WO2017114694A1 - VARIABLE REGIONS FOR NKp46 BINDING PROTEINS - Google Patents

VARIABLE REGIONS FOR NKp46 BINDING PROTEINS Download PDF

Info

Publication number
WO2017114694A1
WO2017114694A1 PCT/EP2016/081953 EP2016081953W WO2017114694A1 WO 2017114694 A1 WO2017114694 A1 WO 2017114694A1 EP 2016081953 W EP2016081953 W EP 2016081953W WO 2017114694 A1 WO2017114694 A1 WO 2017114694A1
Authority
WO
WIPO (PCT)
Prior art keywords
nkp46
domain
polypeptide
amino acid
protein
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2016/081953
Other languages
English (en)
French (fr)
Inventor
Laurent Gauthier
Nadia ANCERIZ
Ariane MOREL
Benjamin Rossi
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Innate Pharma SA
Original Assignee
Innate Pharma SA
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to US16/066,688 priority Critical patent/US11001629B2/en
Priority to JP2018552124A priority patent/JP7091250B2/ja
Priority to CN202210862118.XA priority patent/CN115925933A/zh
Priority to AU2016383475A priority patent/AU2016383475B2/en
Priority to EP16826025.5A priority patent/EP3397645B1/en
Priority to CA3007898A priority patent/CA3007898A1/en
Priority to CN201680082632.4A priority patent/CN108779175B/zh
Application filed by Innate Pharma SA filed Critical Innate Pharma SA
Publication of WO2017114694A1 publication Critical patent/WO2017114694A1/en
Anticipated expiration legal-status Critical
Priority to US17/315,547 priority patent/US11891444B2/en
Priority to JP2022096649A priority patent/JP7551693B2/ja
Priority to US18/432,126 priority patent/US20240174748A1/en
Priority to JP2024151952A priority patent/JP2025000628A/ja
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2809Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2887Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD20
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/46Hybrid immunoglobulins
    • C07K16/468Immunoglobulins having two or more different antigen binding sites, e.g. multifunctional antibodies
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/64General methods for preparing the vector, for introducing it into the cell or for selecting the vector-containing host
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/66General methods for inserting a gene into a vector to form a recombinant vector using cleavage and ligation; Use of non-functional linkers or adaptors, e.g. linkers containing the sequence for a restriction endonuclease
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/10Cells modified by introduction of foreign genetic material
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/526CH3 domain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/732Antibody-dependent cellular cytotoxicity [ADCC]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2511/00Cells for large scale production
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2523/00Culture process characterised by temperature

