WO2017083750A1 - Compositions and methods for expression of multiple biologically active polypeptides from a single vector for treatment of cardiac conditions and other pathologies - Google Patents

Compositions and methods for expression of multiple biologically active polypeptides from a single vector for treatment of cardiac conditions and other pathologies Download PDF

Info

Publication number
WO2017083750A1
WO2017083750A1 PCT/US2016/061668 US2016061668W WO2017083750A1 WO 2017083750 A1 WO2017083750 A1 WO 2017083750A1 US 2016061668 W US2016061668 W US 2016061668W WO 2017083750 A1 WO2017083750 A1 WO 2017083750A1
Authority
WO
WIPO (PCT)
Prior art keywords
polypeptide
seq
polynucleotide
sequence
linker
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2016/061668
Other languages
English (en)
French (fr)
Inventor
Dimki S. PATEL
Amit N. Patel
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Precigen Inc
Original Assignee
Intrexon Corp
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to HK19101096.0A priority Critical patent/HK1259137A1/zh
Priority to SG11201803934YA priority patent/SG11201803934YA/en
Priority to CN201680078586.0A priority patent/CN108713025A/zh
Priority to BR112018009645A priority patent/BR112018009645A2/pt
Priority to MX2018005886A priority patent/MX2018005886A/es
Priority to JP2018524443A priority patent/JP6976244B2/ja
Priority to CA3004742A priority patent/CA3004742A1/en
Priority to AU2016353342A priority patent/AU2016353342B2/en
Priority to RU2018117674A priority patent/RU2758489C2/ru
Application filed by Intrexon Corp filed Critical Intrexon Corp
Priority to EP16810130.1A priority patent/EP3387010A1/en
Priority to KR1020187016185A priority patent/KR20180069081A/ko
Publication of WO2017083750A1 publication Critical patent/WO2017083750A1/en
Priority to US15/978,036 priority patent/US11154622B2/en
Anticipated expiration legal-status Critical
Priority to US17/481,938 priority patent/US20220072159A1/en
Priority to US18/485,838 priority patent/US20240148908A1/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • A61K48/005Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
    • A61K48/0058Nucleic acids adapted for tissue specific expression, e.g. having tissue specific promoters as part of a contruct
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4728Calcium binding proteins, e.g. calmodulin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/1703Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • A61K38/1709Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • A61K38/1738Calcium binding proteins, e.g. calmodulin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/18Growth factors; Growth regulators
    • A61K38/1858Platelet-derived growth factor [PDGF]
    • A61K38/1866Vascular endothelial growth factor [VEGF]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/19Cytokines; Lymphokines; Interferons
    • A61K38/195Chemokines, e.g. RANTES
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K41/00Medicinal preparations obtained by treating materials with wave energy or particle radiation ; Therapies using these preparations
    • A61K41/0028Disruption, e.g. by heat or ultrasounds, sonophysical or sonochemical activation, e.g. thermosensitive or heat-sensitive liposomes, disruption of calculi with a medicinal preparation and ultrasounds
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/475Growth factors; Growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/521Chemokines
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/62DNA sequences coding for fusion proteins
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/50Fusion polypeptide containing protease site
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2840/00Vectors comprising a special translation-regulating system
    • C12N2840/002Vectors comprising a special translation-regulating system controllable or inducible
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2840/00Vectors comprising a special translation-regulating system
    • C12N2840/007Vectors comprising a special translation-regulating system cell or tissue specific

