS ET AL.: "PCR: The Polymerase Chain Reaction", 1994, BIRKAUSWER PRESS
MYERS, E.W.; MULLER W., CABIOS, vol. 4, 1988, pages 11 - 17
MYSZKA, J. MOL. RECOGNIT, vol. 12, 1999, pages 279 - 284
MYSZKA; MORTON ET AL., BIOPHYS. CHEM, vol. 64, 1997, pages 127 - 137
P. FINCH, ANTIBODIES, 1997
P. SHEPHERD AND C. DEAN: "Monoclonal antibodies: a practical approach", 2000, OXFORD UNIVERSITY PRESS
R.I. FRESHNEY: "Animal Cell Culture", 1987
RAVETCH; KINET, ANN. REV. IMMUNOL., vol. 9, 1991, pages 457 - 92
ROBINSON, E.D., COMB. THEOR., vol. 11, 1971, pages 105
ROSENBERG ET AL., NATURE REVIEWS CANCER, vol. 8, no. 4, 2008, pages 299 - 308
SADELAIN ET AL., CURR. OPIN. IMMUNOL, vol. 21, no. 2, 2009, pages 215 - 223
SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual, 2nd ed.", 1989, COLD SPRING HARBOR PRESS
SANTOU, N.; NES, M., MOL. BIOL. EVOL., vol. 4, 1987, pages 406 - 425
SHEETS ET AL., PROC. NATL. ACAD. SCI. (USA, vol. 95, 1998, pages 6157 - 6162
SNEATH, P.H.A.; SOKAL, R.R.: "Numerical Taxonomy the Principles and Practice of Numerical Taxonomy", 1973, FREEMAN PRESS
VAUGHAN ET AL., NATURE BIOTECHNOLOGY, vol. 14, 1996, pages 309 - 314
WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 546
WILBUR, W.J; LIPMAN, D.J., PROC. NATL. ACAD. SCI. USA, vol. 80, 1983, pages 726 - 730

Cited By (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN109265561A (zh) * 2018-09-25 2019-01-25 山东兴瑞生物科技有限公司 抗EGFRvⅢ安全型嵌合抗原受体、其制备方法、利用其修饰的NK细胞及应用
CN109265561B (zh) * 2018-09-25 2021-05-25 山东兴瑞生物科技有限公司 抗EGFRvⅢ安全型嵌合抗原受体、其制备方法、利用其修饰的NK细胞及应用
US12565532B2 (en) 2019-07-02 2026-03-03 The United States Of America As Represented By The Secretary, Department Of Health And Human Services Monoclonal antibodies that bind EGFRvIII and their use
WO2022140388A1 (en) 2020-12-21 2022-06-30 Allogene Therapeutics, Inc. Protease-activating cd45-gate car
US12404315B2 (en) 2020-12-21 2025-09-02 Allogene Therapeutics, Inc. Protease-activating CD45-gate CAR
WO2022165233A1 (en) 2021-01-29 2022-08-04 Allogene Therapeutics, Inc. KNOCKDOWN OR KNOCKOUT OF ONE OR MORE OF TAP2, NLRC5, β2m, TRAC, RFX5, RFXAP AND RFXANK TO MITIGATE T CELL RECOGNITION OF ALLOGENEIC CELL PRODUCTS
US12577283B2 (en) 2021-01-29 2026-03-17 Allogene Therapeutics, Inc. Knockdown or knockout of one or more of TAP2, NLRC5, B2m, TRAC, RFX5, RFXAP and RFXANK to mitigate t cell recognition of allogeneic cell products
EP4408888A4 (en) * 2021-09-29 2025-07-30 Nat Res Council Canada HUMANIZED ANTI-EGFRVIII ANTIBODIES AND ANTIGEN-BINDING FRAGMENTS THEREOF
WO2024026445A1 (en) 2022-07-29 2024-02-01 Allogene Therapeutics Inc. Engineered cells with reduced gene expression to mitigate immune cell recognition
WO2025096560A1 (en) 2023-10-30 2025-05-08 Allogene Therapeutics, Inc. Engineered cells