Definitions

  • Immunoglobulin variable regions and proteins such as antibodies and multispecific proteins that comprise the variable regions are provided.
  • the proteins can bind and specifically redirect NK cells to lyse a target cell of interest.
  • the proteins have utility in the treatment of disease, notably cancer or infectious disease.
  • Bispecific antibodies binding two different epitopes offer opportunities for increasing specificity, broadening potency, and utilizing novel mechanisms of action that cannot be achieved with a traditional monoclonal antibody.
  • a variety of formats for bispecific antibodies that bind to two targets simultaneously have been reported.
  • Cross-linking two different receptors using a bispecific antibody to inhibit a signaling pathway has shown utility in a number of applications (see, e.g., Jackman, et al., (2010) J. Biol. Chem. 285:20850-20859).
  • Bispecific antibodies have also been used to neutralize two different receptors.
  • bispecific antibodies have been used to recruit immune effector cells, where T- cell activation is achieved in proximity to tumor cells by the bispecific antibody which binds receptors simultaneously on the two different cell types (see Baeuerle, P. A., et al, (2009) Cancer Res 69(12):4941-4).
  • Approaches developed to date have primarily involved bispecific antibodies that link the CD3 complex on T cells to a tumor-associated antigen.
  • bispecific antibodies having one arm which binds CD16 (FcyRllla) and another which bound to an antigen of interest such as CD19 have been developed (see Kellner et al. (201 1 ) Cancer Lett. 303(2): 128-139).
  • NK cells Natural killer (NK) cells are a subpopulation of lymphocytes that are involved in non- conventional immunity. NK cells provide an efficient immunosurveillance mechanism by which undesired cells such as tumor or vi rally-infected cells can be eliminated. Characteristics and biological properties of NK cells include the expression of surface antigens including CD16, CD56 and/or CD57, the absence of the alpha/beta or gamma/delta TCR complex on the cell surface; the ability to bind to and kill cells that fail to express "self" MHC/HLA antigens by the activation of specific cytolytic enzymes, the ability to kill tumor cells or other diseased cells that express a ligand for NK activating receptors, and the ability to release protein molecules called cytokines that stimulate or inhibit the immune response.
  • surface antigens including CD16, CD56 and/or CD57, the absence of the alpha/beta or gamma/delta TCR complex on the cell surface; the ability to bind to and kill cells that
  • NK cell activity is regulated by a complex mechanism that involves both activating and inhibitory signals.
  • Several distinct NK cell receptors have been identified that play an important role in the NK cell mediated recognition and killing of HLA Class I deficient target cells.
  • One receptor although not specific to NK cells, is FcyR3a (CD16) which is responsible for NK cell mediated ADCC.
  • Another NK cell receptor is NKp46, a member of the Ig superfamily. It is specific to NK cells and its cross-linking, induced by specific mAbs, leads to a strong NK cell activation resulting in increased intracellular Ca ++ levels, triggering of cytotoxicity, and lymphokine release.
  • NK cell specific bispecific antibodies have been developed.
  • the depleting agents that recruit NK cytotoxicity such as anti-tumor antibodies are typically full- length lgG1 that mediate ADCC via CD16.
  • lgG1 that mediate ADCC via CD16.
  • the present invention arises from the discovery of antibody hypervariable regions that cross-react with both a human NKp46 polypeptide and a non- human primate (e.g. e.g. a Macaca fascicularis) NKp46 polypeptide.
  • a non- human primate e.g. e.g. a Macaca fascicularis
  • the present invention arises from the discovery of antibody hypervariable regions that remain functional in in single chain proteins and multi-specific proteins (e.g. a polypeptide, a single chain protein, a multi-chain protein, including but not limited to antibody-based protein formats) that bind to NKp46 on NK cells.
  • the antigen domains bind to epitopes on NKp46 that provide for highly potent antigen binding proteins.
  • the epitopes are furthermore shared by human and non-human primates, including on NKp46 as expressed at the surface of an NK cell.
  • variable regions when incorporated into a polypeptide (e.g. antibody, Fc protein, scFv, etc.) that binds NKp46 in monovalent manner, permit the binding to NKp46 on isolated NK cells without triggering NKp46 activation (in the absence of target cells).
  • the variable regions are capable of binding NKp46 with high affinity as single chain polypeptides, e.g., as tandem variable regions separated by a peptide linker, as well as in F(ab) form, and are capable, as monovalent binders, to bind to NKp46 epitopes that enable NK cells to be directed to lyse target cells.
  • a polypeptide e.g. antibody, Fc protein, scFv, etc.
  • the variable regions are capable of binding NKp46 with high affinity as single chain polypeptides, e.g., as tandem variable regions separated by a peptide linker, as well as in F(ab) form, and are capable, as
  • bispecific proteins that bind to NKp46 and an antigen of interest via the heavy and light chain anti-NKp46 variable regions, and to an antigen of interest on a target cell via a hypervariable region (e.g. a heavy and light chain variable region) that specifically binds the antigen of interest.
  • a multispecific protein is capable of redirecting NK cells to lyse a target cell that expresses the antigen of interest, e.g. a cell that contributes to disease.
  • hypervariable regions and humanized variable regions disclosed herein retain monovalent binding in single chain form and can be used advantageously in configurations where they are placed on a single polypeptide chain, they can also be used in other applications, such as other proteins where variable regions are on separate chains, e.g. bispecific antibodies and Fc proteins, or more generally monospecific and/or conventional anti-NKp46 antibodies, for example to bind, modulate and/or detect human and/or non-human primate NKp46 polypeptides, in vivo or in vitro (e.g. in a biological sample).
  • an antigen binding domain that binds both a human and a non-human primate NKp46 polypeptide (e.g. with similar affinity, as assessed for example by surface plasmon resonance and/or by flow cytometry to NKp46-expression cells, by the methods herein).
  • the ABD is capable of binding to a NKp46 polypeptide as a single chain antigen binding domain (e.g. an scFv).
  • the ABD comprises (or is comprised in) an immunoglobulin heavy and light variable region, e.g. wherein the heavy and light chain variable domains are placed on a single polypeptide chain.
  • heavy and light chain variable domains are placed on different polypeptide chains within a multimeric protein.
  • the heavy chain variable region comprises a heavy chain framework region of human origin and the light chain variable region comprises a light chain framework regions of human origin, optionally wherein the heavy and/or light chain framework regions comprise one or more amino acid modifications (e.g. substitution(s), back-mutation(s) in which a residue is substituted by the residue present in the parental (e.g., murine) framework at the position), optionally wherein the amino acid modifications provides or increases binding to a non-human primate NKp46.
  • a protein, an Fc protein, an antibody or an antibody fragment that comprises such an ABD and/or variable regions In one aspect, provided is an isolated and/or recombinant nucleic acid that encodes such an antigen binding domain (ABD).
  • ABS antigen binding domain
  • proteins or polypeptides include, e.g. a single polypeptide chain
  • NKp46-binding domain an ABD that binds human NKp46 placed on a single polypeptide chain, e.g., a polypeptide comprising a VH and VL of the separated by a (poly)peptide linker).
  • the single chain NKp46 binding domain comprises a VH and a VL domain disclosed herein, separated by a peptide linker.
  • the single polypeptide chain may be comprised in a multi-chain polypeptide that comprises one or more further polypeptide chains, or may be isolated as a single polypeptide chain.
  • a protein or polypeptide that comprises an anti-NKp46 ABD is a multimeric protein comprising a first and a second polypeptide chain, wherein one chain comprises a VH domain of an anti-NKp46 ABD disclosed herein and the other chain comprises the VL of an anti-NKp46 ABD disclosed herein, wherein the chains are configured so that the VH and VL form an antigen binding domain that binds NKp46.
  • a protein or polypeptide e.g. a monospecific, bispecific, or multispecific antibody or protein, a scFv, a F(ab) or F(ab) 2 , a multispecific Fc protein
  • the protein nor polypeptide comprises: (a) a heavy chain variable region comprising a human heavy chain framework region (FR1 , FR2, and FR3) derived from a human IGHV1 -69 gene, and heavy chain CDR1 , 2 and 3 of a NKp46-1 antibody; and (b) a light chain variable region comprising a human light chain framework region (FR1 , FR2, and FR3) derived from a human IGKV1 -33 gene, and light chain CDR1 , 2 and 3 of a NKp46- 1 antibody.
  • CDRs as defined by Kabat, Chotia or IMGT numbering the protein or polypeptide binds a wild-type NKp46 polypeptide but has decreased binding to a mutant NKp46 polypeptide having a mutation (e.g., an alanine substitution) any one or more of the residues K41 , E42, E1 19, Y121 and/or Y194 (with reference to SEQ ID NO:1 ) compared to binding to the wild-type NKp46).
  • a mutation e.g., an alanine substitution
  • the heavy chain variable region comprises an amino acid sequence sharing at least 70%, 80%, 90%, 95% or 98% identity with the amino acid sequence of SEQ ID NO: 3, and/or the light chain variable region comprises an amino acid sequence sharing at least 70%, 80%, 90%, 95% or 98% identity with the amino acid sequence of SEQ ID NO: 4.
  • the heavy chain variable region comprises an amino acid sequence of the NKp46-1 H1 or H3 variable domain (or an amino acid sequence sharing at least 80, 90%, 95% or 98% identity therewith) and the light chain variable region comprises an amino acid sequence of the NKp46-1 L1 variable domain (or an amino acid sequence sharing at least 80, 90%, 95% or 98% identity therewith).
  • a protein or polypeptide e.g. a monospecific, bispecific, or multispecific antibody or protein, a scFv, a F(ab) or F(ab) 2 , a multispecific Fc protein
  • the protein nor polypeptide comprises: (a) a heavy chain variable region comprising a human heavy chain framework region (FR1 , FR2, and FR3) derived from a IGHV4-30-4 gene, and heavy chain CDR1 , 2 and 3 of a NKp46-2 antibody; and (b) a light chain variable region comprising a human light chain framework region (FR1 , FR2, and FR3) derived from a IGKV1 -39 gene, and light chain CDR1 , 2 and 3 of a NKp46-2 antibody.
  • the heavy chain variable region comprises an amino acid sequence sharing at least 70%, 80%, 90%, 95% or 98% identity with the amino acid sequence of SEQ ID NO: 5
  • the light chain variable region comprises an amino acid sequence sharing at 70%, 80%, 90%, 95% or 98% identity with the amino acid sequence of SEQ ID NO: 6.
  • the heavy chain variable region comprises an amino acid sequence of the NKp46-2 H1 , H2 or H3 variable domain (or an amino acid sequence sharing at least 80, 90%, 95% or 98% identity therewith) and the light chain variable region comprises an amino acid sequence of the NKp46-2 L1 variable domain(or an amino acid sequence sharing at least 80, 90%, 95% or 98% identity therewith).
  • a protein or polypeptide e.g. a monospecific, bispecific, or multispecific antibody or protein, a scFv, a F(ab) or F(ab) 2 , a multispecific Fc protein
  • the protein nor polypeptide comprises: (a) a heavy chain variable region comprising a human heavy chain framework region (FR1 , FR2, and FR3) derived from a IGHV1 -69 gene, and heavy chain CDR1 , 2 and 3 of a NKp46-3 antibody; and (b) a light chain variable region comprising a human light chain framework region (FR1 , FR2, and FR3) derived from a IGKV3-1 1 and/or a IGKV3-15 gene (e.g.
  • the protein or polypeptide binds a wild-type NKp46 polypeptide but has decreased binding to a mutant NKp46 polypeptide having a mutation (e.g., an alanine substitution) any one or more of the residues P132, E133, 1135, and/or S136 (with reference to SEQ ID NO:1 ) compared to binding to the wild-type NKp46).
  • a mutation e.g., an alanine substitution
  • the heavy chain variable region comprises an amino acid sequence sharing at least 70%, 80%, 90%, 95% or 98% identity with the amino acid sequence of SEQ ID NO: 7, and/or the light chain variable region comprises an amino acid sequence sharing at least 70%, 80%, 90%, 95% or 98% identity with the amino acid sequence of SEQ ID NO: 8.
  • the heavy chain variable region comprises an amino acid sequence of the NKp46-3 H1 , H3 or H4 variable domain (or an amino acid sequence sharing at least 80, 90%, 95% or 98% identity therewith) and the light chain variable region comprises an amino acid sequence of the NKp46-3 L1 variable domain (or an amino acid sequence sharing at least 80, 90%, 95% or 98% identity therewith).
  • a protein or polypeptide e.g. a monospecific, bispecific, or multispecific antibody or protein, a scFv, a F(ab) or F(ab) 2 , a multispecific Fc protein
  • the protein nor polypeptide comprises: (a) a heavy chain variable region comprising a human heavy chain framework region (FR1 , FR2, and FR3) derived from a IGHV1 -46 and/or a IGHV1 -69 gene (e.g.
  • a mosaic variable region comprising both IGHV1 -46 and IGHV1-69 sequences or segments), and heavy chain CDR1 , 2 and 3 of a NKp46-4 antibody; and (b) a light chain variable region comprising a human light chain framework region (FR1 , FR2, and FR3) derived from a IGKV1 -NL1 gene, and light chain CDR1 , 2 and 3 of a NKp46-4 antibody.
  • CDRs as defined by Kabat, Chotia or IMGT numbering.
  • the protein or polypeptide binds a wild-type NKp46 polypeptide but has decreased binding to a mutant NKp46 polypeptide having a mutation (e.g., an alanine substitution) any one or more of the residues R101 , V102, E104 and/or L105 (with reference to SEQ ID NO:1 ) compared to binding to the wild-type NKp46).
  • the heavy chain variable region comprises an amino acid sequence sharing at least 70%, 80%, 90%, 95% or 98% identity with the amino acid sequence of SEQ ID NO: 9
  • the light chain variable region comprises an amino acid sequence sharing at least 70%, 80%, 90%, 95% or 98% identity with the amino acid sequence of SEQ ID NO: 10.
  • the heavy chain variable region comprises an amino acid sequence of the NKp46-4 H 1 variable domain (or an amino acid sequence sharing at least 80, 90%, 95% or 98% identity therewith) and the light chain variable region comprises an amino acid sequence of the NKp46-4 L2 variable domain (or an amino acid sequence sharing at least 80, 90%, 95% or 98% identity therewith).
  • a protein or polypeptide e.g.
  • a monospecific, bispecific, or multispecific antibody or protein a scFv, a F(ab) or F(ab) 2 , a multispecific Fc protein) that binds a human NKp46 polypeptide, optionally that further bind a non-human primate NKp46 polypeptide
  • the protein nor polypeptide comprises: (a) a heavy chain variable region comprising a human heavy chain framework region (FR1 , FR2, FR3) derived from a IGHV4-30-4 gene, and heavy chain CDR1 , 2 and 3 of a NKp46-9 antibody; and (b) a light chain variable region comprising a human light chain framework region (FR1 , FR2, FR3) derived from a IGKV1 -39 gene, and light chain CDR1 , 2 and 3 of a NKp46-9 antibody.
  • the heavy chain variable region comprises an amino acid sequence sharing at least 70%, 80%, 90%, 95% or 98% identity with the amino acid sequence of SEQ ID NO: 13, and/or the light chain variable region comprises an amino acid sequence sharing at least 70%, 80%, 90%, 95% or 98% identity with the amino acid sequence of SEQ ID NO: 14.
  • the heavy chain variable region comprises an amino acid sequence of the NKp46-9 H2 variable domain (or an amino acid sequence sharing at least 80, 90%, 95% or 98% identity therewith) and the light chain variable region comprises an amino acid sequence of the NKp46-9 L1 or L2 variable domain (or an amino acid sequence sharing at least 80, 90%, 95% or 98% identity therewith).
  • the heavy chain variable region comprises an amino acid sequence of the NKp46-9 H3 variable domain (or an amino acid sequence sharing at least 80, 90%, 95% or 98% identity therewith) and the light chain variable region comprises an amino acid sequence of the NKp46-9 L1 or L2 variable domain (or an amino acid sequence sharing at least 80, 90%, 95% or 98% identity therewith).
  • an antigen binding domain comprising a heavy chain variable region (VH) and a light chain variable region (VL) each containing human FR1 , 2 and 3 framework regions, or a protein or polypeptide comprising such ABD (e.g. a monoclonal antibody, an scFv, a multispecific polypeptide, a bispecific antibody, a DART® or BiTe® or protein comprising such, etc.) that binds a human and a non-human primate NKp46 polypeptide, e.g. a cell surface NKp46 polypeptide, wherein the protein or polypeptide comprises a VH and VL combination selected from the group consisting of:
  • VH comprising an amino acid sequence at least 70%, 80%, 90%, 95% or 98%
  • VH comprising an amino acid sequence at least 70%, 80%, 90%, 95% or 98% (or 100%) identical to the amino acid sequence of the NKp46-3 H1 , H3 or H4 variable domain shown in SEQ ID NOS: 206, 207 or 208, respectively, and a VL comprising an amino acid sequence at least 70%, 80%, 90%, 95% or 98% identical to the amino acid sequence of the NKp46-3 L1 variable domain shown in SEQ ID NO: 209;
  • VH comprising an amino acid sequence at least 70%, 80%, 90%, 95% or 98% (or 100%) identical to the amino acid sequence of the NKp46-4 H1 , H2 or H3 variable domain shown in SEQ ID NOS: 210, 21 1 or 212, and a VL comprising an amino acid sequence at least 70%, 80%, 90%, 95% or 98% identical to the amino acid sequence of the NKp46-4 L2 variable domain shown in SEQ ID NO: 213;
  • VH comprising an amino acid sequence at least 70%, 80%, 90%, 95% or 98% (or 100%) identical to the amino acid sequence of the NKp46-9 H2 variable domain shown in SEQ ID NO: 215, and a VL comprising an amino acid sequence at least 70%, 80%, 90%, 95% or 98% identical to the amino acid sequence of the NKp46-9 L1 or L2 variable domain shown in SEQ ID NOS: 217 or 218, respectively;
  • VH comprising an amino acid sequence at least 70%, 80%, 90%, 95% or 98% (or 100%) identical to the amino acid sequence of the NKp46-9 H3 variable domain shown in SEQ ID NO: 215, and a VL comprising an amino acid sequence at least 70%, 80%, 90%, 95% or 98% identical to the amino acid sequence of the NKp46-9 L1 or L2 variable domain shown in SEQ ID NOS: 217 or 218, respectively.
  • an antigen binding domain comprising a heavy chain variable region (VH) and a light chain variable region (VL) each containing human FR1 , 2 and 3 framework regions, or a protein or polypeptide comprising such ABD that binds a human and a non-human primate NKp46 polypeptide, wherein the protein or polypeptide comprises a VH and VL combination selected from the group consisting of:
  • a VH comprising a CDR1 , 2 and 3 of the VH domain having the amino acid sequence shown in SEQ ID NO: 3 and a FR1 , 2 and 3 of a human IGHV1 -69 gene segment, and a VL comprising a CDR1 , 2 and 3 of the VL domain having the amino acid sequence shown in SEQ ID NO: 4 and a FR1 , 2 and 3 of a human IGKV1 -33 gene segment;
  • a VH comprising a CDR1, 2 and 3 of the VH domain having the amino acid sequence shown in SEQ ID NO: 5 and a FR1, 2 and 3 of a human IGHV4-30-4 gene segment, and a VL comprising a CDR1, 2 and 3 of the VL domain having the amino acid sequence shown in SEQ ID NO: 6 and a FR1 , 2 and 3 of a human IGKV1-39 gene segment;
  • VH comprising a CDR1, 2 and 3 of the VH domain having the amino acid sequence shown in SEQ ID NO: 7 and a FR1 , 2 and 3 of a human IGHV1-69 gene segment, and a VL comprising a CDR1, 2 and 3 of the VL domain having the amino acid sequence shown in SEQ ID NO: 8 and a FR1, 2 and 3 of a human IGKV3-11 and/or IGKV3-15 gene segment;
  • VH comprising a CDR1, 2 and 3 of the VH domain having the amino acid sequence shown in SEQ ID NO: 9 and a FR1, 2 and 3 of a human IGHV1-46 and/or a IGHV1-69 gene segment, and a VL comprising a CDR1, 2 and 3 of the VL domain having the amino acid sequence shown in SEQ ID NO: 10 and a FR1, 2 and 3 of a human IGKV1- NL1 gene segment;
  • VH comprising a CDR1, 2 and 3 of the VH domain having the amino acid sequence shown in SEQ ID NO: 13 and a FR1, 2 and 3 of a human IGHV4-30-4 gene segment
  • VL comprising a CDR1, 2 and 3 of the VL domain having the amino acid sequence shown in SEQ ID NO: 14 and a FR1, 2 and 3 of a human IGKV1-39 gene segment.
  • an antigen binding domain may comprise a VH and a VL comprising an amino acid sequence at least 80%, 90%, 95% or 98% (or 100%) identical to the respective VH and VL of any one of antibodies: NKp46-1 H1L1, NKp46-1 H3L1, NKp46-2 H1L1, NKp46-2 H2L1, NKp46-2 H3L1, NKp46-3 H1L1, NKp46-3 H3L1, NKp46-3 H4L1, NKp46-4 H1L2, NKp46-4 H2L2, NKp46-4 H3L2, NKp46-9 H2L1, NKp46-9 H2L2, NKp46-9 H3L1 or NKp46-9 H3L2.
  • an antigen binding domain comprising a heavy chain variable region (VH) and a light chain variable region (VL) each containing human FR1, 2 and 3 framework regions, or a protein or polypeptide (e.g., an antibody, multispecific protein) comprising such ABD that binds a NKp46 polypeptide, wherein the protein or polypeptide comprising an amino acid sequence at least 80%, 90%, 95% or 98% (or 100%) identical to the respective VH and VL of any one of antibodies: NKp46-1 H1L1, NKp46-1 H3L1, NKp46- 2 H1L1, NKp46-2 H2L1, NKp46-2 H3L1, NKp46-3 H1L1, NKp46-3 H3L1, NKp46-3 H4L1, NKp46-4 H1L2, NKp46-4 H2L2, NKp46-4 H3L2, NKp46-9 H2L1, NKp46-9 H2L2, NKp46-9 H2L2,
  • a NKp46-1 VL can comprising an amino acid substitution at Kabat position 87, optionally wherein the residue at position 87 is a phenylalanine.
  • a NKp46-1 VH can comprise an amino acid substitution at Kabat residues 27, 66 and/or 67, optionally further a substitution at Kabat residues 37, 48 and/or 91.
  • the residue present at the particular position is the residue substituted at the position herein, e.g., as shown in Example 1.
  • a NKp46-2 VL can comprise an amino acid substitution at Kabat position 48, optionally wherein the residue at position 48 is a valine.
  • a NKp46-2 VH can comprise an amino acid substitution at Kabat residues 27 and/or 71 , optionally further a substitution at Kabat residues 48 and/or 67, optionally further a substitution at Kabat residue 31.
  • the residue present at the particular position is the residue substituted at the position herein, e.g., as shown in Example 1.
  • a NKp46-3 VL can comprise an amino acid substitution at Kabat position 49, optionally wherein the residue at position 49 is a lysine.
  • a NKp46-3 VH can comprise an amino acid substitution at Kabat residue 27, optionally further a substitution at Kabat residues 48 and/or 67, optionally further a substitution at Kabat residue 69.
  • the residue present at the particular position is the residue substituted at the position herein, e.g., as shown in Example 1.
  • a NKp46-4 VL can comprise an amino acid substitution at Kabat position 36 and/or 48, optionally wherein the residue at position 36 is a phenylalanine, optionally wherein the residue at position 48 is a valine.
  • a NKp46-4 VH can comprise an amino acid substitution at Kabat residues 30, 48 and/or 93, optionally further a substitution at Kabat residue 67, optionally further a substitution at Kabat residue 69.
  • the residue present at the particular position is the residue substituted at the position herein, e.g., as shown in Example 1.
  • a NKp46-9 VL can comprise an amino acid substitution at Kabat position 36, optionally wherein the residue at position 36 is a cysteine, optionally further a substitution at Kabat residue 48, optionally wherein the residue at position 48 is a valine.
  • a NKp46-9 VH can comprise an amino acid substitution at Kabat residue 71 , optionally further a substitution at Kabat residue 27, optionally further a substitution at Kabat residue 48 and/or 67.
  • the residue present at the particular position is the residue substituted at the position herein, e.g., as shown in Example 1.
  • the protein or polypeptide binds NKp46 in monovalent manner.
  • the protein or polypeptide comprises or contains no more than one antigen binding domain that binds NKp46.
  • the protein or polypeptide comprises a human Fc domain or a portion thereof, wherein the Fc domain or portion thereof is capable of binding to human neonatal Fc receptor (FcRn) and to human CD16 polypeptide. Because FcyRllla (CD16) is not present on all NK cells, conventional therapeutic antibodies (e.g.
  • NKp46 + CD16 NK cells as well as NKp46 + CD16 + NK cells.
  • the protein or polypeptide comprises a human Fc domain or a portion thereof, wherein the Fc domain or a portion thereof is capable of binding to human neonatal Fc receptor (FcRn) and lacks binding to human CD16 polypeptide.
  • FcRn human neonatal Fc receptor
  • the protein or polypeptide is a single chain polypeptide. In one embodiment, the protein or polypeptide is a multimeric polypeptide, optionally a dimeric, trimeric or tetrameric protein.
  • a multi-specific protein can bind (i) to antigen of interest on target cells and (ii) to NKp46 on NK cells, and, when bound to both antigen of interest on target cells and NKp46, can induce signaling in and/or activation of the NK cells through NKp46 (the protein acts as an NKp46 agonist), thereby promoting activation of NK cells and/or lysis of target cells, notably via the activating signal transmitted by NKp46.
  • the multi- specific comprises a single antigen binding domain that binds NKp46 (the protein binds to NKp46 in monovalent fashion).
  • the protein is capable of, when bound to both antigen of interest on target cells and NKp46 on NK cells, inducing signaling in the NK cells through NKp46.
  • the protein comprises a first antigen binding domain and a second antigen binding domain, wherein one of the first or second antigen binding domains binds to a human NKp46 polypeptide and the other of the first or second antigen binding domains binds an antigen of interest expressed on a target cell.
  • a multispecific protein is monomeric.
  • a multispecific protein is a dimer, e.g. a heterodimer, trimer or tetramer.
  • the protein is a heterodimer, heterotrimer or a tetramer comprising a first polypeptide chain comprising a VH and a VL domain of an ABD that binds NKp46 (a VH and VL disclosed herein) separated by a linker peptide, and optionally an Fc domain, and a second polypeptide chain comprising one or more variable regions or antigen binding domains that bind an antigen of interest, and optionally an Fc domain.
  • both a first and a second polypeptide chain comprise an Fc domain
  • the protein comprises a dimeric Fc domain, optionally wherein the Fc domain is capable of binding to human CD16.
  • the monomeric or dimeric protein comprises a protein with a domain structure in which an Fc domain is interposed between the antigen binding domain (ABD) that binds to NKp46 and the antigen binding domain that binds an antigen of interest.
  • the multispecific Fc-derived polypeptide is a bispecific antibody.
  • the antigen binding domain of a multispecific protein that binds to an antigen of interest binds to an antigen (e.g. polypeptide) expressed by a target cell which sought to be lysed by an NK cell.
  • an antigen e.g. polypeptide
  • such an antigen is expressed by a cancer cell, a tumor associated immune cell (e.g. an immune suppressor or regulatory cell), a virally infected cell, or a cell that contributes to an autoimmunity or inflammatory disease.
  • the antigen of interest is a cancer antigen known to be capable of undergoing intracellular internalization when contacted with a full length human lgG1 antibody that binds specifically thereto.
  • a recombinant nucleic acid encoding a VH and/or a VL, an antibody heavy and/or light chain, a single chain antigen binding domain, a first, second, third or further polypeptide chain of any of the proteins of the disclosure.
  • a recombinant host cell comprising a nucleic acid of the disclosure.
  • any of the methods can further be characterized as comprising any step described in the application, including notably in the "Detailed Description of the Invention").
  • the invention further relates to methods of identifying, testing and/or making proteins described herein.
  • the invention further relates to a multispecific protein obtainable by any of present methods.
  • the disclosure further relates to pharmaceutical or diagnostic formulations of the multispecific protein disclosed herein.
  • the disclosure further relates to methods of using the multispecific protein in methods of treatment or diagnosis.
  • Figure 1 shows that Anti-CD19-F1 -Anti-CD3 does not cause T/B cell aggregation in the presence of B221 (CD19) or JURKAT (CD3) cell lines when separate, but it does cause aggregation of cells when both B221 and JURKAT cells are co-incubated.
  • FIGS. 2A to 2F show different domain arrangements of bispecific proteins produced.
  • Figures 3A and 3B show respectively bispecific F1 and F2 antibodies having NKp46 binding region based on NKp46-1 , NKp46-2, NKp46-3 or NKp46-4 are able to direct resting NK cells to their CD19-positive Daudi tumor target cells, while isotype control antibody did not lead to elimination of the Daudi cells.
  • Rituximab (RTX) served as positive control of ADCC, where the maximal response obtained with RTX (at 10 ⁇ g/ml in this assay) was 21.6% specific lysis.
  • Figure 4A shows bispecific antibodies having NKp46 and CD19 binding regions in an F2 format protein do not activate resting NK cells in the absence of target cells, however full length anti-NKp46 antibodies as well as positive control alemtuzumab did activate NK cells.
  • Figure 4B shows that in presence of Daudi target cells, bispecific anti-NKp46 x anti-CD19 antibodies (including each of the NKp46-1 , NKp46- 2, NKp46-3 or NKp46-4 binding domains) activated resting NK cells (top panel CD107, bottom panel CD69), while full-length anti-CD19 showed at best only very low activation of NK cells.
  • FIG. 4C shows that in the presence of CD19-negative HUT78 cells, none of the bispecific anti-NKp46 x anti-CD19 antibody (including each of the NKp46- 1 , NKp46-2, NKp46-3 or NKp46-4 variable regions) activated NK cells.
  • the full- length anti-NKp46 antibodies and alemtuzumab caused detectable activation of NK cells at a similar level observed in presence of NK cells alone. Isotype control antibody did not induce activation.
  • Figures 5A and 5B show that at low effectontarget ratio of 1 :1 each of the bispecific anti-NKp46 x anti-CD19 antibody activated NK cells in the presence of Daudi cells, and that bispecific anti-NKp46 x anti-CD19 were far more potent than the anti-CD19 antibody as a full-length human lgG1 as ADCC inducing antibody.
  • Top panel is CD107 (Figure 5A) and bottom panel shows CD69 ( Figure 5B).
  • Figures 6A and 6B show that each NKp46 x CD19 bispecific protein (single chain format F3, and multimeric formats F5 and F6) induced specific lysis of Daudi ( Figure 6A) or B221 ( Figure 6B) cells by human KHYG-1 CD16-negative hNKp46-positive NK cell line, while rituximab and human lgG1 isotype control (IC) antibodies did not.
  • Figure 7 shows the NKp46 x CD19 bispecific protein in F5 format whose Fc domain binds CD16 is far more potent in mediating Daudi target cell lysis that the full-length lgG1 anti-CD19 antibody or the F6 format bispecific protein.