Definitions

  • the present invention provides novel nucleic acids and vectors, and polypeptides encoded by same, for multigenic therapeutic treatment of diseases, disorders and pathologic conditions. More particularly, the present invention provides novel nucleic acids, vectors, polypeptides and methods for multigenic treatment and prevention of cardiac diseases and disorders. Moreover, the present invention provides novel nucleic acids and polypeptide linkers, which provide advantageous protein expression from nucleic acids and vectors, useful for multigenic therapeutic treatment of diseases, disorders and pathologic conditions.
  • Cardiac disease represents a significant unmet medical need; with some estimates indicating at least 25 million patients worldwide. Moreover, according to the United States of America (U.S.) government’s Centers for Disease Control and Prevention (CDC)“Heart Failure Fact Sheet” as of 2013, over 5 million people in the U.S. have heart failure conditions.
  • U.S. United States of America
  • CDC Centers for Disease Control and Prevention
  • Heart failure has been estimated to cause 1 in 9 deaths with as many as 825,000 new cases each year.
  • the average survival rate 5 years after diagnosis is at about 40% and represents the highest hospital readmission rate among any diagnosis-related group.
  • the cost in the U.S. has been estimated to be as high as $32 billion per year.
  • Heart failure treatment options include medications, invasive devices, and heart transplant.
  • Congestive heart failure describes the inability of the heart to provide sufficient cardiac output to supply the metabolic demand of the body.
  • CHF Congestive heart failure
  • AHA American Heart Association
  • cardiovascular disease claimed 810,000 lives in the United States in 2013, which accounts for ⁇ 1 in every 3 reported deaths.
  • ACE inhibitors angiotensin II type I receptor antagonists, selected ⁇ -blockers, and aldosterone antagonists
  • control of symptoms diuretics (eventually thiazide plus loop diuretic), digitalis (low dose); temporary inotropes, and selected anti-arrhythmics); and 3) palliation (opioids, antidepressants, anxiolytics, oxygen and continuous inotropes).
  • CTR cardiac resynchronization therapy
  • ICD implantable cardioverter-defibrillator
  • VAD ventricular assist devices
  • CHF congestive heart failure
  • LVAD left ventricular assist device
  • a single gene-based approach to treating cardiac disorders is reasonable in patients with unique genetic mutations, i.e. Troponin I or Heavy chain myosin.
  • Troponin I or Heavy chain myosin the end- stage disease is due to multiple factors. Therefore, in such cases a single gene approach is unlikely to work.
  • Cardiac patients usually have scar tissue requiring positive remodeling via cell recruitment and/or angiogenesis. They usually also require an increase in inotropic function via calcium or other pathways.
  • a combination of genes which effect calcium handling, cell recruitment and angiogenesis together provides a more appropriate path to treat and recover these end-stage CHF patients.
  • the use of a viral vectors may antagonize the human immune system, or patients may already have pre- formed anti-viral antibodies (e.g., anti-AAV1/AAV2 antibodies), which could cause safety and efficacy issues.
  • anti-viral antibodies e.g., anti-AAV1/AAV2 antibodies
  • the use of plasmid DNA which has low to no adverse immune response in humans and can be re-dosed as needed, provides an advantageous mode of therapeutic gene delivery.
  • one embodiment of the present invention provides a triple effector non-viral plasmid-based DNA for therapeutic treatment of cardiac diseases and disorders (for example, but not limited to, CHF).
  • the present invention provides a triple effector non-viral plasmid-based DNA vector (construct).
  • an expression plasmid referred to as pXoX encodes and expresses biologically active SDF1 ⁇ , S100A1, and VEGF, wherein these three effector genes of interest (GOI) are separated by selectively designed linker sequences described herein.
  • a multigenic plasmid DNA approach to treat cardiac diseases and disorders is based on positive in vitro, pre-clinical and clinical data from other studies in which single genes have been utilized.