Also Published As

Publication number Publication date
JP7198797B2 (ja) 2023-01-04
TWI634125B (zh) 2018-09-01
SA518392058B1 (ar) 2023-02-12
RU2018130088A3 (https=) 2020-07-29
PH12018501473B1 (en) 2023-08-02
CN108699124A (zh) 2018-10-23
EP3405481B1 (en) 2023-01-18
ES2942362T3 (es) 2023-05-31
DK3405481T3 (da) 2023-04-17
AU2017208834B2 (en) 2021-09-02
JP2019506394A (ja) 2019-03-07
RU2018130088A (ru) 2020-02-25
NZ744821A (en) 2023-06-30
IL260666B (en) 2022-10-01
US10259876B2 (en) 2019-04-16
UA125252C2 (uk) 2022-02-09
PH12018501473A1 (en) 2019-03-11
EP3405481A1 (en) 2018-11-28
CA2954014A1 (en) 2017-07-21
US20220227874A1 (en) 2022-07-21
JP2021036873A (ja) 2021-03-11
EA201891641A1 (ru) 2019-01-31
JP6823659B2 (ja) 2021-02-03
TW201920237A (zh) 2019-06-01
TW201734038A (zh) 2017-10-01
US20190144550A1 (en) 2019-05-16
TWI755547B (zh) 2022-02-21
DK3405481T5 (da) 2024-09-23
MX2018008978A (es) 2019-01-10
BR112018014585A2 (pt) 2018-12-11
SG11201805872SA (en) 2018-08-30
US11267892B2 (en) 2022-03-08
IL260666A (en) 2018-09-20
KR102479606B1 (ko) 2022-12-21
KR20180099890A (ko) 2018-09-05
AU2017208834A1 (en) 2018-08-09
US20170210811A1 (en) 2017-07-27
SG10202111458RA (en) 2021-11-29
MY192474A (en) 2022-08-23
IL260666B2 (en) 2023-02-01
RU2751662C2 (ru) 2021-07-15

Similar Documents

Publication Publication Date Title
US20220227874A1 (en) Chimeric antigen receptors targeting epidermal growth factor receptor variant iii
US11912776B2 (en) Chimeric antigen receptors targeting B-cell maturation antigen
HK40043804A (en) Chimeric antigen receptors targeting b-cell maturation antigen
HK40043804B (en) Chimeric antigen receptors targeting b-cell maturation antigen
HK1262083B (en) Chimeric antigen receptors targeting epidermal growth factor receptor variant iii
HK1262083A1 (en) Chimeric antigen receptors targeting epidermal growth factor receptor variant iii
EA044329B1 (ru) Химерные антигенные рецепторы, нацеленные на вариант iii рецептора эпидермального фактора роста
HK1250993B (en) Chimeric antigen receptors targeting b-cell maturation antigen

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17701190

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 11201805872S

Country of ref document: SG

WWE Wipo information: entry into national phase

Ref document number: 12018501473

Country of ref document: PH

WWE Wipo information: entry into national phase

Ref document number: 260666

Country of ref document: IL

ENP Entry into the national phase

Ref document number: 2018538085

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: MX/A/2018/008978

Country of ref document: MX

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112018014585

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2017208834

Country of ref document: AU

Date of ref document: 20170110

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 201891641

Country of ref document: EA

WWE Wipo information: entry into national phase

Ref document number: A201808794

Country of ref document: UA

ENP Entry into the national phase

Ref document number: 20187023865

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 1020187023865

Country of ref document: KR

WWE Wipo information: entry into national phase

Ref document number: 2017701190

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2017701190

Country of ref document: EP

Effective date: 20180821

ENP Entry into the national phase

Ref document number: 112018014585

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20180717