  • the bispecific anti-CD19 in F6 format whose Fc domain does not bind CD16 was as potent in mediating NK cell lysis of Daudi target cells as the full-length lgG1 anti-CD19 antibody, which is remarkable considering that the control lgG1 anti-CD19 antibody binds CD19 bivalently.
  • the term "antigen binding domain” refers to a domain comprising a three-dimensional structure capable of immunospecifically binding to an epitope.
  • said domain can comprise a hypervariable region, optionally a VH and/or VL domain of an antibody chain, optionally at least a VH domain.
  • the binding domain may comprise at least one complementarity determining region (CDR) of an antibody chain.
  • the binding domain may comprise a polypeptide domain from a non-immunoglobulin scaffold.
  • antibody herein is used in the broadest sense and specifically includes full-length monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments and derivatives, so long as they exhibit the desired biological activity.
  • Various techniques relevant to the production of antibodies are provided in, e.g., Harlow, et al., ANTIBODIES: A LABORATORY MANUAL, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., (1988).
  • An “antibody fragment” comprises a portion of a full-length antibody, e.g. antigen-binding or variable regions thereof.
  • antibody fragments include Fab, Fab', F(ab) 2 , F(ab') 2 , F(ab) 3 , Fv (typically the VL and VH domains of a single arm of an antibody), single-chain Fv (scFv), dsFv, Fd fragments (typically the VH and CH1 domain), and dAb (typically a VH domain) fragments; VH, VL, VhH, and V-NAR domains; minibodies, diabodies, triabodies, tetrabodies, and kappa bodies (see, e.g., Ill et al., Protein Eng 1997;10: 949-57); camel IgG; IgNAR; and multispecific antibody fragments formed from antibody fragments, and one or more isolated CDRs or a functional paratope, where isolated CDRs or antigen-binding residues or polypeptides can be associated or linked together so as to form a functional antibody fragment.
  • Fv
  • antibody derivative comprises a full-length antibody or a fragment of an antibody, e.g. comprising at least antigen-binding or variable regions thereof, wherein one or more of the amino acids are chemically modified, e.g., by alkylation, PEGylation, acylation, ester formation or amide formation or the like. This includes, but is not limited to, PEGylated antibodies, cysteine-PEGylated antibodies, and variants thereof.
  • hypervariable region when used herein refers to the amino acid residues of an antibody that are responsible for antigen binding.
  • the hypervariable region generally comprises amino acid residues from a "complementarity-determining region" or "CDR" (e.g.
  • the numbering of amino acid residues in this region is performed by the method described in Kabat et al., supra.
  • Phrases such as "Kabat position”, “variable domain residue numbering as in Kabat” and “according to Kabat” herein refer to this numbering system for heavy chain variable domains or light chain variable domains.
  • the actual linear amino acid sequence of a peptide may contain fewer or additional amino acids corresponding to a shortening of, or insertion into, a FR or CDR of the variable domain.
  • a heavy chain variable domain may include a single amino acid insert (residue 52a according to Kabat) after residue 52 of CDR H2 and inserted residues (e.g.
  • residues 82a, 82b, and 82c, etc. according to Kabat after heavy chain FR residue 82.
  • the Kabat numbering of residues may be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a "standard" Kabat numbered sequence.
  • frame or "FR” residues as used herein is meant the region of an antibody variable domain exclusive of those regions defined as CDRs.
  • Each antibody variable domain framework can be further subdivided into the contiguous regions separated by the CDRs (FR1 , FR2, FR3 and FR4).
  • constant region as defined herein is meant an antibody-derived constant region that is encoded by one of the light or heavy chain immunoglobulin constant region genes.
  • constant light chain or “light chain constant region” as used herein is meant the region of an antibody encoded by the kappa (Ckappa) or lambda (Clambda) light chains.
  • the constant light chain typically comprises a single domain, and as defined herein refers to positions 108-214 of Ckappa, or Clambda, wherein numbering is according to the EU index (Kabat et al., 1991 , Sequences of Proteins of Immunological Interest, 5th Ed., United States Public Health Service, National Institutes of Health, Bethesda).
  • constant heavy chain or “heavy chain constant region” as used herein is meant the region of an antibody encoded by the mu, delta, gamma, alpha, or epsilon genes to define the antibody's isotype as IgM, IgD, IgG, IgA, or IgE, respectively.
  • the constant heavy chain as defined herein, refers to the N-terminus of the CH1 domain to the C-terminus of the CH3 domain, thus comprising positions 1 18-447, wherein numbering is according to the EU index.
  • Fab or "Fab region” as used herein is meant the polypeptide that comprises the VH, CH1 , VL, and CL immunoglobulin domains. Fab may refer to this region in isolation, or this region in the context of a polypeptide, multispecific polypeptide or ABD, or any other embodiments as outlined herein.
  • single-chain Fv or “scFv” as used herein are meant antibody fragments comprising the VH and VL domains of an antibody, wherein these domains are present in a single polypeptide chain.
  • the Fv polypeptide further comprises a polypeptide linker between the VH and VL domains which enables the scFv to form the desired structure for antigen binding.
  • Methods for producing scFvs are well known in the art. For a review of methods for producing scFvs see Pluckthun in The Pharmacology of Monoclonal Antibodies, vol. 1 13, Rosenburg and Moore eds. Springer-Verlag, New York, pp. 269-315 (1994).
  • Fv or “Fv fragment” or “Fv region” as used herein is meant a polypeptide that comprises the VL and VH domains of a single antibody.
  • Fc or “Fc region”, as used herein is meant the polypeptide comprising the constant region of an antibody excluding the first constant region immunoglobulin domain.
  • Fc refers to the last two constant region immunoglobulin domains of IgA, IgD, and IgG, and the last three constant region immunoglobulin domains of IgE and IgM, and the flexible hinge N-terminal to these domains.
  • IgA and IgM Fc may include the J chain.
  • Fc comprises immunoglobulin domains Cv2 (CH2) and Cy3 (CH3) and the hinge between Cy1 and Cv2.
  • Fc region may vary, the human IgG heavy chain Fc region is usually defined to comprise residues at least C226, P230 or A231 to its carboxyl- terminus, wherein the numbering is according to the EU index.
  • Fc may refer to this region in isolation, or this region in the context of an Fc polypeptide, as described below.
  • Fc polypeptide or “Fc-derived polypeptide” as used herein is meant a polypeptide that comprises all or part of an Fc region.
  • Fc polypeptides include but is not limited to antibodies, Fc fusions and Fc fragments.
  • variable region as used herein is meant the region of an antibody that comprises one or more Ig domains substantially encoded by any of the VL (including Vkappa (VK) and Vlambda) and/or VH genes that make up the light chain (including kappa and lambda) and heavy chain immunoglobulin genetic loci respectively.
  • VL or VH consists of a "framework” or “FR” region interrupted by three hypervariable regions referred to as “complementarity determining regions” or "CDRs". The extent of the framework region and CDRs have been precisely defined, for example as in Kabat (see “Sequences of Proteins of Immunological Interest," E.
  • the framework regions of an antibody that is the combined framework regions of the constituent light and heavy chains, serves to position and align the CDRs, which are primarily responsible for binding to an antigen.
  • the term "specifically binds to” means that an antibody or polypeptide can bind preferably in a competitive binding assay to the binding partner, e.g. NKp46, as assessed using either recombinant forms of the proteins, epitopes therein, or native proteins present on the surface of isolated target cells.
  • a competitive binding assay to the binding partner, e.g. NKp46, as assessed using either recombinant forms of the proteins, epitopes therein, or native proteins present on the surface of isolated target cells.
  • an antibody or polypeptide When an antibody or polypeptide is said to "compete with" a particular monoclonal antibody (e.g. NKp46-1 , -2, -4, -6 or -9 in the context of an anti-NKp46 mono- or bi-specific antibody), it means that the antibody or polypeptide competes with the monoclonal antibody in a binding assay using either recombinant target (e.g. NKp46) molecules or surface expressed target (e.g. NKp46) molecules.
  • a particular monoclonal antibody e.g. NKp46-1 , -2, -4, -6 or -9 in the context of an anti-NKp46 mono- or bi-specific antibody
  • test antibody reduces the binding of NKp46-1 , -2, -4, -6 or -9 to a NKp46 polypeptide or NKp46-expressing cell in a binding assay, the antibody is said to "compete” respectively with NKp46-1 , -2, -4, -6 or -9.
  • affinity means the strength of the binding of an antibody or polypeptide to an epitope.
  • the affinity of an antibody is given by the dissociation constant K D , defined as [Ab] x [Ag] / [Ab-Ag], where [Ab-Ag] is the molar concentration of the antibody-antigen complex, [Ab] is the molar concentration of the unbound antibody and [Ag] is the molar concentration of the unbound antigen.
  • K D dissociation constant
  • a “determinant” designates a site of interaction or binding on a polypeptide.
  • epitope refers to an antigenic determinant, and is the area or region on an antigen to which an antibody or polypeptide binds.
  • a protein epitope may comprise amino acid residues directly involved in the binding as well as amino acid residues which are effectively blocked by the specific antigen binding antibody or peptide, i.e. , amino acid residues within the "footprint” of the antibody. It is the simplest form or smallest structural area on a complex antigen molecule that can combine with e.g., an antibody or a receptor.
  • Epitopes can be linear or conformational/structural.
  • linear epitope is defined as an epitope composed of amino acid residues that are contiguous on the linear sequence of amino acids (primary structure).
  • conformational or structural epitope is defined as an epitope composed of amino acid residues that are not all contiguous and thus represent separated parts of the linear sequence of amino acids that are brought into proximity to one another by folding of the molecule (secondary, tertiary and/or quaternary structures).
  • a conformational epitope is dependent on the 3-dimensional structure.
  • 'conformational' is therefore often used interchangeably with 'structural'.
  • amino acid modification herein is meant an amino acid substitution, insertion, and/or deletion in a polypeptide sequence.
  • An example of amino acid modification herein is a substitution.
  • amino acid modification herein is meant an amino acid substitution, insertion, and/or deletion in a polypeptide sequence.
  • amino acid substitution or “substitution” herein is meant the replacement of an amino acid at a given position in a protein sequence with another amino acid.
  • substitution Y50W refers to a variant of a parent polypeptide, in which the tyrosine at position 50 is replaced with tryptophan.
  • a “variant" of a polypeptide refers to a polypeptide having an amino acid sequence that is substantially identical to a reference polypeptide, typically a native or “parent” polypeptide.
  • the polypeptide variant may possess one or more amino acid substitutions, deletions, and/or insertions at certain positions within the native amino acid sequence.
  • Constant amino acid substitutions are those in which an amino acid residue is replaced with an amino acid residue having a side chain with similar physicochemical properties. Families of amino acid residues having similar side chains are known in the art, and include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine), beta- branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine
  • identity refers to the degree of sequence relatedness between polypeptides, as determined by the number of matches between strings of two or more amino acid residues. "Identity” measures the percent of identical matches between the smaller of two or more sequences with gap alignments (if any) addressed by a particular mathematical model or computer program (i.e., "algorithms”). Identity of related polypeptides can be readily calculated by known methods. Such methods include, but are not limited to, those described in Computational Molecular Biology, Lesk, A. M., ed., Oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smith, D.
  • Preferred methods for determining identity are designed to give the largest match between the sequences tested. Methods of determining identity are described in publicly available computer programs. Preferred computer program methods for determining identity between two sequences include the GCG program package, including GAP (Devereux et al., Nucl. Acid. Res. 12, 387 (1984); Genetics Computer Group, University of Wisconsin, Madison, Wis.), BLASTP, BLASTN, and FASTA (Altschul et al., J. Mol. Biol. 215, 403-410 (1990)). The BLASTX program is publicly available from the National Center for Biotechnology Information (NCBI) and other sources (BLAST Manual, Altschul et al. NCB/NLM/NIH Bethesda, Md. 20894; Altschul et al., supra). The well known Smith Waterman algorithm may also be used to determine identity.
  • NCBI National Center for Biotechnology Information
  • an "isolated" molecule is a molecule that is the predominant species in the composition wherein it is found with respect to the class of molecules to which it belongs (i.e., it makes up at least about 50% of the type of molecule in the composition and typically will make up at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or more of the species of molecule, e.g., peptide, in the composition).
  • a composition of a polypeptide will exhibit 98%, 98%, or 99% homogeneity for polypeptides in the context of all present peptide species in the composition or at least with respect to substantially active peptide species in the context of proposed use.
  • treatment refers to preventing, alleviating, managing, curing or reducing one or more symptoms or clinically relevant manifestations of a disease or disorder, unless contradicted by context.
  • treatment of a patient in whom no symptoms or clinically relevant manifestations of a disease or disorder have been identified is preventive or prophylactic therapy, whereas "treatment” of a patient in whom symptoms or clinically relevant manifestations of a disease or disorder have been identified generally does not constitute preventive or prophylactic therapy.
  • NK cells refers to a sub-population of lymphocytes that is involved in non-conventional immunity.
  • NK cells can be identified by virtue of certain characteristics and biological properties, such as the expression of specific surface antigens including CD56 and/or NKp46 for human NK cells, the absence of the alpha/beta or gamma/delta TCR complex on the cell surface, the ability to bind to and kill cells that fail to express "self" MHC/HLA antigens by the activation of specific cytolytic machinery, the ability to kill tumor cells or other diseased cells that express a ligand for NK activating receptors, and the ability to release protein molecules called cytokines that stimulate or inhibit the immune response.
  • NK cells any of these characteristics and activities can be used to identify NK cells, using methods well known in the art. Any subpopulation of NK cells will also be encompassed by the term NK cells.
  • active NK cells designate biologically active NK cells, including NK cells having the capacity of lysing target cells or enhancing the immune function of other cells.
  • NK cells can be obtained by various techniques known in the art, such as isolation from blood samples, cytapheresis, tissue or cell collections, etc.
  • Useful protocols for assays involving NK cells can be found in Natural Killer Cells Protocols (edited by Campbell KS and Colonna M). Human Press, pp. 219-238 (2000).
  • intracellular internalization refers to the molecular, biochemical and cellular events associated with the process of translocating a molecule from the extracellular surface of a cell to the intracellular surface of a cell.
  • the processes responsible for intracellular internalization of molecules are well-known and can involve, inter alia, the internalization of extracellular molecules (such as hormones, antibodies, and small organic molecules); membrane-associated molecules (such as cell- surface receptors); and complexes of membrane-associated molecules bound to extracellular molecules (for example, a ligand bound to a transmembrane receptor or an antibody bound to a membrane-associated molecule).
  • extracellular molecules such as hormones, antibodies, and small organic molecules
  • membrane-associated molecules such as cell- surface receptors
  • complexes of membrane-associated molecules bound to extracellular molecules for example, a ligand bound to a transmembrane receptor or an antibody bound to a membrane-associated molecule.
  • Nkp46 signaling refers to an ability of a NKp46 polypeptide to activate or transduce an intracellular signaling pathway. Changes in NKp46 signaling activity can be measured, for example, by assays designed to measure changes in NKp46 signaling pathways, e.g.
  • reporter genes can be naturally occurring genes (e.g. monitoring cytokine production) or they can be genes artificially introduced into a cell. Other genes can be placed under the control of such regulatory elements and thus serve to report the level of NKp46 signaling.
  • NKp46 refers to a protein or polypeptide encoded by the Ncr1 gene or by a cDNA prepared from such a gene. Any naturally occurring isoform, allele or variant is encompassed by the term NKp46 polypeptide (e.g., an NKp46 polypeptide 90%, 95%, 98% or 99% identical to SEQ ID NO 1 , or a contiguous sequence of at least 20, 30, 50, 100 or 200 amino acid residues thereof).
  • the 304 amino acid residue sequence of human NKp46 (isoform a) is shown as follows:
  • SEQ ID NO: 1 corresponds to NCBI accession number NP_004820, the disclosure of which is incorporated herein by reference.
  • the human NKp46 mRNA sequence is described in NCBI accession number NM_004829, the disclosure of which is incorporated herein by reference.
  • the amino acid residue sequence of the extracellular domain of the macaca fascicularis (cynomolgus) NKp46 polypeptide is shown as follows:
  • the anti-NKp46 antigen binding domains bind an extra-cellular portion of human NKp46 polypeptide.
  • the protein that comprises a VH and VL of the disclosure is a humanized antibody or comprises an antigen binding fragment thereof.
  • the antibody comprises a constant domain selected from a human lgG1 , lgG2, lgG3 and lgG4 constant domain, optionally comprising one or more amino acid modifications.
  • anti-NKp46 antibody comprises an antibody fragment selected from a Fab fragment, a Fab' fragment, a Fab'-SH fragment, a F(ab)2 fragment, a F(ab')2 fragment, an Fv fragment, a Heavy chain Ig (a llama or camel Ig), a V H H fragment, a single domain FV, and a single-chain antibody fragment.
  • the anti-NKp46 antibody comprises a synthetic or semisynthetic antibody-derived molecule selected from a scFV, a dsFV, a minibody, a diabody, a triabody, a kappa body, an IgNAR; and a multispecific antibody.
  • the agent can optionally further comprise an Fc domain.
  • the antibody is in at least partially purified form. In one aspect, the antibody is in essentially isolated form.
  • Antibodies may be produced by a variety of techniques known in the art.
  • Immunological screening assays in which antibody competition can be assessed can be used to select for antibodies that will bind the same epitope on NKp46 as antigen binding domains herein can be assessed, e.g. as described in for example, in PCT application number PCT/EP2016/064537, filed 23 June 2016 (Innate Pharma), the disclosure of which is incorporated herein by reference.
  • an anti-NKp46 antibody or NKp46 binding protein has an affinity for a NKp46 polypeptide (e.g., a NKp46 polypeptide as produced in the Examples herein) in the range of about 10 4 to about 10 11 M "1 (e.g., about 10 8 to about 10 10 M "1 ).
  • a NKp46 polypeptide e.g., a NKp46 polypeptide as produced in the Examples herein
  • the disclosure provides Anti-NKp46 antibody or NKp46 binding protein that has an average disassociation constant (K D ) of less than 1 x 10 "9 M with respect to NKp46, as determined by, e.g., surface plasmon resonance (SPR) screening (such as by analysis with a BIAcoreTM SPR analytical device).
  • K D average disassociation constant
  • the disclosure provides anti-NKp46 antibodies or NKp46 binding proteins that have a KD of about 1 x 10 "8 M to about 1 x 10 "10 M, or about 1 x 10 "9 M to about 1 x 10 "11 M, for human or cynomolgus NKp46 protein.
  • the NKp46 antibodies or NKp46 binding proteins have a disassociation constant (K D ) for human and cynomolgus NKp46 protein that differs by no more than 1 - or 2-log.
  • Antibodies or NKp46 binding proteins can be characterized for example by a mean KD of no more than about (i.e. better affinity than) 100, 60, 10, 5, or 1 nanomolar, preferably sub-nanomolar or optionally no more than about 500, 200, 100 or 10 picomolar.
  • KD can be determined for example for example by immobilizing recombinantly produced human NKp46 proteins on a chip surface, followed by application of the antibody to be tested in solution.
  • DNA encoding an antibody or other NKp46 binding proteins that binds an epitope present on NKp46 polypeptides is isolated and placed in an appropriate expression vector for transfection into an appropriate host. The host is then used for the recombinant production of the antibody or other NKp46 binding proteins.
  • DNA can be placed into expression vectors, which are then transfected into host cells such as E. coli cells, simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of the desired proteins in the recombinant host cells.
  • the proteins and antibodies herein bind the D1 domain of NKp46, the D2 domain of NKp46, or to a region spanning both the D1 and D2 domains (at the border of the D1 and D2 domains, the D1/D2 junction), of the NKp46 polypeptide of SEQ ID NO: 1.
  • the proteins or antibodies have an affinity for human NKp46 characterized by a K D of less than 10 "8 M, less than 10 "9 M, or less than 10 "10 M.
  • the proteins or antibodies bind NKp46 at substantially the same epitope on NKp46 as antibody NKp46-1 , NKp46-2, NKp46-3 or NKp46-4.
  • the antibodies at least partially overlaps, or includes at least one residue in the segment bound by NKp46-1 , NKp46-2, NKp46-3 or NKp46-4.
  • all key residues of the epitope are in a segment corresponding to domain D1 or D2.
  • the antibody binds a residue present in the D1 domain as well as a residue present in in the D2 domain.
  • the antibodies or proteins bind an epitope comprising 1 , 2, 3, 4, 5, 6, 7 or more residues in the segment corresponding to domain D1 or D2 of the NKp46 polypeptide of SEQ ID NO: 1 .
  • the antibodies or proteins bind domain D1 and bind an epitope comprising 1 , 2, 3, or 4 of the residues R101 , V102, E104 and/or L105.
  • the antibodies or proteins bind domain D1/D2 junction and bind an epitope comprising 1 , 2, 3, 4 or 5 of the residues K41 , E42, E1 19, Y121 and/or Y194.
  • the antibodies bind domain D2 and bind an epitope comprising 1 , 2, 3, or 4 of the residues P132, E133, 1135, and/or S136.
  • NKp46 polypeptides Binding of anti-NKp46 antibody or proteins to cells transfected with the NKp46 mutants was measured and compared to the ability of anti-NKp46 antibody or protein to bind wild-type NKp46 polypeptide (SEQ ID NO:1 ).
  • a reduction in binding between an anti- NKp46 antibody or protein and a mutant NKp46 polypeptide as used herein means that there is a reduction in binding affinity (e.g., as measured by known methods such FACS testing of cells expressing a particular mutant, or by Biacore testing of binding to mutant polypeptides) and/or a reduction in the total binding capacity of the anti-NKp46 antibody or protein (e.g., as evidenced by a decrease in Bmax in a plot of anti-NKp46 antibody concentration versus polypeptide concentration).
  • a significant reduction in binding indicates that the mutated residue is directly involved in binding to the anti-NKp46 antibody or protein or is in close proximity to the binding protein when the anti-NKp46 antibody or protein is bound to NKp46.
  • An epitope will thus preferably include such residue and may include additional residues adjacent to such residue.
  • a significant reduction in binding means that the binding affinity and/or capacity between an anti-NKp46 antibody or protein and a mutant NKp46 polypeptide is reduced by greater than 40 %, greater than 50 %, greater than 55 %, greater than 60 %, greater than 65 %, greater than 70 %, greater than 75 %, greater than 80 %, greater than 85 %, greater than 90% or greater than 95% relative to binding between the antibody or protein and a wild type NKp46 polypeptide (e.g., the polypeptide shown in SEQ ID NO:1 ). In certain embodiments, binding is reduced below detectable limits.
  • a significant reduction in binding is evidenced when binding of an anti-NKp46 antibody to a mutant NKp46 polypeptide is less than 50% (e.g., less than 45%, 40%, 35%, 30%, 25%, 20%, 15% or 10%) of the binding observed between the anti-NKp46 antibody and a wild-type NKp46 polypeptide (e.g., the polypeptide shown in SEQ ID NO: 1 (or the extracellular domain thereof)).
  • binding measurements can be made using a variety of binding assays known in the art. A specific example of one such assay is described in the Example section.
  • anti-NKp46 antibodies or proteins are provided that exhibit significantly lower binding for a mutant NKp46 polypeptide in which a residue in a wild-type NKp46 polypeptide (e.g., SEQ ID NO:1 ) is substituted.
  • a residue in a wild-type NKp46 polypeptide e.g., SEQ ID NO:1
  • the format is: Wild type residue: Position in polypeptide: Mutant residue, with the numbering of the residues as indicated in SEQ ID NO: 1.
  • an anti-NKp46 antibody or protein binds a wild-type NKp46 polypeptide but has decreased binding to a mutant NKp46 polypeptide having a mutation (e.g., an alanine substitution) any one or more of the residues R101 , V102, E104 and/or L105 (with reference to SEQ ID NO:1 ) compared to binding to the wild-type NKp46).
  • a mutation e.g., an alanine substitution
  • an anti-NKp46 antibody or protein binds a wild-type NKp46 polypeptide but has decreased binding to a mutant NKp46 polypeptide having a mutation (e.g., an alanine substitution) any one or more of the residues K41 , E42, E1 19, Y121 and/or Y194 (with reference to SEQ ID NO:1 ) compared to binding to the wild-type NKp46).
  • a mutation e.g., an alanine substitution
  • an anti-NKp46 antibody or protein binds a wild-type NKp46 polypeptide but has decreased binding to a mutant NKp46 polypeptide having a mutation (e.g., an alanine substitution) any one or more of the residues P132, E133, 1135, and/or S136 (with reference to SEQ ID NO:1 ) compared to binding to the wild-type NKp46).
  • a mutation e.g., an alanine substitution
  • amino acid sequence of the heavy and light chain variable region of parental antibodies NKp46-1 , NKp46-2, NKp46-3 and NKp46-4 are listed herein in Table B.
  • Amino acid sequence of the heavy and light chain variable region of humanized antibodies NKp46- 1 , NKp46-2, NKp46-3, NKp46-4 and NKp46-9 that displayed high binding affinity for both human and non-human primate NKp46 are listed herein in Table C.
  • a heavy chain variable region of a NKp46-1 , NKp46-2, NKp46-3, NKp-46-4, NKp46-6 or NKp46-9 antibody may comprise, for the respective antibody: a human heavy chain FR1 framework region; a HCDR1 region comprising an amino acid sequence as set forth in Table A, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, wherein one or more of these amino acids may be substituted by a different amino acid; a human heavy chain FR2 framework region; a HCDR2 region comprising an amino acid sequence as set forth in Table A, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, wherein one or more of these amino acids may be substituted by a different amino acid; a human heavy chain FR3 framework region; and a HCDR3 region comprising an amino acid sequence as set forth in as set forth in Table A, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino
  • a light chain variable region of a NKp46-1 , NKp46-2, NKp46-3, NKp-46-4, NKp46-6 or NKp46-9 antibody may comprise, for the respective antibody: a human light chain FR1 framework region; a LCDR1 region comprising an amino acid sequence as set forth in Table A, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, wherein one or more of these amino acids may be substituted by a different amino acid; a human light chain FR2 framework region; a LCDR2 region comprising an amino acid sequence as set forth in Table A, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, wherein one or more of these amino acids may be substituted by a different amino acid; a human light chain FR3 framework region; and a LCDR3 region comprising an amino acid sequence as set forth in Table A, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, wherein one or
  • VH and VL combinations examples include:
  • VH comprising a CDR1 , 2 and 3 of SEQ ID NO: 3 and a FR1 , 2 and 3 of a human IGHV1 -69 gene segment, and a VL comprising a CDR1 , 2 and 3 of SEQ ID NO: 4 and a FR1 , 2 and 3 of a human IGKV1 -33 gene segment;
  • VH comprising a CDR1 , 2 and 3 of SEQ ID NO: 5 and a FR1 , 2 and 3 of a human IGHV4-30-4 gene segment, and a VL comprising a CDR1 , 2 and 3 of SEQ ID NO: 6 and a FR1 , 2 and 3 of a human IGKV1 -39 gene segment;
  • VH comprising a CDR1 , 2 and 3 of SEQ ID NO: 7 and a FR1 , 2 and 3 of a human IGHV1 -69 gene segment, and a VL comprising a CDR1 , 2 and 3 of SEQ ID NO: 8 and a FR1 , 2 and 3 of a human IGKV3-1 1 and/or IGKV3-15 gene segment;
  • a VH comprising a CDR1 , 2 and 3 of SEQ ID NO: 9 and a FR1 , 2 and 3 of a human IGHV1 -46 and/or a IGHV1 -69 gene segment, and a VL comprising a CDR1 , 2 and 3 of SEQ ID NO: 10 and a FR1 , 2 and 3 of a human IGKV1 -NL1 gene segment; or (e) a VH comprising a CDR1 , 2 and 3 of SEQ ID NO: 13 and a FR1 , 2 and 3 of a human IGHV4-30-4 gene segment, and a VL comprising a CDR1 , 2 and 3 of SEQ ID NO: 14 and a FR1 , 2 and 3 of a human IGKV1 -39 gene segment.
  • examples of VH and VL combinations include:
  • VH comprising an amino acid sequence at least 70%, 80%, 90%, 95% or
  • VL comprising an amino acid sequence at least 70%, 80%, 90%, 95% or 98% identical to the amino acid sequence of the NKp46-1 L1 variable domain
  • VH comprising an amino acid sequence at least 70%, 80%, 90%, 95% or 98% identical to the amino acid sequence of the NKp46-2 H1 , H2 or H3 variable domain, and a VL comprising an amino acid sequence at least 70%, 80%, 90%, 95% or 98% identical to the amino acid sequence of the NKp46-2 L1 variable domain;
  • VH comprising an amino acid sequence at least 70%, 80%, 90%, 95% or 98% identical to the amino acid sequence of the NKp46-3 H1 , H3 or H4 variable domain, and a VL comprising an amino acid sequence at least 70%, 80%, 90%, 95% or 98% identical to the amino acid sequence of the NKp46-3 L1 variable domain;
  • VH comprising an amino acid sequence at least 70%, 80%, 90%, 95% or 98% identical to the amino acid sequence of the NKp46-4 H 1 variable domain, and a VL comprising an amino acid sequence at least 70%, 80%, 90%, 95% or 98% identical to the amino acid sequence of the NKp46-4 L2 variable domain;
  • VH comprising an amino acid sequence at least 70%, 80%, 90%, 95% or 98% identical to the amino acid sequence of the NKp46-9 H2 variable domain, and a VL comprising an amino acid sequence at least 70%, 80%, 90%, 95% or 98% identical to the amino acid sequence of the NKp46-9 L1 or L2 variable domain;
  • VH comprising an amino acid sequence at least 70%, 80%, 90%, 95% or
  • VL comprising an amino acid sequence at least 70%, 80%, 90%, 95% or 98% identical to the amino acid sequence of the NKp46-9 L1 or L2 variable domain.
  • the aforementioned CDRs are according to Kabat, e.g. as shown in Table A. In one embodiment, the aforementioned CDRs are according to Chotia numbering, e.g. as shown in Table A. In one embodiment, the aforementioned CDRs are according to IMGT numbering, e.g. as shown in Table A.
  • the particular VH or VL comprises an amino acid substitution in a human framework (e.g. a back-mutation) at a Kabat position shown in Example 1 ; optionally the amino acid residue substituted in Example 1 at the corresponding Kabat position can be specified as being present at the particular position.
  • any of the CDRs 1 , 2 and 3 of the heavy and light chains may be characterized by a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, and/or as having an amino acid sequence that shares at least 50%, 60%, 70%, 80%, 85%, 90% or 95% sequence identity with the particular CDR or set of CDRs listed in the corresponding SEQ ID NO or Table A.
  • VL or VH sequence can be specified or numbered so as to contain or lack a signal peptide or any part thereof.
  • NKp46-2 Kabat 31 SDYAWN 34 YITYSGSTSYNPSLES 36 GGYYGSSWGVF
  • NKp46-3 Kabat 46 EYTMH 49 GISPNIGGTSYNQKFKG 51 RGGSFDY
  • NKp46-4 Kabat 60 SFTMH 63 YINPSSGYTEYNQKFKD 65 GSSRGFDY
  • NKp46-2 Rabat 39 RVSENIYSYLA 42 NARTLAE 43 QHHYGTPWT
  • NKp46-4 Rabat 68 RASENIYSNLA 70 AATNLAD 71 QHFWGTPRT
  • NKp46-6 Rabat 80 RASQSISDYLH YASQSIS 82 QNGHSFLMYT Chotia 81 GRFDSQSISDY YAS 83 GHSFLMY
  • NKp46-2 VH 5 EVQLQESGPGLVRPSQSLSLTCTVTGYSITSDYAWNWIRQFPGNRLEWMGY
  • NKp46-2 VL 6 DIQMTQSPASLSASVGETVTITCRVSENIYSYLAWYQQRQGRSPQLLVYNA
  • NKp46-3 VH 7 EVQLQQSGPELVRPGASVRISCRTSGYTFTEYTMHWVRQSHGRSLEWIGGI
  • NKp46-6 VL 12 DIVMTQSPATLSVTPGDRVSLSCRASQSI SDYLHWYQQKSHESPRLLIKYA
  • NKp46-9 VH 13 DVQLQESGPGLVKPSQSLSLTCTVTGYSITSDYAWNWIRQFPGNKLEWMGY
  • Antigen binding domains that bind NKp46 can be derived from the anti- NKp46 CDR, VH and VL sequences provided herein (see section "Anti-NKp46 variable domains").
  • the antigen binding domains can be arranged one the same or on separate polypeptides, such that they form an antigen binding domain capable of binding NKp46 (e.g. human NKp46 as expressed at the surface of a cell).
  • the ABDs can be produced, for example, as an scFv, a tandem scFv, a Bite, a DART, a Fab, a F(ab) 2 , an antibody, a bispecific antibody, or a monomeric or multimeric Fc protein.
  • antigen binding domains that bind an antigen of interest can be readily derived a variety of immunoglobulin or non-immunoglobulin scaffolds, for example affibodies based on the Z-domain of staphylococcal protein A, engineered Kunitz domains, monobodies or adnectins based on the 10th extracellular domain of human fibronectin III, anticalins derived from lipocalins, DARPins (designed ankyrin repeat domains, multimerized LDLR-A module, avimers or cysteine-rich knottin peptides. See, e.g., Gebauer and Skerra (2009) Current Opinion in Chemical Biology 13:245-255, the disclosure of which is incorporated herein by reference.
  • Variable domains that bind an antigen of interest can be derived from an antibody, for example in the form of associated VL and VH domains found on two polypeptide chains, or single chain antigen binding domains such as scFv, a V H domain, a V L domain, a dAb, a V-NAR domain or a V H H domain.
  • the an antigen binding domain e.g,. ABD-i and ABD 2
  • antibodies are initially obtained by immunization of a non-human animal, e.g., a mouse, with an immunogen comprising a polypeptide, or a fragment or derivative thereof, typically an immunogenic fragment, for which it is desired to obtain antibodies (e.g. a human polypeptide).
  • an immunogen comprising a polypeptide, or a fragment or derivative thereof, typically an immunogenic fragment, for which it is desired to obtain antibodies (e.g. a human polypeptide).
  • the step of immunizing a non-human mammal with an antigen may be carried out in any manner well known in the art for stimulating the production of antibodies in a mouse (see, for example, E. Harlow and D. Lane, Antibodies: A Laboratory Manual., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY (1988), the entire disclosure of which is herein incorporated by reference).
  • Antigen binding domains that bind antigens of interest (other than NKp46) for use in a multispecific polypeptide can be selected based on the desired cellular target, and may include for example cancer antigens, bacterial or viral antigens, etc.
  • bacterial antigen includes, but is not limited to, intact, attenuated or killed bacteria, any structural or functional bacterial protein or carbohydrate, or any peptide portion of a bacterial protein of sufficient length (typically about 8 amino acids or longer) to be antigenic. Examples include gram-positive bacterial antigens and gram-negative bacterial antigens.
  • the bacterial antigen is derived from a bacterium selected from the group consisting of Helicobacter species, in particular Helicobacter pyloris; Borelia species, in particular Borelia burgdorferi; Legionella species, in particular Legionella pneumophilia; Mycobacteria s species, in particular M. tuberculosis, M. avium, M. intracellular, M. kansasii, M. gordonae; Staphylococcus species, in particular Staphylococcus aureus; Neisseria species, in particular N. gonorrhoeae, N.
  • Helicobacter species in particular Helicobacter pyloris
  • Borelia species in particular Borelia burgdorferi
  • Legionella species in particular Legionella pneumophilia
  • Mycobacteria s species in particular M. tuberculosis, M. avium, M. intracellular, M. kansasii, M. gordonae
  • pneumonias anaerobic Streptococcus species; pathogenic Campylobacter species; Enterococcus species; Haemophilus species, in particular Haemophilus influenzue; Bacillus species, in particular Bacillus anthracis; Corynebacterium species, in particular Corynebacterium diphtheriae; Erysipelothrix species, in particular Erysipelothrix rhusiopathiae; Clostridium species, in particular C. perfringens, C.
  • Enterobacter species in particular Enterobacter aerogenes, Klebsiella species, in particular Klebsiella 1 S pneumoniae, Pasturella species, in particular Pasturella multocida, Bacteroides species; Fusobacterium species, in particular Fusobacterium nucleatum; Streptobacillus species, in particular Streptobacillus moniliformis; Treponema species, in particular Treponema per pneumonia; Leptospira; pathogenic Escherichia species; and Actinomyces species, in particular Actinomyces israelii.
  • viral antigen includes, but is not limited to, intact, attenuated or killed whole virus, any structural or functional viral protein, or any peptide portion of a viral protein of sufficient length (typically about 8 amino acids or longer) to be antigenic.
  • Retroviridae e.g., human immunodeficiency viruses, such as HIV-1 (also referred to as HTLV-III, LAV or HTLV-III/LAV, or HIV-III; and other isolates, such as HIV-LP; Picornaviridae (e.g., polio viruses, hepatitis A virus; enteroviruses, human Coxsackie viruses, rhinoviruses, echoviruses); Calciviridae (e.g., strains that cause gastroenteritis); Togaviridae (e.g., equine encephalitis viruses, rubella viruses); Flaviviridae (e.g., dengue viruses, encephalitis viruses, yellow fever viruses); Coronaviridae (e.g., coronaviruses); Rhabdoviridae (e.g., vesicular stomatitis viruses, rabies viruses); Fil
  • cancer antigen and “tumor antigen” are used interchangeably and refer to antigens (other than NKp46) that are differentially expressed by cancer cells or are expressed by non-tumoral cells (e.g. immune cells) having a pro-tumoral effect (e.g. an immunosuppressive effect), and can thereby be exploited in order to target cancer cells.
  • cancer antigens are antigens which can potentially stimulate apparently tumor- specific immune responses. Some of these antigens are encoded, although not necessarily expressed, or expressed at lower levels or less frequently, by normal cells.
  • cancer antigens can be characterized as those which are normally silent (i.e., not expressed) in normal cells, those that are expressed only at certain stages of differentiation and those that are temporally expressed such as embryonic and fetal antigens.
  • Other cancer antigens are encoded by mutant cellular genes, such as oncogenes (e.g., activated ras oncogene), suppressor genes (e.g., mutant p53), fusion proteins resulting from internal deletions or chromosomal translocations.
  • Still other cancer antigens can be encoded by viral genes such as those carried on RNA and DNA tumor viruses.
  • Still other cancer antigens can be expressed on immune cells capable of mediating a pro-tumoral effect, e.g. a monocyte or a macrophage, optionally a suppressor T cell, regulatory T cell, or myeloid-derived suppressor cell.
  • the cancer antigens are usually normal cell surface antigens which are either over- expressed or expressed at abnormal times, or are expressed by a targeted population of cells.
  • the target antigen is expressed only on proliferative cells (e.g., tumor cells) or pro-tumoral cells (e.g. immune cells having an immunosuppressive effect), however this is rarely observed in practice.
  • proliferative cells e.g., tumor cells
  • pro-tumoral cells e.g. immune cells having an immunosuppressive effect
  • Example of cancer antigens include: Receptor Tyrosine Kinase-like Orphan Receptor 1 (ROR1 ), Cripto, CD4, CD20, CD30, CD19, CD38, CD47, Glycoprotein NMB, CanAg, Her2 (ErbB2/Neu), a Siglec family member, for example CD22 (Siglec2) or CD33 (Siglec3), CD79, CD138, CD171 , PSCA, L1 -CAM, PSMA (prostate specific membrane antigen), BCMA, CD52, CD56, CD80, CD70, E-selectin, EphB2, Melanotransferin, Mud 6 and TMEFF2.
  • ROR1 Receptor Tyrosine Kinase-like Orphan Receptor 1
  • Cripto CD4, CD20, CD30, CD19, CD38, CD47, Glycoprotein NMB, CanAg, Her2 (ErbB2/Neu), a Siglec family member, for example CD22 (Siglec2) or CD
  • cancer antigens also include Immunoglobulin immunoglobulin superfamily (IgSF) such as cytokine receptors, Killer-lg Like Receptor, CD28 family proteins, for example, Killer-lg Like Receptor 3DL2 (KIR3DL2), B7-H3, B7-H4, B7-H6, PD-L1 , IL-6 receptor.
  • IgSF Immunoglobulin immunoglobulin superfamily
  • Examples also include MAGE, MART-1/Melan-A, gp100, major histocompatibility complex class l-related chain A and B polypeptides (MICA and MICB), adenosine deaminase-binding protein (ADAbp), cyclophilin b, colorectal associated antigen (CRC)- C017-1A/GA733, protein tyrosine kinase 7(PTK7), receptor protein tyrosine kinase 3 (TYRO- 3), nectins (e.g.
  • nectin-4 major histocompatibility complex class l-related chain A and B polypeptides
  • MICA and MICB proteins of the UL16-binding protein
  • RAET1 proteins of the retinoic acid early transcript-1
  • CEA carcinoembryonic antigen
  • CAP-1 and CAP-2 proteins of the retinoic acid early transcript-1
  • PSA carcinoembryonic antigen
  • T- cell receptor/CD3-zeta chain MAGE-family of tumor antigens, GAGE-family of tumor antigens, anti-Mullerian hormone Type II receptor, delta-like ligand 4 (DLL4), DR5, ROR1 (also known as Receptor Tyrosine Kinase-Like Orphan Receptor 1 or NTRKR1 (EC 2.7.10.1 ), BAGE, RAGE, LAGE-1 , NAG, GnT-V, MUM-1 , CDK4, MUC family, VEGF, VEGF receptors,
  • the antigen of interest is an antigen (e.g. any one of the antigens listed above) capable of undergoing intracellular internalization, for example when bound by an conventional human lgG1 antibody, either in the presence of absence of Fey receptor cells.
  • the antigen of interest is a CD19 polypeptide; in one aspect, the multispecific protein comprises an scFv that binds CD19 comprising an amino acid sequence which is at least 60%, 70%, 80%, 85%, 90% or 95% identical to the sequence of the anti-CD19 scFv of the Examples herein, or that comprises the heavy and light chain CDR1 , -2 and -3 of the anti-CD19 heavy and light chain variable regions shown herein.
  • the ABD that binds an antigen of interest is derived from (e.g. comprises the hypervariable region of, or comprises the CDRs of) a parental antibody that binds an antigen of interest (e.g. a murine antibody, a human antibody) which, when bound to its antigenic target (the antigen of interest on cells), increases or induces down- modulation or intracellular internalization of the antigen of interest.
  • the antigen of interest is a cancer antigen, e.g. one of the cancer antigens listed above known to internalize (e.g.
  • Immunoglobulin immunoglobulin superfamily (IgSF) members for example cytokine receptor alpha or beta chains, Killer-lg Like Receptors, CD28 family proteins, B7- H3, B7-H4, B7-H6, KIR3DL2, PTK7, ROR1 , L1 -CAM, Siglec family members, EGF receptor and EGF-like receptor family members, EGFR, HER-2, integrins, anti-Mullerian hormone Type II receptor, CSF-1 R, and others)
  • the antigen target is a polypeptide present on an immune cell capable of mediating a pro-tumoral effect, e.g. a monocyte or a macrophage, optionally a suppressor T cell, regulatory T cell, or myeloid- derived suppressor cell.
  • the non-NKp46 ABD binds to a cancer antigen, a viral antigen, a microbial antigen, or an antigen present on an infected cell (e.g. virally infected) or on a proinflammatory immune cell.
  • DNA encoding each of the or ABD can be separately placed, in suitable arrangements, in an appropriate expression vector, together with DNA encoding any elements such as an enzymatic recognition tag, CH1 , CK, CH2 and/or CH3 domains and any other optional elements (e.g. DNA encoding a hinge region) for transfection into an appropriate host.
  • ABDs will be arranged in an expression vector, or in separate vectors as a function of which type of polypeptide is to be produced, so as to produce the Fc-polypeptides having the desired domains operably linked to one another. The host is then used for the recombinant production of the multispecific polypeptide.
  • a polypeptide fusion product can be produced from a vector in which the first of the two ABD is operably linked (e.g. directly, via a heavy or light chain CH1 , CK or CA constant region and/or hinge region) to the N-terminus of a CH2 domain, and the CH2 domain is operably linked at its C-terminus to the N-terminus a CH3 domain.
  • the second of the two ABD can be linked to the polypeptide at either terminus, or can be on a second polypeptide chain that forms a dimer, e.g. heterodimer, with the polypeptide comprising the first ABD.
  • the polypeptide may comprise a full length Fc domain.
  • the multispecific polypeptide can then be produced in an appropriate host cell or by any suitable synthetic process.
  • a host cell chosen for expression of the multispecific polypeptide is an important contributor to the final composition, including, without limitation, the variation in composition of the oligosaccharide moieties decorating the protein in the immunoglobulin CH2 domain.
  • the host cell may, for example, be of mammalian origin or may be selected from COS-1 , COS-7, HEK293, BHK21 , CHO, BSC-1 , Hep G2, 653, SP2/0, 293, HeLa, myeloma, lymphoma, yeast, insect or plant cells, or any derivative, immortalized or transformed cell thereof.
  • a range of different protein formats can be prepared using the NKp46-binding VH-VL pairs of the disclosure, including monomeric, heterodimeric, hetertrimeric and tetrameric multispecific proteins. Included, without limitation, are any of a variety of formats described in for example, in PCT application number PCT/EP2016/064537, filed 23 June 2016 (Innate Pharma), the disclosure of which is incorporated herein by reference.
  • a multispecific protein comprises, in a single polypeptide chain, a first antigen binding domain that binds to NKp46 (e.g. an ABD comprising a VH and a VL disclosed herein, separated by a (poly)peptide linker) and a second antigen binding domain that binds an antigen other than NKp46.
  • a first antigen binding domain that binds to NKp46 e.g. an ABD comprising a VH and a VL disclosed herein, separated by a (poly)peptide linker
  • second antigen binding domain that binds an antigen other than NKp46.
  • the protein or polypeptide is or comprises an scFv comprising the anti-NKp46 VH and VL of the disclosure, or a tandem scFv comprising the scFv that binds NKp46 and a second scFv that binds NKp46 or an antigen of interest other than NKp46, linked by a (poly)peptide linker optionally fused to another polypeptide or amino acid sequence.
  • BITE® Bispecific T- cell Engager
  • BITE® Bispecific T- cell Engager
  • a single polypeptide containing two antigen-binding domains each contributed by a pair of VH and VL, linked in tandem via a flexible linker (see, e.g., Nagorsen et al., 2009, Leukemia & Lymphoma 50:886-91 ; Amann et al., 2009, J Immunother 32:453- 64; Baeuerle and Reinhardt, 2009, Cancer Res 69:4941-44).
  • DART® Dual-Affinity Re-Targeting
  • a disulfide-stabilized diabody design see, e.g., Moore et al., 201 1 , Blood 1 17:4542-51 ; Veri et al., 2010, Arthritis Rheum 62:1933-43).
  • the single polypeptide chain further comprises an Fc domain
  • Fc domain e.g. a full length Fc domain or a portion thereof
  • Fc domain is interposed between the first and second antigen binding domains.
  • the first antigen binding domain and/or the second antigen binding domain comprise a scFv, optionally where the scFv comprises human framework amino acid sequences.
  • a monomeric bispecific Fc-derived polypeptide comprising: (a) a first scFv that binds to NKp46; (b) a second scFv that binds an antigen other than NKp46; and, optionally, (c) at least a portion of a human Fc domain.
  • the Fc domain (i) does not dimerize with another Fc-derived polypeptide and (ii) is capable of binding to human FcRn.
  • the Fc domain is interposed between the first and second scFv.
  • the CH3 domains may be arranged and/or comprise amino acid modification to prevent CH3-CH3 dimerization.
  • the CH3 domain comprises mutations in the dimer interface to prevent interchain CH3-CH3 dimerization.
  • the CH3 domain is a tandem CH3 domain (or the Fc domain comprises a tandem CH3 domain) to prevent interchain CH3-CH3 dimerization.
  • Such monomers will retain partial FcRn binding (compared, e.g., to a wild type full length human lgG1 antibody).
  • the monomeric polypeptide is capable of binding to human FcRn with intermediate affinity, e.g. retains binding to FcRn but has decreased binding to a human FcRn receptor compared to a full-length wild type human lgG1 antibody.
  • the Fc moiety may further comprise one or more amino acid modifications, e.g. in the CH2 domain, that further decreases or substantially abolishes binding to one or more Fey receptors.
  • the monomeric Fc-derived polypeptides that have at least a portion of a human Fc domain can advantageously comprise a CH2 domain and a CH3 domain, wherein said CH3 domain comprises a modified CH3 dimer interface (e.g. a mutations in the CH3 dimer interface) to prevent dimerization with another Fc-derived polypeptide. See e.g. format 1 and 2 in Figure 2A).
  • the CH3 domain comprises an amino acid substitution at 1 , 2, 3, 4, 5, 6 or 7 of the positions L351 , T366, L368, P395, F405, T407 (or Y407) and/or K409 (EU numbering as in Kabat).
  • a tandem CH3 domain comprises a first and a second CH3 domain, wherein the two CH3 domains associate with one another via non-covalent interactions.
  • the two CH3 domains associate with one another via the CH3 dimerization interface of each CH3 domain.
  • the polypeptide chain does not dimerize with another polypeptide chain comprising an Fc domain.
  • An Fc domain that comprise a tandem CH3 domain will interact with neonatal Fc receptor (FcRn) but will have low or no binding to human Fey receptors, notably CD16.
  • Multimeric bispecific proteins such as heterodimers, heterotrimers and tetramers (the latter including for example antibodies with two heavy chains and two light chains) that comprise an ABD that binds NKp46 (e.g. an ABD comprising a VH and a VL disclosed herein) can be produced according to a variety of formats.
  • a multimeric protein or polypeptide is a tetrameric antibody made up of two heavy chains comprising variable regions (or 1 , 2 or 3 CDRs thereof) derived from two different parental antibodies, and two light chains comprising variable regions (or 1 , 2 or 3 CDRs thereof) derived from two different parental antibodies.
  • a tetramer may comprise (a) two heavy chains each comprising a variable region, a CH1 domain, hinge and an Fc domain, and (b) two antibody light chains each comprising a light chain variable region and a CK domain, wherein one heavy chain variable region together with a light chain variable region binds to NKp46 and the other heavy chain variable region together with a light chain variable region bind an antigen of interest.
  • One advantageous way of making multimeric proteins is through the assembly of different polypeptide chains that each comprise at least one heavy or light chain variable domain fused to a human CH1 or CK constant domain (a V-(CH 1/CK) unit), wherein the protein chains undergo CH1 -CK dimerization and are bound to one another by non-covalent bonds and optionally further by disulfide bonds formed between respective CH1 and CK domain.
  • a human CH1 or CK constant domain a V-(CH 1/CK) unit
  • an isolated or purified heterodimeric or heterotimeric protein that binds a first and second antigen, wherein the protein comprises at least two or three polypeptide chains each comprising a V-(CH 1 /CK) unit, whereby the chains are bound to one another by non-covalent bonds and optionally further by disulfide bonds between CH 1 and CK domains, optionally, whereby the chains are further bound by non-covalent bonds between respective variable regions and CH3 domains of the Fc portion.
  • variable and constant regions can be selected and configured such that each chain will preferentially associate with its desired complementary partner chain.
  • the resulting multimeric protein will therefore be simple to produce using conventional production methods using recombinant host cells.
  • the choice of which VH, VL to associate with a CH1 and CK in a unit is based on affinity between the units to be paired so as to drive the formation of the desired multimer.
  • the resulting multimer will be bound by non-covalent bonds between complementary VH and VL domains, by non-covalent bonds between complementary CH1 and CK domains, and optionally by disulfide bonding between complementary CH1 and CK domains and/or optionally further by disulfide bonds between complementary hinge domains).
  • VH-VL associations are stronger than VH-VH or VL-VL, consequently, as shown herein, one can place a VH or a VL next to either a CH1 or a CK, and the resulting V-C unit will partner preferably with its V-C counterpart.
  • VH-CK will pair with VL-CH1 preferentially over VH-CH1 .
  • preferred chain pairing is further improved, as the two Fc-containing chains will be bound by non-covalent bonds between CH3 domains of the Fc domains.
  • the different V-C combinations, optionally further combined with Fc pairing thereby provides tools to make heteromultimeric proteins.
  • a heteromultimeric polypeptide or protein comprises a monomeric Fc domain (e.g. the second polypeptide does not comprise an Fc domain), optionally wherein the Fc domain comprises a CH3 domain with an amino acid mutation to prevent CH3-CH3 dimerization or a tandem CH3 domain.
  • the above heteromultimeric polypeptide or protein comprises a dimeric Fc domain capable of binding to human CD16, e.g. a human Fc domain comprising N-linked glycosylation at amino acid residue N297 (Kabat EU numbering).
  • a heterodimer can for example have the configuration as follows (see also Examples of such proteins shown as formats 2, 1 1 and 12 shown in Figures 2A and 2C):
  • V b -i - (CH1 or CK) b (second polypeptide chain) wherein one of V a-1 of the first polypeptide chain and V b- i of the second polypeptide chain is a light chain variable domain and the other is a heavy chain variable domain, and wherein one of V a-2 and V b-2 is a light chain variable domain and the other is a heavy chain variable domain.
  • the heterodimer can in another example have the configuration as follows (see also Examples of such proteins shown as format 10 shown in Figure 2B):
  • V b-1 - (CH1 or CK) b (second polypeptide chain) wherein one of V a-1 of the first polypeptide chain and V b-1 of the second polypeptide chain is a light chain variable domain and the other is a heavy chain variable domain, and wherein one of V a-2 and V b-2 is a light chain variable domain and the other is a heavy chain variable domain.
  • the resulting heterodimer can in another example have the configuration as follows (see also Examples of such proteins shown as formats 13 and 14 shown in Figure 2D and 2E):
  • V b-1 - (CH1 or CK) b - Fc domain (second polypeptide chain) wherein one of V a-1 of the first polypeptide chain and V b-1 of the second polypeptide chain is a light chain variable domain and the other is a heavy chain variable domain, and wherein one of V a-2 and V b-2 is a light chain variable domain and the other is a heavy chain variable domain.
  • Heterotrimeric proteins can for example be formed by using a central (first) polypeptide chain comprising a first variable domain (V) fused to a first CH1 or CK constant region, a second variable domain (V) fused to a second CH1 or CK constant region, and an Fc domain or portion thereof interposed between the first and second variable domains (i.e. the Fc domain is interposed between the first and second (V-(CH1/CK) units.
  • a central polypeptide chain for use in a heterotrimeric protein can have the domain arrangements (N- to C- terminal) as follows:
  • a second polypeptide chain can then comprise a domain arrangement (N- to C- terminal):
  • V b-1 - (CH1 or CK) c
  • a third polypeptide chain can then comprise a domain arrangement (N- to C- terminal):
  • An example of a configuration of a resulting heterotrimer with a dimeric Fc domain (also shown as formats 5, 6, 7 and 16 in Figures 2D and 2E) has a domain arrangement: V b-1 - (CH 1 or CK) C - Fc domain (second polypeptide)
  • V b-2 - (CH1 or CK) d (third polypeptide)
  • V b-1 - (CH 1 or CK)c (second polypeptide)
  • V b-2 - (CH 1 or CK) d third polypeptide
  • the first polypeptide can have two variable domains that each form an antigen binding domain with a variable domain on a separate polypeptide chain (i.e. the variable domain of the second and third chains), the second polypeptide chain has one variable domain, and the third polypeptide has one variable domain.
  • a trimeric polypeptide may comprise:
  • a first polypeptide chain comprising a first variable domain (V) fused to a first CH1 of CK constant region, a second variable domain (V) fused to a second CH1 of CK constant region, and an Fc domain or portion thereof interposed between the first and second variable domains;
  • a second polypeptide chain comprising a variable domain fused at its C- terminus to a CH1 or CK constant region selected to be complementary to the first CH1 or CK constant region of the first polypeptide chain such that the first and second polypeptides form a CH1 -CK heterodimer, and optionally an Fc domain;
  • a third polypeptide chain comprising a variable domain fused (e.g. at its C- terminus) to a CH1 or CK constant region, wherein the variable domain and the constant region are selected to be complementary to the second variable domain and second CH1 or CK constant region of the first polypeptide chain such that the first and third polypeptides form a CH1 -CK heterodimer bound by non-covalent bonds and optionally further by disulfide bond(s) formed between the CH1 or CK constant region of the third polypeptide and the second CH1 or CK constant region of the first polypeptide, but not between the CH1 or CK constant region of the third polypeptide and the first CH1 or CK constant region of the first polypeptide
  • first, second and third polypeptides form a CH1 -CK heterotrimer
  • first variable domain of the first polypeptide chain and the variable domain of the second polypeptide chain form an antigen binding domain specific for a first antigen of interest
  • second variable domain of the first polypeptide chain and the variable domain on the third polypeptide chain form an antigen binding domain specific for a second antigen of interest.
  • One of the two antigens of interest will be NKp46, and the ABD that binds NKp46 comprises a VH-VL variable domain pair of the disclosure.
  • domain arrangement for the trimeric bispecific polypeptide formed from include but are not limited to:
  • VH - (CK) (second polypeptide)
  • VK - (CK) (third polypeptide)
  • VH - (CK) - Fc domain (second polypeptide)
  • VK - (CK) (third polypeptide)
  • the Fc domain may comprise a CH2-CH3 unit (a full length CH2 and CH3 domain or a fragment thereof).
  • the CH3 domain will be capable of CH3-CH3 dimerization (e.g. a wild-type CH3 domain).
  • the Fc domain will be incapable of CH3-CH3 dimerization; for example the CH3 domain(s) will have amino acid modification(s) in the CH3 dimer interface or the Fc domain will comprise a tandem CH3 domain incapable of CH3-CH3 dimerization.
  • the multispecific protein can be tetramers, e.g. heterodimeric tetramers with two light chains and two different heavy chains, wherein the heavy chains are engineered for heterodimerization.
  • Such proteins can be prepared as described, for example, in PCT application number PCT/EP2016/064537, filed 23 June 2016 (Innate Pharma), the disclosure of which is incorporated herein by reference.
  • a hinge region will typically be present on a polypeptide chain between a CH1 domain and a CH2 domain, and/or can be present between a CK domain and a CH2 domain.
  • a hinge region can optionally be replaced for example by a suitable linker peptide.
  • the proteins domains described in the present disclosure can optionally be specified as being from N- to C- terminal. Protein arrangements of the disclosure for purposes of illustration are shown from N-terminus (on the left) to C-terminus. Domains can be referred to as fused to one another (e.g. a domain can be said to be fused to the C-terminus of the domain on its left, and/or a domain can be said to be fused to the N-terminus of the domain on its right).
  • proteins domains described in the present disclosure can be fused to one another directly or via intervening amino acid sequences.
  • a CH1 or CK domain will be fused to an Fc domain (or CH2 or CH3 domain thereof) via a linker peptide, optionally a hinge region or a fragment thereof.
  • a VH or VK domain will be fused to a CH3 domain via a linker peptide.
  • VH and VL domains linked to another in tandem will be fused via a linker peptide (e.g. as an scFv).
  • VH and VL domains linked to an Fc domain will be fused via a linker peptide.
  • Two polypeptide chains will be bound to one another (indicated by "
  • a multispecific protein is capable of inducing activation of an NKp46-expressing cell (e.g. an NK cell, a reporter cell) when the protein is incubated in the presence of the NKp46-expressing cell (e.g. purified NK cells) and a target cell that expresses the antigen of interest).
  • an NKp46-expressing cell e.g. an NK cell, a reporter cell
  • the protein is incubated in the presence of the NKp46-expressing cell (e.g. purified NK cells) and a target cell that expresses the antigen of interest).
  • a multispecific protein is capable of inducing NKp46 signaling in an NKp46-expressing cell (e.g. an NK cell, a reporter cell) when the protein is incubated in the presence of the NKp46-expressing cell (e.g. purified NK cells) and a target cell that expresses the antigen of interest).
  • an NKp46-expressing cell e.g. an NK cell, a reporter cell
  • the protein is incubated in the presence of the NKp46-expressing cell (e.g. purified NK cells) and a target cell that expresses the antigen of interest).
  • NK cell activation or signaling in characterized by increased expression of a cell surface marker of activation, e.g. CD107, CD69, etc.
  • Activity can be measured for example by bringing target cells and NKp46-expressing cells into contact with one another, in presence of the multispecific polypeptide.
  • aggregation of target cells and NK cells is measured.
  • the multispecific protein may, for example, be assessed for the ability to cause a measurable increase in any property or activity known in the art as associated with NK cell activity, respectively, such as marker of cytotoxicity (CD107) or cytokine production (for example IFN- ⁇ or TNF-a), increases in intracellular free calcium levels, the ability to lyse target cells in a redirected killing assay, etc.
  • Assays for activity are further described in more detail, for example, in PCT application number PCT/EP2016/064537, filed 23 June 2016 (Innate Pharma), the disclosure of which is incorporated herein by reference.
  • NKp46 an antigen binding domain that binds NKp46
  • NKp46 polypeptides e.g. NK cells
  • NKp46 polypeptides e.g. NK cells
  • any of the compounds defined herein for the manufacture of a pharmaceutical preparation for the treatment or diagnosis of a mammal in need thereof.
  • any of the compounds defined above as a medicament or an active component or active substance in a medicament.
  • the invention provides a method of restoring or potentiating the activity of NKp46 + NK cells in a patient in need thereof (e.g. a patient having a cancer, or a viral or bacterial infection), comprising the step of administering a multispecific protein described herein to said patient.
  • the method is directed at increasing the activity of NKp46+ lymphocytes in patients having a disease in which increased lymphocyte (e.g. NK cell) activity is beneficial or which is caused or characterized by insufficient NK cell activity, such as a cancer, or a viral or microbial/bacterial infection.
  • polypeptides described herein can be used to prevent or treat disorders that can be treated with antibodies, such as cancers, solid and non-solid tumors, hematological malignancies, infections such as viral infections, and inflammatory or autoimmune disorders.
  • the antigen of interest is an antigen expressed on the surface of a malignant cell of a type of cancer selected from the group consisting of: carcinoma, including that of the bladder, head and neck, breast, colon, kidney, liver, lung, ovary, prostate, pancreas, stomach, cervix, thyroid and skin, including squamous cell carcinoma; hematopoietic tumors of lymphoid lineage, including leukemia, acute lymphocytic leukemia, acute lymphoblastic leukemia, B-cell lymphoma, T-cell lymphoma, Hodgkins lymphoma, non-Hodgkins lymphoma, hairy cell lymphoma and Burketts lymphoma; hematopoietic tumors of myeloid lineage, including acute and chronic myelogenous leukemias and promyelocytic leukemia; tumors of mesenchymal origin, including fibrosarcoma and rhabdom
  • polypeptides described herein can be used to prevent or treat a cancer selected from the group consisting of: carcinoma, including that of the bladder, head and neck, breast, colon, kidney, liver, lung, ovary, prostate, pancreas, stomach, cervix, thyroid and skin, including squamous cell carcinoma; hematopoietic tumors of lymphoid lineage, including leukemia, acute lymphocytic leukemia, acute lymphoblastic leukemia, B- cell lymphoma, T-cell lymphoma, Hodgkins lymphoma, non-Hodgkins lymphoma, hairy cell lymphoma and Burketts lymphoma; hematopoietic tumors of myeloid lineage, including acute and chronic myelogenous leukemias and promyelocytic leukemia; tumors of mesenchymal origin, including fibrosarcoma and rhabdomyoscarcoma; other tumors, including neuroblastoma and
  • T-cell disorders such as T-prolymphocytic leukemia (T-PLL), including of the small cell and cerebriform cell type; large granular lymphocyte leukemia (LGL) preferably of the T-cell type; Sezary syndrome (SS); Adult T-cell leukemia lymphoma (ATLL); a/d T-NHL hepatosplenic lymphoma; peripheral/post-thymic T cell lymphoma (pleomorphic and immunoblastic subtypes); angio immunoblastic T-cell lymphoma; angiocentric (nasal) T-cell lymphoma; anaplastic (Ki 1 +) large cell lymphoma; intestinal T-cell lymphoma; T-lymphoblastic; and lymphoma/leukaemia (T-Lbly/T-ALL
  • the tumor antigen is an antigen expressed on the surface of a lymphoma cell or a leukemia cell, and the multispecific protein is administered to, and/or used for the treatment of, an individual having a lymphoma or a leukemia.
  • the tumor antigen is selected from CD19, CD20, CD22, CD30 or CD33.
  • the methods of treatment comprise administering to an individual a multispecific protein described herein in a therapeutically effective amount, e.g., for the treatment of a disease as disclosed herein, for example a cancer selected from the group above.
  • a therapeutically effective amount may be any amount that has a therapeutic effect in a patient having a disease or disorder (or promotes, enhances, and/or induces such an effect in at least a substantial proportion of patients with the disease or disorder and substantially similar characteristics as the patient).
  • the multispecific protein described herein may be used as monotherapy (without other therapeutic agents), or in combined treatments with one or more other therapeutic agents, including agents normally utilized for the particular therapeutic purpose for which the antibody is being administered.
  • the additional therapeutic agent will normally be administered in amounts and treatment regimens typically used for that agent in a monotherapy for the particular disease or condition being treated.
  • Such therapeutic agents when used in the treatment of cancer include, but are not limited to anti-cancer agents and chemotherapeutic agents; in the treatment of infectious disease, include, but are not limited to anti-viral agents and anti-biotics.
  • kits may optionally further contain any number of polypeptides and/or other compounds, e.g., 1 , 2, 3, 4, or any other number of proteins and/or polypeptides and/or other compounds. It will be appreciated that this description of the contents of the kits is not limiting in any way.
  • the kit may contain other types of therapeutic compounds.
  • the kits also include instructions for using the proteins and/or polypeptides, e.g., detailing the herein- described methods.
  • compositions comprising the compounds as defined above.
  • a compound may be administered in purified form together with a pharmaceutical carrier as a pharmaceutical composition.
  • the form depends on the intended mode of administration and therapeutic or diagnostic application.
  • the pharmaceutical carrier can be any compatible, nontoxic substance suitable to deliver the compounds to the patient.
  • Pharmaceutically acceptable carriers include, for example, aqueous solutions such as (sterile) water or physiologically buffered saline or other solvents or vehicles such as glycols, glycerol, oils such as olive oil or injectable organic esters, alcohol, fats, waxes, and inert solids
  • a pharmaceutically acceptable carrier may further contain physiologically acceptable compounds that act for example to stabilize or to increase the absorption of the compounds
  • physiologically acceptable compounds include, for example, carbohydrates, such as glucose, sucrose or dextrans, antioxidants, such as ascorbic acid or glutathione, chelating agents, low molecular weight proteins or other stabilizers or excipients
  • a pharmaceutically acceptable carrier including a physiologically acceptable compound, depends, for example, on the route of administration of the composition
  • Pharmaceutically acceptable adjuvants, buffering agents, dispersing agents, and the like may also be incorporated into the pharmaceutical compositions.
  • the compounds can be administered parenterally. Preparations of the compounds for parenteral administration must be sterile. Sterilization is readily accomplished by filtration through sterile filtration membranes, optionally prior to or following lyophilization and reconstitution.
  • the parenteral route for administration of compounds is in accord with known methods, e.g. injection or infusion by intravenous, intraperitoneal, intramuscular, intraarterial, or intralesional routes.
  • the compounds may be administered continuously by infusion or by bolus injection.
  • a typical composition for intravenous infusion could be made up to contain 100 to 500 ml of sterile 0.9% NaCI or 5% glucose optionally supplemented with a 20% albumin solution and 1 mg to 10 g of the compound, depending on the particular type of compound and its required dosing regimen.
  • Methods for preparing parenterally administrable compositions are well known in the art.
  • mice were immunized with a recombinant human NKp46 extracellular domain recombinant-Fc protein.
  • Mice received one primo-immunization with an emulsion of 50 ⁇ g NKp46 protein and Complete Freund Adjuvant, intraperitoneally, a 2nd immunization with an emulsion of 50 ⁇ g NKp46 protein and Incomplete Freund Adjuvant, intraperitoneally, and finally a boost with 10 ⁇ g NKp46 protein, intravenously.
  • Immune spleen cells were fused 3 days after the boost with X63.Ag8.653 immortalized B cells, and cultured in the presence of irradiated spleen cells.
  • SN Supernatant of growing clones were tested in a primary screen by flow cytometry using a cell line expressing the human NKp46 construct at the cell surface. Briefly, for FACS screening, the presence of reacting antibodies in supernanants was revealed by Goat anti-mouse polyclonal antibody (pAb) labeled with PE.
  • pAb Goat anti-mouse polyclonal antibody
  • NKp46-1 , -2, -3, -4, -6 and -9 A selection of antibodies that bound NKp46 were selected, produced as full-length human IgG antibodies and as bispecific antibodies.
  • variable regions evaluated for their activity in the context of a bispecific molecule in Examples 2-13 were antibodies NKp46-1 , -2, -3, -4, -6 and -9 having the respective variable regions shown in Table B herein.
  • Part B Generation of humanized anti-human/anti-cynomologus NKp46 antibodies
  • Antibodies NKp46-1 , -2, -3 and -4 having the respective variable regions shown in Table B herein were produced as humanized antibodies by complementary determining region (CDR) grafting of heavy and light chains having the amino acid sequence shown below. Antibodies were produced using CHO cells and tested for binding to human NKp46.
  • CDR complementary determining region
  • each of the CDR-grafted antibodies bound with good affinity to human NKp46. However, none of the CDR-grafted antibodies bound to cynomologus NKp46. Epitopes on human NKp46 were determined (see Example 13); in view of the possibility that modifications that affect the conformation of the antibody variable regions or positioning of the CDRs may permit an epitope shared on cynomolgus NKp46 to be recognized, multiple variants were prepared for each of the CDR-grafted antibodies for NKp46-1 , -2, -3, -4, and -9 were prepared and produced using CHO cells, and tested for binding to cynomolgus NKp46.
  • NKp46-1 , -2, -3, -4, and -9 For each of antibody NKp46-1 , -2, -3, -4, and -9, one more variants were identified that permitted the recognition with good affinity of an epitope shared by human and cynomolgus NKp46 binding. Based on 3D modelling studies, different heavy and light chain variable regions were designed that included NKp46-1 CDRs and human frameworks, produced as human lgG1 antibodies, and tested for binding to cynomolgus NKp46.
  • NKp46-1 CDRs and human frameworks were designed that included NKp46-1 CDRs and human frameworks, produced as human lgG1 antibodies, and tested for binding to cynomolgus NKp46.
  • Two combinations of heavy and light chains were able to bind to both human and cynomolgus NKp46: the heavy chain variable region "H1 " and the heavy chain ⁇ 3", in each case combined with the light chain "L1 ".
  • These cross-binding variable regions included, for the heavy chain variable region: the NKp46-1 heavy chain CDRs (shown below, underlined), human IGHV1 -69 * 06 gene framework 1 , 2 and 3 regions and a human IGHJ6 * 01 gene framework 4 region.
  • the light chain variable region the NKp46-1 light chain CDRs (shown below, underlined), human IGKV1 -33 * 01 gene framework 1 , 2 and 3 regions and a human IGKJ4 * 01 gene framework 4 region.
  • CDRs were chosen according to Kabat numbering.
  • the H1 , H3 and L1 chain had the specific amino acid substitutions (shown in bold and underlining below).
  • L1 had a phenylalanine at Kabat light chain residue 87.
  • H1 had a tyrosine at Kabat heavy chain residue 27 and a lysine and alanine at Kabat residues 66 and 67, respectively.
  • H3 additionally had a glycine at Kabat residue 37, an isoleucine at Kabat residue 48, and a phenylalanine at Kabat residue 91 .
  • NKp46-1 ⁇ 1" heavy chain variable region
  • NKp46-1 ⁇ 3" heavy chain variable region
  • NKp46-1 "L1" light chain variable region
  • NKp46-2 CDRs and human frameworks were designed that included NKp46-2 CDRs and human frameworks, produced as human lgG1 antibodies, and tested for binding to cynomolgus NKp46.
  • Three combinations of heavy and light chains were able to bind to both human and cynomolgus NKp46: the heavy chain variable regions ⁇ 1 ", ⁇ 2 and ⁇ 3", in each case combined with the light chain "L1 ".
  • the H1 L1 furthermore had an improved binding affinity compared to the parental NKp46-2 antibody having the VH and VL of SEQ ID NOS: 5 and 6.
  • NKp46-2 heavy chain CDRs shown below, underlined
  • human IGHV4-30-4 * 01 gene framework 1 , 2 and 3 regions and a human IGHJ1 * 01 gene framework 4 region.
  • the light chain variable region the NKp46-2 light chain CDRs (shown below, underlined), human IGKV1 -39 * 01 gene framework 1 , 2 and 3 regions and a human IGKJ4 * 01 gene framework 4 region.
  • CDRs were chosen according to Kabat numbering.
  • the L1 , H1 , H2 and H3 chains had the specific amino acid substitutions (shown in bold and underlining below). L1 had a valine at Kabat light chain residue 48.
  • H1 had a tyrosine at Kabat heavy chain residue 27 and an arginine at Kabat residue 71 .
  • H2 additionally had a methionine at Kabat residue 48 and an isoleucine at Kabat residue 67.
  • H3 additionally had a threonine at Kabat residue 31.
  • NKp46-2 ⁇ 1" heavy chain variable region
  • NKp46-2 "H 2" heavy chain variable region
  • NKp46-2 "H 3" heavy chain variable region
  • NKp46-2 "L 1 " light chain variable region
  • NKp46-3 CDRs and human frameworks were designed that included NKp46-3 CDRs and human frameworks, produced as human lgG1 antibodies, and tested for binding to cynomolgus NKp46.
  • Three combinations of heavy and light chains were able to bind to both human and cynomolgus NKp46: the heavy chain variable regions ⁇ 1 ", ⁇ 3 and ⁇ 4", in each case combined with the light chain "L1 ".
  • the H3L1 furthermore had an improved binding affinity compared to the parental NKp46-3 antibody having the VH and VL of SEQ ID NOS: 7 and 8.
  • NKp46-3 heavy chain CDRs shown below, underlined
  • human IGHV1 -69 * 02 gene framework 1 , 2 and 3 regions and a human IGHJ6 * 01 gene framework 4 region.
  • the light chain variable region the NKp46-3 light chain CDRs (shown below, underlined), framework 1 , 2 and 3 regions created by a mosaic approach using FR1 and FR2 from IGKV3-15 and FR3 from IGKV3-1 1 , and a human IGKJ2 * 01 gene framework 4 region.
  • CDRs were chosen according to Kabat numbering.
  • L1 , H1 , H3 and H4 chains had the specific amino acid substitutions (shown in bold and underlining below).
  • L1 had a lysine at Kabat light chain residue 49.
  • H1 had a tyrosine at Kabat heavy chain residue 27.
  • H3 additionally had a isoleucine at Kabat residue 48 and an alanine at Kabat residue 67.
  • H4 additionally had a leucine at Kabat residue 69.
  • NKp46-3 ⁇ 1" heavy chain variable region
  • NKp46-3 "H3" heavy chain variable region
  • NKp46-3 ⁇ 4" heavy chain variable region
  • NKp46-3 "L1" light chain variable region
  • the heavy chain variable region the NKp46-4 heavy chain CDRs (shown below, underlined), human framework 1 , 2 and 3 regions designed using a mosaic approach using FR1 from IGHV1646,0 FR3 from IGHV1 - 69, and a common FR2 (IGHV1 -46 and IGHV1 -69 share the same FR2), and a human IGHJ6 * 01 gene framework 4 region.
  • the light chain variable region the NKp46-4 light chain CDRs (shown below, underlined), framework 1 , 2 and 3 regions from IGKV1 -NL1 , and a human IGKJ4 * 01 gene framework 4 region.
  • L2 had a phenylalanine at Kabat light chain residue 36 and a valine at Kabat residue 48.
  • H1 had a threonine at Kabat heavy chain residue 30 and an isoleucine at Kabat residue 48 and a valine at Kabat residue 93.
  • H2 additionally had a threonine at Kabat residue 67.
  • H3 additionally had a leucine at Kabat residue 69.
  • NKp46-4 ⁇ 1" heavy chain variable region
  • NKp46-4 ⁇ 2" heavy chain variable region
  • NKp46-4 ⁇ 3" heavy chain variable region
  • NKp46-4 "L2" light chain variable region
  • Heavy chain variable region ⁇ 2 when combined with either light chain variable region “L1 " or “L2”, and heavy chain variable region ⁇ 3" when combined with either light chain variable region “L1 " or “L2”, were able to bind to both human and cynomolgus NKp46 with greater affinity that the parental antibody (having the VH and VL of SEQ ID NOS: 13 and 14.
  • the "H1 " chain was not able to bind cynomolgus NKp46 with any of the light chains tested but bound well to human NKp46.
  • These cross-binding variable regions included, for the heavy chain variable region: the NKp46-9 heavy chain CDRs (shown below, underlined), human framework 1 , 2 and 3 regions from IGHV4-30-4 * 01 , and a human IGHJ6 * 01 gene framework 4 region.
  • the light chain variable region the NKp46-9 light chain CDRs (shown below, underlined), framework 1 , 2 and 3 regions from IGKV1 -39 * 01 , and a human IGKJ2 * 01 gene framework 4 region. CDRs were chosen according to Kabat numbering.
  • L1 , L2, H1 , H2 and H3 chains had the specific amino acid substitutions (shown in bold and underlining below).
  • L1 had a cysteine at Kabat light chain residue 36.
  • L2 additionally had a valine at Kabat residue 48.
  • H1 had an arginine at Kabat heavy chain residue 71.
  • H2 additionally had a tyrosine at Kabat residue 27.
  • H3 additionally had a methionine at Kabat residue 48 and an isoleucine at Kabat residue 67.
  • NKp46-9 ⁇ 1" heavy chain variable region
  • NKp46-9 "H2" heavy chain variable region
  • NKp46-9 "H3" heavy chain variable region
  • NKp46-9 "L1" light chain variable region
  • NKp46-9 "L2" light chain variable region
  • the aim of this experiment was to develop a new bispecific protein format that places an Fc domain on a polypeptide together with an anti-NKp46 binding domain and an anti-target antigen binding domain.
  • the bispecific protein binds to NKp46 monovalently via its anti-NKp46 binding domain.
  • the monomeric Fc domain retains at least partial binding to the human neonatal Fc receptor (FcRn), yet does not substantially bind human CD16 and/or other human Fey receptors. Consequently, the bispecific protein will not induce Fcj- mediated (e.g. CD16-mediated) target cell lysis.
  • Example 2-1 Construction and binding analysis of Anti-CD19-lgG1 -Fcmono-Anti-CD3 Since no anti-NKp46 bispecific antibody has been produced that could indicate whether such a protein could be functional, CD3 was used as a model antigen in place of NKp46 in order to investigate the functionality of a new monovalent bispecific protein format prior to targeting NK cells via NKp46.
  • a bispecific Fc-based on a scFv specific for tumor antigen CD19 (anti-CD19 scFv) and a scFV specific for activating receptor CD3 on a T cell (anti-CD3 scFv) was used to assess FcRn binding and CD19-binding functions of a new monomeric bispecific polypeptide format.
  • the domain arrangement of the final polypeptide is referred to as the "F1 " format (the star in the CH2 domain indicates an optional N297S mutation, not included in the polypeptide tested here).
  • a bispecific monomeric Fc-containing polypeptide was constructed based on an scFv specific for the tumor antigen CD19 (anti-CD19 scFv) and an scFV specific for an activating receptor CD3 on a T cell (anti-CD3 scFv).
  • the CH3 domain incorporated the mutations (EU numbering) L351 K, T366S, P395V, F405R, T407A and K409Y.
  • the polypeptide has domains arranged as follows: anti-CD19-CH2-CH3-anti-CD3.
  • DNA sequence coding for a CH3A H linker peptide having the amino acid sequence STGS was designed in order to insert a specific Sail restriction site at the CH3-VH junction.
  • the CH3 domain incorporated the mutations (EU numbering) L351 K, T366S, P395V, F405R, T407A and K409Y.
  • the CH2 domain was a wild-type CH2.
  • DNA and amino acid sequences for the monomeric CH2-CH3 Fc portion and the anti-CD19 are shown below.
  • the light chain and heavy chain DNA and amino acid sequences corresponding to the anti-CD19 scFv were as follows:
  • SEQ ID NO: 1 The DNA sequences for the monomeric CH2-CH3 Fc portion and final bispecific lgG1 -Fcmono polypeptide (the last K was removed in that construct) is shown in SEQ ID NO: 1 17.
  • the amino acid sequence is shown in SEQ ID NO: 2.
  • the Anti-CD19-F1 -Anti-CD3 complete sequence (mature protein) is shown in SEQ ID NO: 1 18.
  • Coding sequences were generated by direct synthesis and/or by PCR. PCR were performed using the PrimeSTAR MAX DNA polymerase (Takara, #R045A) and PCR products were purified from 1 % agarose gel using the NucleoSpin gel and PCR clean-up kit (Macherey-Nagel, #740609.250). Once purified the PCR product were quantified prior to the In-Fusion ligation reaction performed as described in the manufacturer's protocol (ClonTech, #ST0345). The plasmids were obtained after a miniprep preparation run on an EVO200 (Tecan) using the Nucleospin 96 plasmid kit (Macherey-Nagel, #740625.4). Plasmids were then sequenced for sequences confirmation before to transfecting the CHO cell line.
  • CHO cells were grown in the CD-CHO medium (Invitrogen) complemented with phenol red and 6 mM GlutaMax. The day before the transfection, cells are counted and seeded at 175.000 cells/ml.
  • cells (200.000 cells/transfection) are prepared as described in the AMAXA SF cell line kit (AMAXA, #V4XC-2032) and nucleofected using the DS137 protocol with the Nucleofector 4D device. All the tranfections were performed using 300 ng of verified plasmids. After transfection, cells are seeded into 24 well plates in pre-warmed culture medium. After 24H, hygromycine B was added in the culture medium (200 g/ml).
  • Protein expression is monitored after one week in culture. Cells expressing the proteins are then sub-cloned to obtain the best producers. Sub-cloning was performed using 96 flat-bottom well plates in which the cells are seeded at one cell per well into 200 ⁇ of culture medium complemented with 200 ⁇ g ml of hygromycine B. Cells were left for three weeks before to test the clone's productivity.
  • Recombinant proteins which contain a lgG1-Fc fragment are purified using Protein-A beads (- rProteinA Sepharose fast flow, GE Healthcare, ref.: 17-1279-03). Briefly, cell culture supernatants were concentrated, clarified by centrifugation and injected onto Protein-A columns to capture the recombinant Fc containing proteins. Proteins were eluted at acidic pH (citric acid 0.1 M pH3), immediately neutralized using TRIS-HCL pH8.5 and dialyzed against 1X PBS. Recombinant scFv which contain a "six his" tag were purified by affinity chromatography using Cobalt resin. Other recombinant scFv were purified by size exclusion chromatography (SEC).
  • SEC size exclusion chromatography
  • Example 2-2 Binding analysis ofAnti-CD19-lgG1-Fcmono-Anti-CD3 to B221, JURKAT,
  • HUT78 and CHO cell lines Cells were harvested and stained with the cell supernatant of the anti-CD19-F1 -anti- CD3 producing cells during 1 H at 4°C. After two washes in staining buffer (PBS1X / BSA 0.2% / EDTA 2mM), cells were stained for 30 min at 4°C with goat anti-human (Fc)-PE antibody (IM0550 Beckman Coulter - 1/200). After two washes, stainings were acquired on a BD FACS Canto II and analyzed using the FlowJo software.
  • staining buffer PBS1X / BSA 0.2% / EDTA 2mM
  • CD3 and CD19 expression were also controlled by flow cytometry: Cells were harvested and stained in PBS1 X / BSA 0.2% / EDTA 2mM buffer during 30 min at 4°C using 5 ⁇ of the anti-CD3-APC and 5 ⁇ of the anti-CD19-FITC antibodies. After two washes, stainings were acquired on a BD FACS Canto II and analyzed using the FlowJo software.
  • the Anti-CD19-F1 -Anti-CD3 protein binds to the CD3 cell lines (HUT78 and JURKAT cell lines) and the CD19 cell line (B221 cell line) but not to the CHO cell line used as a negative control.
  • Results are shown in Figure 1.
  • the top panel shows that Anti-CD19-F1 -Anti-CD3 does not cause aggregation in the presence of B221 (CD19) or JURKAT (CD3) cell lines, but it does cause aggregation of cells when both B221 and JURKAT cells are co-incubated, illustrating that the bispecific antibody is functional.
  • the lower panel shows control without antibody.
  • Example 2-4
  • FcRn proteins were immobilized covalently to carboxyl groups in the dextran layer on a Sensor Chip CM5.
  • the chip surface was activated with EDC/NHS (N- ethyl-N'-(3-dimethylaminopropyl) carbodiimidehydrochloride and N-hydroxysuccinimide (Biacore GE Healthcare)).
  • FcRn proteins were diluted to 10 ⁇ g ml in coupling buffer (10 mM acetate, pH 5.6) and injected until the appropriate immobilization level was reached (i.e. 2500 RU). Deactivation of the remaining activated groups was performed using 100 mM ethanolamine pH 8 (Biacore GE Healthcare).
  • Affinity was evaluated using SPR, in comparison to a chimeric full length antibody having human lgG1 constant regions.
  • multimeric proteins that comprise two or three polypeptide chains, wherein the Fc domain remains monomeric, were developed that are compatible for use with antibody variable regions that do not maintain binding to their target when converted to scFv format.
  • the latter formats can be used conveniently for antibody screening; by incorporating at least one binding region as a F(ab) structure, any anti-target (e.g. anti-tumor) antibody variable region can be directly expressed in a bispecific construct as the F(ab) format within the bispecific protein and tested, irrespective of whether the antibody would retain binding as an scFv, thereby simplifying screening and enhancing the number of antibodies available.
  • These formats in which the Fc domain remains monomeric have the advantage of maintaining maximum conformational flexibility and as shown infra may permit optimal binding to NKp46 or target antigens.
  • variable domains from the scFv specific for tumor antigen CD19 described in Example 2-1 were also made using different variable regions from antibodies specific for the NKp46 receptor identified in Example 1 .
  • a construct was also made using as the anti-NKp46 the variable regions from a commercially available antibody Bab281 (mlgG1 , available commercially from Beckman Coulter, Inc. (Brea, CA, USA) (see also Pessino et al, J. Exp. Med, 1998, 188 (5): 953-960 and Sivori et al, Eur J Immunol, 1999. 29:1656-1666) specific for the NKp46 receptor.
  • Bab281 mlgG1 , available commercially from Beckman Coulter, Inc. (Brea, CA, USA)
  • CH3-CH3 dimerization was prevented through two different strategies: (1 ) through the use of CH3 domain incorporating specific mutations (EU numbering), i.e., L351 K, T366S, P395V, F405R, T407A and K409Y; or (2) through the use of a tandem CH3 domain in which the tandem CH3 domains are separated by a flexible linker associated with one another, which prevents interchain CH3-CH3 dimerization.
  • EU numbering i.e., L351 K, T366S, P395V, F405R, T407A and K409Y
  • tandem CH3 domain in which the tandem CH3 domains are separated by a flexible linker associated with one another, which prevents interchain CH3-CH3 dimerization.
  • the DNA and amino acid sequences for the monomeric CH2-CH3 Fc portion containing the above-identified point mutations were the same as in Example 2-1 .
  • Example 2-1 The light chain and heavy chain DNA and amino acid sequences for the anti-CD19 scFv were also the same as in Example 2-1 . Proteins were cloned, produced and purified as in Example 2-1. Shown below are the light chain and heavy chain DNA and amino acid sequences for different anti-NKp46 scFvs.
  • NKp46-2 CARGGYYGSSWGVFAYWGQGTLVTVSAVEGGSGGSGGSGGSGGVD
  • NKp46-3 YCARRGGSFDYWGQGTTLTVSSVEGGSGGSGGSGGSGGVDDIVMTQ
  • TKLEIK- (SEQ ID NO: 122)
  • NKp46-6 YYCARGGRFDDWGAGTTVTVSSVEGGSGGSGGSGGSGGVDDIVMTQ
  • TKLELK- (SEQ ID NO: 124)
  • Table 2A DNA sequences corresponding to different anti-NKp46 scFvs scFv anti- scFV sequences
  • NKp46-1 SEQ ID NO: 126
  • NKp46-2 SEQ ID NO: 127
  • the domain structure of Format 1 is shown in Figure 2A.
  • a bispecific Fc- containing polypeptide was constructed based on a scFv specific for the tumor antigen CD19 (anti-CD19 scFv) and an scFV specific for the NKp46 receptor.
  • the polypeptide is a single chain polypeptide having domains arranged (N- to C- termini) as follows:
  • a DNA sequence coding for a CH3A H linker peptide having the amino acid sequence STGS was designed in order to insert a specific Sail restriction site at the CH3-V H junction.
  • the domain arrangement of the final polypeptide in shown in Figure 2 (the star in the CH2 domain indicates an optional N297S mutation), where the anti-CD3 scFv is replaced by an anti-NKp46 scFv.
  • the (VK-V h ) units include a linker between the V H and VK domains. Proteins were cloned, produced and purified as in Example 2-1 .
  • the amino acid sequences of the bispecific polypeptides are shown in the corresponding SEQ ID NOS listed in the Table 2B below.
  • the domain structure of F2 polypeptides is shown in Figure 2A.
  • the DNA and amino acid sequences for the monomeric CH2-CH3 Fc portion were as in Example 2-1 and it similarly contains CH3 domain mutations (the mutations (EU numbering) L351 K, T366S, P395V, F405R, T407A and K409Y.
  • the heterodimer is made up of:
  • the (VK-VH) unit was made up of a V H domain, a linker and a Vioinit (i.e. an scFv).
  • a V H domain a linker and a Vioinit (i.e. an scFv).
  • the amino acid sequences for the first and second chains of the F2 protein are shown in SEQ ID NO: 140 and 141.
  • the domain structure of F3 polypeptides is shown in Figure 2A.
  • the DNA and amino acid sequences for the CH2-CH3 Fc portion comprised a tandem CH3 domain in which the two CH3 domains on the same polypeptide chain associated with one another, thereby preventing dimerization between different bispecific proteins.
  • the single chain polypeptide has domains arranged (N- to C- termini) as follows: (VK-V H ) ANTI"CD19 - CH2 - CH3 - CH3 - (V H -V K ) ANTI - NK 46
  • the (VK-VH) units were made up of a V H domain, a linker and a VK unit (scFv).
  • the domain structure of F4 polypeptides is shown in Figure 2A.
  • the DNA and amino acid sequences for the CH2-CH3 Fc portion comprised a tandem CH3 domain as in Format F3, and additionally comprise a N297S mutation which prevents N-linked glycosylation and abolishes FcyR binding.
  • Proteins were cloned, produced and purified as in Example 2-1 .
  • Bispecific proteins was purified from cell culture supernatant by affinity chromatography using prot-A beads and analyzed and purified by SEC. The protein showed a good production yield of 1 mg/L and the purified proteins exhibited a simple SEC profile.
  • the amino acid sequence for the F4 protein with NKp46-3 variable domains is shown in SEQ ID NO: 143.
  • the domain structure of F8 polypeptides is shown in Figure 2B.
  • the DNA and amino acid sequences for the monomeric CH2-CH3 Fc portion were as in Format F2 and it similarly contains CH3 domain mutations (the mutations (EU numbering) L351 K, T366S, P395V, F405R, T407A and K409Y, as well as a N297S mutation which prevents N-linked glycosylation and moreover abolishes FcyR binding.
  • F8 proteins Three variants of F8 proteins were produced: (a) one wherein the cysteine residues in the hinge region were left intact (wild- type, referred to as F8A), (b) a second wherein the cysteine residues in the hinge region were replaced by serine residues (F8B), and (c) a third including a linker sequence GGGSS replacing residues DKTHTCPPCP in the hinge (F8C).
  • F8A cysteine residues in the hinge region were left intact (wild- type, referred to as F8A)
  • F8B cysteine residues in the hinge region were replaced by serine residues
  • F8C a third including a linker sequence GGGSS replacing residues DKTHTCPPCP in the hinge
  • Proteins were cloned, produced and purified as in Example 2-1. Bispecific proteins was purified from cell culture supernatant by affinity chromatography using prot-A beads and analyzed and purified by SEC. The protein showed a high production yield of 3.7 mg/L (F8C) and the purified proteins again exhibited a simple SEC profile.
  • the amino acid sequences of the three chains of the F8 protein (C variant) with NKp46-3 variable regions are shown in SEQ ID NOS: 144, 145 and 146.
  • the F9 polypeptide is a trimeric polypeptide having a central polypeptide chain and two polypeptide chains each of which associate with the central chain via CH1 -CK dimerization.
  • the domain structure of the trimeric F9 protein is shown in Figure 2B, wherein the bonds between the CH1 and CK domains are interchain disulfide bonds.
  • the two antigen binding domains have a F(ab) structure permitting the use of these antibodies irrespective of whether they remain functional in a scFv format.
  • the DNA and amino acid sequences for the CH2-CH3 Fc portion comprise a tandem CH3 domain as in Format F4 and comprise a CH2 domain comprising a N297S substitution.
  • F9A cysteine residues in the hinge region left intact (wild-type, referred to as F9A)
  • F9B cysteine residues in the hinge region were replaced by serine residues
  • F9C a linker sequence GGGSS which replaces residues DKTHTCPPCP in the hinge
  • Proteins were cloned, produced and purified as in Example 2-1. Bispecific proteins was purified from cell culture supernatant by affinity chromatography using prot-A beads and analyzed and purified by SEC. The protein showed a high production yield of 8.7 mg/L (F9A) and 3.0 mg/L (F9B), and the purified proteins again exhibited a simple SEC profile.
  • the amino acid sequences of the three chains of the F9 protein variant F9A are shown in the SEQ ID NOS: 147, 148 and 149.
  • the amino acid sequences of the three chains of the F9 protein variant F9B are shown in the SEQ ID NOS: 150, 151 and 152.
  • the amino acid sequences of the three chains of the F9 protein variant F9C are shown in the SEQ ID NOS: 153, 154 and 155.
  • the F10 polypeptide is a dimeric protein having a central polypeptide chain and a second polypeptide chain which associates with the central chain via CH1 -CK dimerization.
  • the domain structure of the dimeric F10 protein is shown in Figure 2B wherein the bonds between the CH1 and CK domains are interchain disulfide bonds.
  • One of the two antigen binding domains has a Fab structure, and the other is a scFv.
  • the DNA and amino acid sequences for the CH2-CH3 Fc portion comprise a tandem CH3 domain as shown in Format F4 and comprise a CH2 domain containing a N297S substitution.
  • F10A cysteine residues in the hinge region were left intact (wild-type, referred to as F10A)
  • F10B cysteine residues in the hinge region were replaced by serine residues
  • F10C serine residues
  • Variants F10B and F10C provided advantages in production as they avoid the formation of homodimers of the central chain.
  • the (VK-V h ) unit was made up of a V H domain, a linker and a VK unit (scFv).
  • the heterodimer is made up of:
  • Example 2-1 Bispecific proteins was purified from cell culture supernatant by affinity chromatography using prot-A beads and analyzed and purified by SEC.
  • the protein showed a good production yield of 2 mg/L (F10A) and the purified proteins again exhibited a simple SEC profile.
  • the amino acid sequences of the two chains of the F10A protein variant are shown in SEQ ID NOS: 156 (second chain) and 157 (first chain).
  • the amino acid sequences of the two chains of the F10B protein variant are shown in SEQ ID NOS: 158 (second chain) and 159 (first chain).
  • the amino acid sequences of the two chains of the F10C protein variant are shown in the SEQ ID NOS: 160 (second chain) and 161 (first chain).
  • the domain structure of F1 1 polypeptides is shown in Figure 2C.
  • the heterodimeric protein is similar to F10 except that the structures of the antigen binding domains are reversed.
  • One of the two antigen binding domains has a Fab-like structure, and the other is a scFv.
  • the heterodimer is made up of :
  • the domain structure of the dimeric F12 polypeptides is shown in Figure 2C, wherein the bonds between the CH1 and CK domains are disulfide bonds.
  • the heterodimeric protein is similar to F1 1 but the CH1 and CK domains within the F(ab) structure are inversed.
  • the heterodimer is made up of:
  • Proteins were cloned, produced and purified as in Example 2-1. Bispecific proteins were purified from the cell culture supernatant by affinity chromatography using prot-A beads and analyzed and purified by SEC. The protein showed a good production yield of 2.8 mg/L and the purified proteins similarly exhibited a simple SEC profile.
  • the amino acid sequences of the two chains of the F12 protein are shown in SEQ ID NO: 164 (chain 1 ) and SEQ ID NO: 165 (chain 2).
  • the domain structure of the trimeric F17 polypeptides is shown in Figure 2C, wherein the bonds between the CH1 and CK domains are disulfide bonds.
  • the heterodimeric protein is similar to F9 but the V H and VK domains, and the CH1 and CK, domains within the C-terminal F(ab) structure are each respectively inversed with their partner.
  • the heterotrimer is made up of:
  • F17A cysteine residues in the hinge region were left intact (wild-type, referred to as F17A), (b) a second wherein the cysteine residues in the hinge region were replaced by serine residues (F10B, and (c) a third containing a linker sequence GGGSS which replaces residues DKTHTCPPCP in the hinge (F17C).
  • F17A cysteine residues in the hinge region were left intact (wild-type, referred to as F17A)
  • F10B serine residues
  • GGGSS linker sequence GGGSS which replaces residues DKTHTCPPCP in the hinge
  • variable domain(s) a single variable domain that associates with a variable domain on a separated polypeptide chain, a tandem variable domain (e.g., an scFv), or a single variable domain that is capable of binding antigen as a single variable domain.
  • the two chains associate by CH1-CK dimerization to form disulfide linked dimers, or if associated with a third chain, to form trimers.
  • Proteins were cloned, produced and purified as in Example 2-1. Bispecific proteins was purified from cell culture supernatant by affinity chromatography using prot-A beads and analyzed and purified by SEC. The protein showed a high production yield of 37 mg/L and the purified proteins again exhibited a simple SEC profile.
  • the amino acid sequences of the three polypeptide chains are shown in SEQ ID NOS 169 (second chain), 170 (first chain) and 171 (third chain).
  • the domain structure of heterotrimeric F6 polypeptides is shown in Figure 2D.
  • the F6 protein is the same as F5, but contains a N297S substitution to avoid N-linked glycosylation. Proteins were cloned, produced and purified as in Example 2-1 . Bispecific proteins were purified from cell culture supernatant by affinity chromatography using prot-A beads and analyzed and purified by SEC. The protein showed a high production yield of 12 mg/L and the purified proteins exhibited a simple SEC profile.
  • the amino acid sequences of the three polypeptide chains are shown in SEQ ID NOS: 172 (second chain), 173 (first chain) and 174 (third chain).
  • the domain structure of heterotrimeric F7 polypeptides is shown in Figure 2D.
  • the F7 protein is the same as F6, except for cysteine to serine substitutions in the CH1 and CK domains that are linked at their C-termini to Fc domains, in order to prevent formation of a minor population of dimeric species of the central chain with the VK antl"NKp46 - CH1 chain.
  • Proteins were cloned, produced and purified as in Example 2-1.
  • Bispecific proteins were purified from the cell culture supernatant by affinity chromatography using prot-A beads and analyzed and purified by SEC. The protein showed a high production yield of 1 1 mg/L and the purified proteins exhibited a simple SEC profile.
  • the amino acid sequences of the three polypeptide chains are shown in SEQ ID NOS: 175 (second chain), 176 (first chain) and 177 (third chain).
  • the domain structure of the dimeric F13 polypeptide is shown in Figure 2D, wherein the interchain bonds between hinge domains (indicated between CH1/CK and CH2 domains on a chain) and interchain bonds between the CH1 and CK domains are interchain disulfide bonds.
  • the heterodimer is made up of:
  • the (V H -VK) unit was made up of a V H domain, a linker and a VK unit (scFv).
  • Proteins were cloned, produced and purified as in Example 2-1. Bispecific proteins were purified from the cell culture supernatant by affinity chromatography using prot-A beads and analyzed and purified by SEC. The protein showed a high production yield of 6.4 mg/L and the purified proteins exhibited a simple SEC profile.
  • the amino acid sequences of the two polypeptide chains are shown in SEQ ID NOS: 178 (second chain) and 179 (first chain).
  • the domain structure of the dimeric F14 polypeptide is shown in Figure 2E.
  • the F14 polypeptide is a dimeric polypeptide which shares the structure of the F13 format, but instead of a wild-type Fc domain (CH2-CH3), the F14 bispecific format has CH2 domain mutations N297S to abolish N-linked glycosylation.
  • Proteins were cloned, produced and purified as in Example 2-1. Bispecific proteins were purified from cell culture supernatant by affinity chromatography using prot-A beads and analyzed and purified by SEC. The protein showed a high production yield of 2.4 mg/L and the purified proteins exhibited a simple SEC profile.
  • the amino acid sequences of the two polypeptide chains are shown in SEQ ID NOS: 180 (second chain) and 181 (first chain).
  • the domain structure of the trimeric F15 polypeptides is shown in Figure 2E.
  • the F15 polypeptide is a dimeric polypeptide which shares the structure of the F6 format, but differs by inversion of the N-terminal V H -CH1 and VK-CK units between the central and second chains.
  • Proteins were cloned, produced and purified as in Example 2-1. Bispecific proteins were purified from the cell culture supernatant by affinity chromatography using prot-A beads and analyzed and purified by SEC. The protein showed a good production yield of 0.9 mg/L and the purified proteins possessed a simple SEC profile.
  • the amino acid sequences of the three polypeptide chains are shown in SEQ ID NOS: 182 (second chain), 183 (first chain) and 184 (third chain).
  • the domain structure of the trimeric F16 polypeptide is shown in Figure 2E.
  • the F16 polypeptide is a dimeric polypeptide which shares the structure of the F6 format, but differs by inversion of the C-terminal V H -CK and VK-CH1 units between the central and second chains. Proteins were cloned, produced and purified as in Example 2-1 .
  • the amino acid sequences of the three polypeptide chains are shown in SEQ ID NOS: 185 (second chain), 186 (first chain) and 187 (third chain). Format 75 (T5)
  • the domain structure of a trimeric T5 polypeptide is shown in Figure 2F.
  • the T5 polypeptide is a trimeric polypeptide which shares the structure of the F5 format, but differs by fusion of an scFv unit at the C-terminus of the third chain (the chain lacking the Fc domain).
  • This protein will therefore have two antigen binding domains for antigens of interest, and one for NKp46, and will bind CD16 via its Fc domain. Proteins were cloned, produced and purified as in Example 2-1.
  • the T5 protein had two antigen binding domains that bind human CD20, originating from different antibodies (and binding to different epitopes on CD20).
  • the first anti-CD20 ABD contained the V H and V L of the parent antibody GA101 (GAZYVA®, Gazyvaro®, obinutuzumab, Roche Pharmaceuticals).
  • the second anti-CD20 ABD contained the V H and V L of the parent antibody rituximab (Rituxan®, Mabthera®, Roche Pharmaceuticals).
  • the third antigen binding domain binds human NKp46.
  • the amino acid sequences of the three chains of the T5 protein are shown below (Rituximab sequences are in bold and underlined, anti-GA101 sequences are underlined, anti-NKp46 sequences are in italics).
  • Polypeptide 2 (SEQ ID NO : 189)
  • Polypeptide 3 (SEQ ID NO : 190)
  • the domain structure of the trimeric T6 polypeptide is shown in Figure 2F.
  • the T6 polypeptide is a trimeric polypeptide which shares the structure of the F6 format, but differs by the fusion of an scFv unit at the C-terminus of the third chain (the chain lacking the Fc domain).
  • This trimeric protein contains two antigen binding domains for antigens of interest, and one for NKp46, and does not bind CD16 via its Fc domain due to the N297 substitution. Proteins were cloned, produced and purified as in Example 2-1 .
  • the T6 protein contains two antigen binding domains that bind human CD20.
  • the first anti-CD20 ABD comprises the V H and V L of the parent antibody GA101 and the second anti-CD20 ABD comprises the V H and V L of rituximab.
  • the amino acid sequences of the three chains of the T6 proteins are shown in SEQ ID NOS : 191 , 192 and 193.
  • the domain structure of the trimeric T9B polypeptide is shown in Figure 2F.
  • the T9B polypeptide is a trimeric polypeptide which shares the structure of the F9 format (F9B variant), but differs by the fusion of an scFv unit at the C-terminus of the free CH1 domain (on the third chain).
  • This protein contains two antigen binding domains for antigen of interest, and one for NKp46, but will not bind CD16 via its Fc domain due to the monomeric Fc domain and/or the N297 substitution.
  • Trimeric proteins as above described were cloned, produced and purified as in Example 2-1 .
  • the T9B protein had two antigen binding domains that bind human CD20.
  • the first anti-CD20 ABD contained the V H and V L of the parent antibody GA101 and the second anti-CD20 ABD contained the V H and V L of the parent antibody rituximab.
  • the amino acid sequences of the three chains of the T9B proteins are shown below.
  • Polypeptide 2 (SEQ ID NO : 195)
  • Polypeptide 1 (SEQ ID NO : 194)
  • Polypeptide 3 (SEQ ID NO : 196):
  • the domain structure of the dimeric T1 1 polypeptide is shown in Figure 2F.
  • the T1 1 polypeptide is a trimeric polypeptide which shares the structure of the F1 1 format, but differs by the fusion of an scFv unit at the C-terminus of the free CH1 domain.
  • This dimeric protein contains two antigen binding domains for antigen of interest, and one for NKp46, and does not bind CD16 via its Fc domain due to the monomeric Fc domain and/or the N297 substitution. Proteins were cloned, produced and purified as in Example 2-1.
  • the T1 1 protein contains two antigen binding domains that bind human CD20.
  • the first anti-CD20 ABD contained the V H and V L of the parent antibody GA101 and the second anti-CD20 ABD contained the V H and V L of rituximab.
  • the amino acid sequences of the two chains of the T1 1 protein are shown below.
  • Polypeptide 1 (SEQ ID NO : 197):
  • Polypeptide 2 (SEQ ID NO : 198):
  • Protein-A proteins were immobilized covalently to carboxyl groups in the dextran layer on a Sensor Chip CM5.
  • the chip surface was activated with EDC/NHS (N-ethyl-N'-(3- dimethylaminopropyl) carbodiimidehydrochloride and N-hydroxysuccinimide (Biacore GE Healthcare)).
  • Protein-A was diluted to 10 ⁇ g ml in coupling buffer (10 mM acetate, pH 5.6) and injected until the appropriate immobilization level was reached (i.e. 2000 RU). Deactivation of the remaining activated groups was performed using 100 mM ethanolamine pH 8 (Biacore GE Healthcare).
  • the bispecific proteins were first tested in Format F1 described in Example 2 having different anti-NKp46 variable regions from NKp46-1 , NKp46-2, NKp46-3 or NKp46-4 antibodies. Antibodies were next tested as different formats F3, F4, F5, F6, F9, F10, F1 1 , F13, F14 having the anti-NKp46 variable regions from the NKp46-3 antibody, and compared to the NKp46-3 antibody as a full-length human lgG1 .
  • Bispecific proteins at 1 ⁇ g mL were captured onto Protein-A chip and recombinant human NKp46 proteins were injected at 5 ⁇ g mL over captured bispecific antibodies. For blank subtraction, cycles were performed again replacing NKp46 proteins with running buffer.
  • the Bab281 antibody was separately tested for binding to NKp46 by SPR, and additionally by flow cytometry using a cell line expressing the human NKp46 construct at the cell surface.
  • SPC and FACS results showed that the Bab281 based antibody did not bind the NKp46 cell line or NKp46- Fc proteins.
  • Bab281 lost binding to its target when presented in the bispecific format.
  • Bispecific antibodies having a monomeric Fc domain and a domain arrangement according to the single chain F1 or dimeric F2 formats described in Example 3, and a NKp46 binding region based on NKp46-1 , NKp46-2, NKp46-3 or NKp46-4 were tested for functional ability to direct NK cells to lyse CD19-positive tumor target cells (Daudi, a well characterized B lymphoblast cell line).
  • the F2 proteins additionally included NKp46-9 variable regions which lost binding to NKp46 in the scFv format but which retained binding in the F(ab)-like format of F2.
  • each bi-specific antibody NKp46-1 , NKp46-2, NKp46-3, NKp46-4 or NKp46-9 induced specific lysis of Daudi cells by human KHYG-1 hNKp46 NK cell line compared to negative controls (Human lgG1 isotype control (IC) and CD19/CD3 bi-specific antibodies), thereby showing that these antibodies induce Daudi target cell lysis by KHYG-1 hNKp46 through CD19/NKp46 cross-linking.
  • each bi-specific antibody NKp46-1 , NKp46-2, NKp46-3, NKp46-4 or NKp46-9 again induced specific lysis of Daudi cells by human NK cells compared to negative control (Human lgG1 isotype control (IC) antibody), thereby showing that these antibodies induce Daudi target cell lysis by human NK cells through CD19/NKp46 cross-linking.
  • Rituximab RTX, chimeric lgG1
  • ADCC Antibody-Dependent Cell Cytotoxicity
  • NKp46 x CD19 bispecific proteins having an arrangement according to the F2 format described in Example 3 with anti-NKp46 variable domains from NKp46-1 , NKp46-2, NKp46- 3, NKp46-4 or NKp46-9 were compared to:
  • the different proteins were tested for functional effect on NK cell activation in the presence of CD19-positive tumor target cells (Daudi cells), in the presence of CD19- negative, CD16-positive target cells (HUT78 T-lymphoma cells), and in the absence of target cells.
  • NK activation was tested by assessing CD69 and CD107 expression on NK cells by flow cytometry.
  • the assay was carried out in 96 U well plates in completed RPMI, 150 ⁇ _ final/well. Effector cells were fresh NK cells purified from donors. Target cells were Daudi (CD19-positive), HUT78 (CD19-negative) or K562 (NK activation control cell line). In addition to K562 positive control, three conditions were tested, as follows:
  • Antibodies, target cells and effector cells were mixed; spun 1 min at 300g; incubated 4h at 37°C; spun 3 min at 500g; washed twice with Staining Buffer (SB); added 50 ⁇ _ of staining Ab mix; incubated 30 min at 300g; washed twice with SB resuspended pellet with CellFix ; stored overnight at 4°C; and fluorescence revealed with Canto II (HTS).
  • SB Staining Buffer
  • Results are shown in Figure 4A.
  • the bispecific anti-NKp46 x anti-CD19 antibody (including each of the NKp46-1 , NKp46-2, NKp46-3, NKp46-4 and NKp46-9 variable regions) activated NK cells as assessed by CD69 or CD107 expression.
  • Full-length anti-CD19 also did not activate NK cells.
  • the full-length anti-NKp46 antibodies caused detectable activation of NK cells.
  • Alemtuzumab also induced activation of NK cells, at a very high level. Isotype control antibody did not induce activation.
  • Alemtuzumab also induced activation of NK cells a similar level of activation observed in presence of NK cells alone, and at higher antibody concentrations in this setting (ET 2.5 : 1 ) the activation was greater than with the bispecific anti-NKp46 x anti-CD19 antibody. Isotype control antibody did not induce activation.
  • the bispecific anti-NKp46 proteins are able to activate NK cells in a target-cell specific manner, unlike full-length monospecific anti-NKp46 antibodies and full- length antibodies of depleting IgG isotypes which also activate NK cells in the absence of target cells.
  • the NK cell activation achieved with anti-NKp46 bispecific proteins was higher than that observed with full length anti-CD19 lgG1 antibodies.
  • NKp46-mediated NK cell activation toward cancer target cells at lower effector: target ratios The ET ratio used in this Example was 1 :1 which is believed to be closer to the setting that would be encountered in vivo than the 2.5:1 ET ratio used in Example 7 or the 10:1 ET ratio of Example 6.
  • NKp46 x CD19 bispecific proteins having an arrangement according to the F2 format described in Example 3 with anti-NKp46 variable domains from NKp46-1 , NKp46-2, NKp46- 3, NKp46-4 or NKp46-9 were compared to:
  • the anti-CD19 antibody as a full-length human lgG1 as ADCC inducing antibody control comparator.
  • the experiments further included as controls: rituximab (an anti-CD20 ADCC inducing antibody control for a target antigen with high expression levels); anti-CD52 antibody alemtuzumab (a human lgG1 , binds CD52 target present on both targets and NK cells), and negative control isotype control therapeutic antibody (a human lgG1 that does not bind a target present on the target cells (HUG1 -IC).
  • the different proteins were tested for functional effect on NK cell activation as assessed by CD69 or CD107 expression in the presence of CD19-positive tumor target cells (Daudi cells), in the presence of CD19- negative, CD16-positive target cells (HUT78 T-lymphoma cells), and in the absence of target cells.
  • the experiments were carried out as in Example 7 except that the ET ratio was 1 :1.
  • bispecific anti-NKp46 x anti-CD19 antibody The activation induced by bispecific anti-NKp46 x anti-CD19 antibody in the presence of Daudi cells was far more potent than the full-length human lgG1 anti-CD19 antibody as ADCC inducing antibody which had low activity in this setting. Furthermore, in this low E:T ratio setting the activation induced by bispecific anti-NKp46 x anti-CD19 antibody was as potent as anti-CD20 antibody rituximab, with a difference being observed only at the highest concentrations that were 10 fold higher than concentrations in which differences were observed at the 2.5:1 ET ratio.
  • the bispecific anti-NKp46 proteins are able to activate NK cells in a target-cell specific manner and at lower effector:target ratio are more effective in mediating NK cell activation that traditional human lgG1 antibodies.
  • NKp46 x CD19 bispecific proteins having an arrangement according to the F2, F3, F5 or F6 formats described in Examples 3 or 4 with anti-NKp46 variable domains from NKp46-3 were compared to rituximab (anti-CD20 ADCC inducing antibody), and a human lgG1 isotype control antibody for functional ability to direct CD16-/NKp46+ NK cell lines to lyse CD19-positive tumor target cells.
  • rituximab anti-CD20 ADCC inducing antibody
  • human lgG1 isotype control antibody for functional ability to direct CD16-/NKp46+ NK cell lines to lyse CD19-positive tumor target cells.
  • the cytolytic activity of the CD16-/NKp46+ human NK cell line KHYG-1 was assessed in a classical 4-h 51 Cr-release assay in U-bottom 96 well plates.
  • each NKp46 x CD19 bispecific protein (Format F2, F3, F5 and F6) induced specific lysis of Daudi or B221 cells by human KHYG-1 hNKp46 NK cell line, while rituximab and human lgG1 isotype control (IC) antibodies did not.
  • NKp46 x CD19 bispecific proteins that bind human CD16 having an arrangement according to the F5 format with anti-NKp46 variable domains from NKp46-3 were compared to the same bispecific antibody as a F6 format (which lacks CD16 binding), and to a human lgG1 isotype anti-CD19 antibody, as well as a human lgG1 isotype control antibody for functional ability to direct purified NK cells to lyse CD19-positive Daudi tumor target cells.
  • results are shown in Figure 7.
  • the CD19-F6-NKp46 (bispecific protein in F6 format) whose Fc domain does not bind CD16 due to a N297 substitution was as potent in mediating NK cell lysis of Daudi target cells as the full-length lgG1 anti-CD19 antibody, which is remarkable considering that the control lgG1 anti-CD19 antibody binds CD19 bivalently and that the anti-CD19 is bound by CD16.
  • the CD19-F6-NKp46 F5 format protein
  • the CD19-F6-NKp46 was at least 1000 times more potent than the full-length anti-CD19 lgG1 .
  • results are shown in Table 4 below.
  • the bispecific proteins having dimeric Fc domains (formats F5, F6, F13, F14) bound to FcRn with affinity similar to that of the full- length lgG1 antibody.
  • the bispecific proteins with monomeric Fc domains (F3, F4, F9, F10, F1 1 ) also displayed binding to FcRn, however with lower affinity that the bispecific proteins having dimeric Fc domains.
  • F5 and F6 bispecific antibodies CD19-F5-NKp46-3 or CD19-F6-NKp46-3 were immobilized covalently to carboxyl groups in the dextran layer on a Sensor Chip CM5.
  • the chip surface was activated with EDC/NHS (N-ethyl-N'-(3-dimethylaminopropyl) carbodiimidehydrochlonde and N-hydroxysuccinimide (Biacore GE Healthcare)).
  • Bispecific antibodies were diluted to 10 ⁇ g ml in coupling buffer (10 mM acetate, pH 5.6) and injected until the appropriate immobilization level was reached (i.e. 800 to 900 RU). Deactivation of the remaining activated groups was performed using 100 mM ethanolamine pH 8 (Biacore GE Healthcare).
  • CD19-F6-NKp46-3 bi-specific antibodies did not bind to any of the receptors.
  • Convention human anti-lgG1 antibodies has comparable binding to the Fc receptors (KD shown in the table below).
  • Biacore T100 SPR measurements were performed on a Biacore T100 apparatus (Biacore GE Healthcare) at 25°C. In all Biacore experiments HBS-EP+ (Biacore GE Healthcare) and NaOH 10mM NaCI 500 mM served as running buffer and regeneration buffer respectively. Sensorgrams were analyzed with Biacore T100 Evaluation software.
  • Anti-6xHis tag antibody was purchased from QIAGEN. Human 6xHis tagged NKp46 recombinant proteins (NKp46- His) were cloned, produced and purified at Innate Pharma.
  • Anti-His antibodies were immobilized covalently to carboxyl groups in the dextran layer on a Sensor Chip CM5.
  • the chip surface was activated with EDC/NHS (N-ethyl-N'-(3- dimethylaminopropyl) carbodiimidehydrochloride and N-hydroxysuccinimide (Biacore GE Healthcare)).
  • Protein-A and Anti-His antibodies were diluted to 10 ⁇ g ml in coupling buffer (10 mM acetate, pH 5.6) and injected until the appropriate immobilization level was reached (i.e. 2000 to 2500 RU). Deactivation of the remaining activated groups was performed using 100 mM ethanolamine pH 8 (Biacore GE Healthcare).
  • NKp46 binding region corresponding to NKp46-1 , NKp46-2, NKp46-3 or NKp46-4 were used for the competition study which has been performed using an Anti-6xHis tag antibody chip.
  • Bispecific antibodies having NKp46 binding region based on NKp46-1 , NKp46-2, NKp46-3 or NKp46-4 at 1 ⁇ g mL were captured onto Protein-A chip and recombinant human NKp46 proteins were injected at 5 ⁇ g mL together with a second test bispecific antibody of the NKp46-1 , NKp46-2, NKp46-3 or NKp46-4 group.
  • NKp46-1 , NKp46-2, NKp46-3 or NKp46-4 competed with one another for binding to NKp46, these antibodies each representing a different epitope.
  • NKp46 mutants defined by one, two or three substitutions of amino acids exposed at the molecular surface over the 2 domains of NKp46. This approach led to the generation of 42 mutants transfected in Hek-293T cells, as shown in the table below.
  • the targeted amino acid mutations in the table 5 below are shown both using numbering of SEQ ID NO: 1 (also corresponding to the numbering used in Jaron-Mendelson et al. (2012) J. Immunol. 88(12):6165-74.
  • NKp46 mutants were generated by PCR.
  • the sequences amplified were run on agarose gel and purified using the Macherey Nagel PCR Clean-Up Gel Extraction kit (reference 740609).
  • the two or three purified PCR products generated for each mutant were then ligated into an expression vector, with the ClonTech InFusion system.
  • the vectors containing the mutated sequences were prepared as Miniprep and sequenced. After sequencing, the vectors containing the mutated sequences were prepared as Midiprep using the Promega PureYieldTM Plasmid Midiprep System.
  • HEK293T cells were grown in DMEM medium (Invitrogen), transfected with vectors using Invitrogen's Lipofectamine 2000 and incubated at 37°C in a C02 incubator for 24 hours prior to testing for transgene expression.
  • Antibody NKp46-1 had decreased binding to the mutant 2 (having a mutation at residues K41 , E42 and E1 19 (numbering in NKp46 wild-type) compared to wild-type NK46. Similarly, NKp46-1 also had decreased binding to the supplementary mutant Supp7 (having a mutation at residues Y121 and Y194.
  • Antibody NKp46-3 had decreased binding to the mutant 19 (having a mutation at residues 1135, and S136. Similarly, NKp46-1 also had decreased binding to the supplementary mutant Supp8 (having a mutation at residues P132 and E133.
  • Antibody NKp46-4 had decreased binding to the mutant 6 (having a mutation at residues R101 , and V102. Similarly, NKp46-1 also had decreased binding to the supplementary mutant Supp6 having a mutation at residues E104 and L105.
  • epitopes for anti-NKp46 antibodies (NKp46-1 , NKp46-3 and NKp46-4).
  • Epitopes of NKp46-4, NKp46-3 and NKp46-1 are on NKp46 D1 domain, D2 domain and D1/D2 junction, respectively.
  • R101 , V102, E104 and L105 are essential residues for NKp46-4 binding and defined a part of NKp46-4 epitope.
  • the epitope of NKp46- 1 epitope includes K41 , E42, E1 19, Y121 and Y194 residues.
  • the epitope of NKp46-3 includes P132, E133, 1135, and S136 residues.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • General Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Microbiology (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Cell Biology (AREA)
  • Rheumatology (AREA)
  • Pain & Pain Management (AREA)
  • Transplantation (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
PCT/EP2016/081953 2015-12-28 2016-12-20 VARIABLE REGIONS FOR NKp46 BINDING PROTEINS Ceased WO2017114694A1 (en)

Priority Applications (11)

Application Number Priority Date Filing Date Title
CN201680082632.4A CN108779175B (zh) 2015-12-28 2016-12-20 NKp46结合蛋白的可变区
CN202210862118.XA CN115925933A (zh) 2015-12-28 2016-12-20 NKp46结合蛋白的可变区
AU2016383475A AU2016383475B2 (en) 2015-12-28 2016-12-20 Variable regions for NKp46 binding proteins
EP16826025.5A EP3397645B1 (en) 2015-12-28 2016-12-20 Variable regions for nkp46 binding proteins
CA3007898A CA3007898A1 (en) 2015-12-28 2016-12-20 Variable regions for nkp46 binding proteins
US16/066,688 US11001629B2 (en) 2015-12-28 2016-12-20 Variable regions for NKp46 binding proteins
JP2018552124A JP7091250B2 (ja) 2015-12-28 2016-12-20 NKp46結合タンパク質の可変領域
US17/315,547 US11891444B2 (en) 2015-12-28 2021-05-10 Variable regions for NKp46 binding proteins
JP2022096649A JP7551693B2 (ja) 2015-12-28 2022-06-15 NKp46結合タンパク質の可変領域
US18/432,126 US20240174748A1 (en) 2015-12-28 2024-02-05 Variable regions for nkp46 binding proteins
JP2024151952A JP2025000628A (ja) 2015-12-28 2024-09-04 NKp46結合タンパク質の可変領域

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201562271474P 2015-12-28 2015-12-28
US62/271,474 2015-12-28

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US16/066,688 A-371-Of-International US11001629B2 (en) 2015-12-28 2016-12-20 Variable regions for NKp46 binding proteins
US17/315,547 Division US11891444B2 (en) 2015-12-28 2021-05-10 Variable regions for NKp46 binding proteins

Publications (1)

Publication Number Publication Date
WO2017114694A1 true WO2017114694A1 (en) 2017-07-06

Family

ID=57796296

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2016/081953 Ceased WO2017114694A1 (en) 2015-12-28 2016-12-20 VARIABLE REGIONS FOR NKp46 BINDING PROTEINS

Country Status (7)

Country Link
US (3) US11001629B2 (enExample)
EP (1) EP3397645B1 (enExample)
JP (3) JP7091250B2 (enExample)
CN (2) CN115925933A (enExample)
AU (1) AU2016383475B2 (enExample)
CA (1) CA3007898A1 (enExample)
WO (1) WO2017114694A1 (enExample)

Cited By (31)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2019101695A1 (en) 2017-11-21 2019-05-31 Innate Pharma Multispecific antigen binding proteins
WO2019226617A1 (en) 2018-05-21 2019-11-28 Compass Therapeutics Llc Compositions and methods for enhancing the killing of target cells by nk cells
JP2021505196A (ja) * 2018-05-29 2021-02-18 康▲諾▼▲亞▼生物医▲薬▼科技(成都)有限公司 自己免疫阻害剤及びその適用
US10975159B2 (en) * 2017-01-06 2021-04-13 Elsalys Biotech Compounds binding human CD160 and uses thereof
WO2021183207A1 (en) 2020-03-10 2021-09-16 Massachusetts Institute Of Technology COMPOSITIONS AND METHODS FOR IMMUNOTHERAPY OF NPM1c-POSITIVE CANCER
WO2021205438A1 (en) * 2020-04-06 2021-10-14 Yissum Research Development Company Of The Hebrew University Of Jerusalem Ltd. Antibodies to nkp46 and constructs thereof for treatment of cancers and infections
WO2022004805A1 (ja) 2020-06-30 2022-01-06 株式会社ガイアバイオメディシン Nk細胞と抗体との結合を安定化する方法、及びその利用
WO2022144836A1 (en) 2020-12-31 2022-07-07 Sanofi Multifunctional natural killer (nk) cell engagers binding to nkp46 and cd123
WO2022200525A1 (en) 2021-03-26 2022-09-29 Innate Pharma Multispecific proteins comprising an nkp46-binding site, a cancer antgienge binding site fused to a cytokine for nk cell engaging
WO2022258662A1 (en) 2021-06-09 2022-12-15 Innate Pharma Multispecific proteins binding to nkp46, a cytokine receptor, a tumour antigen and cd16a
WO2022258673A1 (en) 2021-06-09 2022-12-15 Innate Pharma Multispecific antibodies binding to cd20, nkp46, cd16 and conjugated to il-2
CN116003595A (zh) * 2022-07-11 2023-04-25 南方医科大学第三附属医院(广东省骨科研究院) 靶向nk细胞nkp46受体的纳米抗体及其制备方法和应用
WO2023076883A1 (en) * 2021-10-27 2023-05-04 Samyang Biopharm Usa Inc. Anti-mic antibodies with variant fc domains
WO2023110937A1 (en) 2021-12-14 2023-06-22 INSERM (Institut National de la Santé et de la Recherche Médicale) Depletion of nk cells for the treatment of adverse post-ischemic cardiac remodeling
US11834506B2 (en) 2017-02-08 2023-12-05 Dragonfly Therapeutics, Inc. Multi-specific binding proteins that bind NKG2D, CD16, and a tumor-associated antigen for activation of natural killer cells and therapeutic uses thereof to treat cancer
US11884732B2 (en) 2017-02-20 2024-01-30 Dragonfly Therapeutics, Inc. Proteins binding HER2, NKG2D and CD16
US11884733B2 (en) 2018-02-08 2024-01-30 Dragonfly Therapeutics, Inc. Antibody variable domains targeting the NKG2D receptor
EP4303234A4 (en) * 2021-03-05 2024-10-09 Shanghai Qilu Pharmaceutical Research and Development Centre Ltd. Antibody against nkp46 and application of antibody
WO2024208818A1 (en) 2023-04-04 2024-10-10 Innate Pharma Modular chimeric antigen receptor
WO2024224313A1 (en) 2023-04-24 2024-10-31 Sanofi Use of cd123 nk cell engager for treating aml and related disorders
US12157771B2 (en) 2020-05-06 2024-12-03 Dragonfly Therapeutics, Inc. Proteins binding NKG2D, CD16 and CLEC12A
US12195555B2 (en) 2022-05-27 2025-01-14 Sanofi Natural killer (NK) cell engagers binding to NKp46 and BCMA variants with Fc-engineering
WO2025012704A1 (en) 2023-07-13 2025-01-16 Sanofi Natural killer cells and cd123 nk cell engager combination therapy
US12215157B2 (en) 2018-02-20 2025-02-04 Dragonfly Therapeutics, Inc. Multi-specific binding proteins that bind CD33, NKG2D, and CD16, and methods of use
US12275791B2 (en) 2018-08-08 2025-04-15 Dragonfly Therapeutics, Inc. Multi-specific binding proteins that bind HER2, NKG2D, and CD16, and methods of use
WO2025114919A1 (en) 2023-11-28 2025-06-05 Sanofi Multifunctional natural killer (nk) cell engager combination therapy for treating hematological neoplastic disorders
US12377144B2 (en) 2021-03-03 2025-08-05 Dragonfly Therapeutics, Inc. Methods of treating cancer using multi-specific binding proteins that bind NKG2D, CD16 and a tumor-associated antigen
US12378318B2 (en) 2018-08-08 2025-08-05 Dragonfly Therapeutics, Inc. Proteins binding NKG2D, CD16 and a tumor-associated antigen
US12384847B2 (en) 2018-02-08 2025-08-12 Dragonfly Therapeutics, Inc. Cancer therapy involving an anti-PD1 antibody and a multi-specific binding protein that binds NKG2D, CD16, and a tumor-associated antigen
US12384851B2 (en) 2018-08-08 2025-08-12 Dragonfly Therapeutics, Inc. Multi-specific binding proteins that bind BCMA, NKG2D and CD16, and methods of use
WO2026055280A1 (en) 2024-09-04 2026-03-12 Sanofi Interleukin 2 (il-2) and cd123 nk cell engager combination therapy

Families Citing this family (20)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP6822849B2 (ja) 2014-06-27 2021-01-27 イナート・ファルマ・ソシエテ・アノニムInnate Pharma Pharma S.A. 多重特異的NKp46結合タンパク質
US9767555B2 (en) * 2015-01-05 2017-09-19 Case Western Reserve University Disease characterization from fused pathology and radiology data
AU2016284871B2 (en) * 2015-06-23 2022-09-29 Innate Pharma Multispecific NK engager proteins
US10736963B2 (en) 2015-07-24 2020-08-11 Innate Pharma Methods for detecting tissue infiltrating NK cells
EP3397645B1 (en) 2015-12-28 2026-03-25 Innate Pharma Variable regions for nkp46 binding proteins
CN110300765B (zh) 2017-01-24 2024-08-23 依奈特制药公司 Nkp46结合剂
CN111201030B (zh) 2017-07-25 2024-11-01 真和制药有限公司 通过阻断tim-3和其配体的相互作用治疗癌症
WO2020160156A2 (en) 2019-01-30 2020-08-06 Immutics, Inc. Anti-gal3 antibodies and uses thereof
JP2022525703A (ja) * 2019-03-20 2022-05-18 ジャベリン・オンコロジー・インコーポレイテッド 抗adam12抗体およびキメラ抗原受容体、ならびにそれを含む組成物および方法
CN113637074B (zh) * 2020-05-11 2024-09-24 上海怀越生物科技有限公司 NKp46抗体及其制备方法和应用
EP4157338A4 (en) 2020-05-26 2024-11-13 TrueBinding, Inc. METHOD FOR TREATING INFLAMMATORY DISEASES BY GALECTIN-3 BLOCKING
CN112029001B (zh) * 2020-09-02 2022-09-06 南京北恒生物科技有限公司 靶向nk激活性受体的嵌合抗原受体
JP2024524301A (ja) * 2021-07-02 2024-07-05 ラエクナ セラピューティクス シャンハイ カンパニー リミテッド 活性化肝星細胞(hsc)の枯渇及びその使用
CN115611984A (zh) * 2021-07-16 2023-01-17 上海怀越生物科技有限公司 NKp46抗体及其制备方法和应用
JP2024534838A (ja) * 2021-08-30 2024-09-26 インヒブルクス インコーポレイテッド NKp46結合ポリペプチド及びその使用
WO2023143341A1 (en) * 2022-01-25 2023-08-03 Biocytogen Pharmaceuticals (Beijing) Co., Ltd. Genetically modified non-human animal with human or chimeric nkp46
CN119768434A (zh) * 2022-08-19 2025-04-04 盛禾(中国)生物制药有限公司 一种双特异性抗体及其应用
CN116003627B (zh) * 2022-09-16 2025-05-13 四川大学华西医院 NKG2D-NKp46细胞接合器分子及其用途
CN121399268A (zh) * 2023-06-14 2026-01-23 上海北恒生物科技有限公司 工程化的滋养细胞及其用途
CN117442721B (zh) * 2023-12-20 2024-03-15 苏州艾凯利元生物科技有限公司 一种包括nk细胞和nk细胞接合器分子的组合物

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2005000086A2 (en) * 2003-06-30 2005-01-06 Yissum Research Development Company Of The Hebrew University Of Jerusalem FRAGMENTS OF NKp44 AND NKp46 FOR TARGETING VIRAL-INFECTED AND TUMOR CELLS
WO2005105848A1 (en) * 2004-04-30 2005-11-10 Innate Pharma Compositions and methods for enhancing nk cell activity
WO2015197593A1 (en) * 2014-06-27 2015-12-30 Innate Pharma MULTISPECIFIC NKp46 BINDING PROTEINS
WO2016207278A1 (en) * 2015-06-23 2016-12-29 Innate Pharma Multispecific nk engager proteins

Family Cites Families (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA2288307C (en) * 1999-11-15 2012-05-15 Universita Di Genova Novel triggering receptor involved in natural cytotoxicity mediated by human natural killer cells and antibodies that identify the same
EP1575615A1 (en) * 2002-12-23 2005-09-21 Innate Pharma Pharmaceutical compositions having an effect on the proliferation of nk cells and a method using the same
CN101300272B (zh) * 2005-10-14 2013-09-18 依奈特制药公司 用于治疗增生性病症的组合物和方法
US8426565B2 (en) * 2007-08-30 2013-04-23 Walter And Eliza Hall Institute Of Medical Research Dendritic cell marker and uses thereof
CN102770456B (zh) * 2009-12-04 2018-04-06 弗·哈夫曼-拉罗切有限公司 多特异性抗体、抗体类似物、组合物和方法
TW201138821A (en) * 2010-03-26 2011-11-16 Roche Glycart Ag Bispecific antibodies
US20140234342A1 (en) * 2011-06-21 2014-08-21 Innate Pharma Nkp46-mediated nk cell tuning
ES2747920T3 (es) * 2013-02-14 2020-03-12 Innate Pharma Anticuerpo anti-NKP46 para diagnóstico de un linfoma de células T periféricas no cutáneo (PTCL)
WO2015015489A1 (en) * 2013-07-30 2015-02-05 Biolinerx Ltd. Antibody for treating diabetes and autoimmune diseases
CN106456749B (zh) * 2014-03-11 2021-03-30 小利兰·斯坦福大学托管委员会 抗SIRPα抗体和双特异性巨噬细胞增强型抗体
EP3397645B1 (en) 2015-12-28 2026-03-25 Innate Pharma Variable regions for nkp46 binding proteins
CN110300765B (zh) 2017-01-24 2024-08-23 依奈特制药公司 Nkp46结合剂

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2005000086A2 (en) * 2003-06-30 2005-01-06 Yissum Research Development Company Of The Hebrew University Of Jerusalem FRAGMENTS OF NKp44 AND NKp46 FOR TARGETING VIRAL-INFECTED AND TUMOR CELLS
WO2005105848A1 (en) * 2004-04-30 2005-11-10 Innate Pharma Compositions and methods for enhancing nk cell activity
WO2015197593A1 (en) * 2014-06-27 2015-12-30 Innate Pharma MULTISPECIFIC NKp46 BINDING PROTEINS
WO2016207278A1 (en) * 2015-06-23 2016-12-29 Innate Pharma Multispecific nk engager proteins

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
KIPRIYANOV S M ET AL: "Recent advances in the generation of bispecific antibodies for tumor immunotherapy", CURRENT OPINION IN DRUG DISCOVERY AND DEVELOPMENT, CURRENT DRUGS, LONDON, GB, vol. 7, no. 2, 1 March 2004 (2004-03-01), pages 233 - 242, XP008082067, ISSN: 1367-6733 *
MARKUS BOLZHAUSER: "Immuntherapie der kindlichen ALL: Einfluss eines bispezifischen CD19*NKp46-Antikörpers auf die zytotoxische Aktivität von NK-Zellen gegenüber CD19 + ALL-Blasten pädiatrischer Patienten", INAUGURAL-DISSERTATION ZUR ERLANGUNG DES DOKTORGRADES DER MEDIZIN DER MEDIZINISCHEN FAKULTÄT DER EBERHARD-KARLS-UNIVERSITÄT ZU TÜBINGEN, 1 January 2010 (2010-01-01), pages 116 pp., XP055209900, Retrieved from the Internet <URL:http://d-nb.info/1003819621/34> [retrieved on 20150827] *

Cited By (42)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10975159B2 (en) * 2017-01-06 2021-04-13 Elsalys Biotech Compounds binding human CD160 and uses thereof
US11834506B2 (en) 2017-02-08 2023-12-05 Dragonfly Therapeutics, Inc. Multi-specific binding proteins that bind NKG2D, CD16, and a tumor-associated antigen for activation of natural killer cells and therapeutic uses thereof to treat cancer
US11884732B2 (en) 2017-02-20 2024-01-30 Dragonfly Therapeutics, Inc. Proteins binding HER2, NKG2D and CD16
WO2019101695A1 (en) 2017-11-21 2019-05-31 Innate Pharma Multispecific antigen binding proteins
US12384847B2 (en) 2018-02-08 2025-08-12 Dragonfly Therapeutics, Inc. Cancer therapy involving an anti-PD1 antibody and a multi-specific binding protein that binds NKG2D, CD16, and a tumor-associated antigen
US12264200B2 (en) 2018-02-08 2025-04-01 Dragonfly Therapeutics, Inc. Antibody variable domains targeting the NKG2D receptor
US12129300B2 (en) 2018-02-08 2024-10-29 Dragonfly Therapeutics, Inc. Antibody variable domains targeting the NKG2D receptor
US11939384B1 (en) 2018-02-08 2024-03-26 Dragonfly Therapeutics, Inc. Antibody variable domains targeting the NKG2D receptor
US11884733B2 (en) 2018-02-08 2024-01-30 Dragonfly Therapeutics, Inc. Antibody variable domains targeting the NKG2D receptor
US12215157B2 (en) 2018-02-20 2025-02-04 Dragonfly Therapeutics, Inc. Multi-specific binding proteins that bind CD33, NKG2D, and CD16, and methods of use
WO2019226617A1 (en) 2018-05-21 2019-11-28 Compass Therapeutics Llc Compositions and methods for enhancing the killing of target cells by nk cells
JP7072077B2 (ja) 2018-05-29 2022-05-19 康▲諾▼▲亞▼生物医▲薬▼科技(成都)有限公司 自己免疫阻害剤及びその適用
JP2021505196A (ja) * 2018-05-29 2021-02-18 康▲諾▼▲亞▼生物医▲薬▼科技(成都)有限公司 自己免疫阻害剤及びその適用
US12503514B2 (en) 2018-05-29 2025-12-23 Keymed Biosciences Co., Ltd. Autoimmune suppressor and application thereof
US11725057B2 (en) 2018-05-29 2023-08-15 Keymed Biosciences Co., Ltd. Autoimmune suppressor and application thereof
US12384851B2 (en) 2018-08-08 2025-08-12 Dragonfly Therapeutics, Inc. Multi-specific binding proteins that bind BCMA, NKG2D and CD16, and methods of use
US12275791B2 (en) 2018-08-08 2025-04-15 Dragonfly Therapeutics, Inc. Multi-specific binding proteins that bind HER2, NKG2D, and CD16, and methods of use
US12378318B2 (en) 2018-08-08 2025-08-05 Dragonfly Therapeutics, Inc. Proteins binding NKG2D, CD16 and a tumor-associated antigen
WO2021183207A1 (en) 2020-03-10 2021-09-16 Massachusetts Institute Of Technology COMPOSITIONS AND METHODS FOR IMMUNOTHERAPY OF NPM1c-POSITIVE CANCER
US20230183342A1 (en) * 2020-04-06 2023-06-15 Yissum Research Development Company Of The Hebrew University Of Jerusalem Ltd. Antibodies to nkp46 and constructs thereof for treatment of cancers and infections
WO2021205438A1 (en) * 2020-04-06 2021-10-14 Yissum Research Development Company Of The Hebrew University Of Jerusalem Ltd. Antibodies to nkp46 and constructs thereof for treatment of cancers and infections
US12157771B2 (en) 2020-05-06 2024-12-03 Dragonfly Therapeutics, Inc. Proteins binding NKG2D, CD16 and CLEC12A
CN115803037A (zh) * 2020-06-30 2023-03-14 盖亚生物制药有限公司 稳定nk细胞与抗体的结合的方法及其应用
WO2022004805A1 (ja) 2020-06-30 2022-01-06 株式会社ガイアバイオメディシン Nk細胞と抗体との結合を安定化する方法、及びその利用
WO2022144836A1 (en) 2020-12-31 2022-07-07 Sanofi Multifunctional natural killer (nk) cell engagers binding to nkp46 and cd123
US11692039B2 (en) 2020-12-31 2023-07-04 Innate Pharma Multifunctional natural killer (NK) cell engagers binding to NKp46 and CD123
TWI905354B (zh) * 2020-12-31 2025-11-21 法商英耐特醫藥公司 結合至NKp46及CD123之多功能自然殺手 (NK) 細胞接合體
US12377144B2 (en) 2021-03-03 2025-08-05 Dragonfly Therapeutics, Inc. Methods of treating cancer using multi-specific binding proteins that bind NKG2D, CD16 and a tumor-associated antigen
EP4303234A4 (en) * 2021-03-05 2024-10-09 Shanghai Qilu Pharmaceutical Research and Development Centre Ltd. Antibody against nkp46 and application of antibody
WO2022200525A1 (en) 2021-03-26 2022-09-29 Innate Pharma Multispecific proteins comprising an nkp46-binding site, a cancer antgienge binding site fused to a cytokine for nk cell engaging
WO2022258662A1 (en) 2021-06-09 2022-12-15 Innate Pharma Multispecific proteins binding to nkp46, a cytokine receptor, a tumour antigen and cd16a
WO2022258673A1 (en) 2021-06-09 2022-12-15 Innate Pharma Multispecific antibodies binding to cd20, nkp46, cd16 and conjugated to il-2
WO2023076883A1 (en) * 2021-10-27 2023-05-04 Samyang Biopharm Usa Inc. Anti-mic antibodies with variant fc domains
WO2023110937A1 (en) 2021-12-14 2023-06-22 INSERM (Institut National de la Santé et de la Recherche Médicale) Depletion of nk cells for the treatment of adverse post-ischemic cardiac remodeling
US12195555B2 (en) 2022-05-27 2025-01-14 Sanofi Natural killer (NK) cell engagers binding to NKp46 and BCMA variants with Fc-engineering
CN116003595B (zh) * 2022-07-11 2024-02-02 南方医科大学第三附属医院(广东省骨科研究院) 靶向nk细胞nkp46受体的纳米抗体及其制备方法和应用
CN116003595A (zh) * 2022-07-11 2023-04-25 南方医科大学第三附属医院(广东省骨科研究院) 靶向nk细胞nkp46受体的纳米抗体及其制备方法和应用
WO2024208818A1 (en) 2023-04-04 2024-10-10 Innate Pharma Modular chimeric antigen receptor
WO2024224313A1 (en) 2023-04-24 2024-10-31 Sanofi Use of cd123 nk cell engager for treating aml and related disorders
WO2025012704A1 (en) 2023-07-13 2025-01-16 Sanofi Natural killer cells and cd123 nk cell engager combination therapy
WO2025114919A1 (en) 2023-11-28 2025-06-05 Sanofi Multifunctional natural killer (nk) cell engager combination therapy for treating hematological neoplastic disorders
WO2026055280A1 (en) 2024-09-04 2026-03-12 Sanofi Interleukin 2 (il-2) and cd123 nk cell engager combination therapy

Also Published As

Publication number Publication date
JP7551693B2 (ja) 2024-09-17
EP3397645B1 (en) 2026-03-25
JP7091250B2 (ja) 2022-06-27
CN108779175A (zh) 2018-11-09
US20180355036A1 (en) 2018-12-13
AU2016383475B2 (en) 2024-02-22
AU2016383475A1 (en) 2018-06-28
EP3397645A1 (en) 2018-11-07
JP2025000628A (ja) 2025-01-07
CN115925933A (zh) 2023-04-07
CA3007898A1 (en) 2017-07-06
JP2019503713A (ja) 2019-02-14
JP2022137054A (ja) 2022-09-21
US20210269523A1 (en) 2021-09-02
US11001629B2 (en) 2021-05-11
CN108779175B (zh) 2022-07-08
US20240174748A1 (en) 2024-05-30
US11891444B2 (en) 2024-02-06

Similar Documents

Publication Publication Date Title
US11891444B2 (en) Variable regions for NKp46 binding proteins
AU2021200972B2 (en) MULTISPECIFIC NKp46 BINDING PROTEINS
US20250215107A1 (en) Multispecific nk engager protein
EP3160994B1 (en) Multispecific antigen binding proteins
AU2016284866A1 (en) Multispecific antigen binding proteins
CA2990518C (en) Multispecific nk engager proteins

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16826025

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3007898

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2018552124

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2016383475

Country of ref document: AU

Date of ref document: 20161220

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2016826025

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2016826025

Country of ref document: EP

Effective date: 20180730

WWG Wipo information: grant in national office

Ref document number: 2016826025

Country of ref document: EP