  • Each gene of interest described below has a specific function for inotropy (e.g., S100A1), cell homing (e.g., SDF-1 ⁇ ), and angiogenesis (e.g., VEGF165).
  • inotropy e.g., S100A1
  • cell homing e.g., SDF-1 ⁇
  • angiogenesis e.g., VEGF165.
  • the rationale for a single plasmid construct comprising all three genes, instead of each individual gene on separately delivered plasmids, is that if single genes (on individual, separate vectors) are delivered to cells, there is no means by which the amount of transfection of each gene to a cell can be controlled.
  • vectors such as pXoX constitutively express S100A1 (an intracellular protein), SDF-1 ⁇ (a secreted protein), and VEGF165 (a secreted protein).
  • S100A1 an intracellular protein
  • SDF-1 ⁇ a secreted protein
  • VEGF165 a secreted protein
  • the 2A self-cleaving peptide encodes a sequence (P2A) that mediates a translational effect known as“ribosome skipping”,“stop-go” and“stop- carry on” translation that results in co-expression of multiple proteins from a single transcript mRNA under the control of a single promoter.
  • Constitutive expression is driven by promoters, such as, but not limited to, a CAG promoter (a hybrid promoter containing the chicken beta- actin (CBA) promoter with a CMV enhancer and hybrid CBA exon 1/rabbit beta-globin intron B). Further description of three effectors and their rationale for inclusion in constructs of the invention are described below.
  • S100A1 is a member of the Ca2+-binding EF-hand protein superfamily (Rohde et al, J Cardiovasc Transl Res, vol.3, no.5, pp.525-537, 2010). S100A1 is a 10.4 kDa protein that functions as a homodimer primarily in cardiomyocytes to regulate Ca2+-controlled networks and fluxes to control contractile function, excitability, metabolism, maintenance, and survival.
  • AAV6-S100A1 in a pig model of heart failure demonstrated the safety of over-expression of S100A1 demonstrating no increase in arrhythmias or right ventricular dysfunction; however, there was a significant increase in left ventricular ejection fraction and cardiac remodeling (Weber et al, Gene Ther, vol.21, pp.131- 138, 2014). Studies such as these support the potential for S100A1 therapy in humans with end- stage heart failure.
  • Stromal cell-derived factor-1 ⁇ is an 8 kDa chemokine that plays an important role in recruitment of cardiac stem cells, inhibition of cardiac myocyte death, and improvement in cardiac function by binding to receptor CXCR4 on mesenchymal stem cells (Penn et al, Gene Ther, vol.19, no.6, pp.583-587, 2012).
  • a non-viral DNA plasmid encoding human SDF-1 ⁇ was tested in several clinical trials (Penn et al., Circ Res, vol.112, no.5, pp.816-825, 2013; and, Chung et al, Eur Heart J, vol.36, pp.2228-2238, 2015).
  • VEGF vascular endothelial growth factor
  • VEGF 165 has a sequence comprising amino acids 27-191 of a VEGF191 sequence disclosed herein.
  • VEGF 165 has a sequence comprising amino acids 27, 28, 29, 30, 31, 32, 33, or 34 to 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, or 191 of a VEGF191 sequence disclosed herein. In certain embodiments, VEGF 165 has a sequence comprising amino acids 30-185 of a VEGF191 sequence disclosed herein.
  • the CAG promoter utilized in conjunction with each individual gene i.e., S100A1, SDF1 ⁇ , and VEGF165
  • S100A1, SDF1 ⁇ , and VEGF165 has demonstrated the individual effects on scar tissue, cardiac function and remodeling.
  • the effect of each gene is unique on cardiac tissue.
  • the potential enhanced effect of all three genes has been tested only in vitro.
  • local administration of the combination of VEGF with SDF-1 ⁇ has been demonstrated to be enhanced in a murine model of hind limb ischemia by promoting endothelial progenitor cell-induced neovascularization (Yu et al, J Vasc Surg, vol.50, no.3, pp.608-616, 2009).
  • polynucleotide constructs (such as, but not limited to, non-viral plasmid vectors) encoding a polypeptide comprising a first functional (i.e., biologically active) polypeptide, a second functional polypeptide and, optionally, a third functional polypeptide.
  • polypeptide comprising an S100 polypeptide, a second functional polypeptide and, optionally, a third functional polypeptide, wherein the second and, optional, third functional polypeptides comprise any one of a cytokine, a chemokine, or an angiogenic polypeptide.
  • polynucleotide constructs comprising polynucleotide sequences encoding polypeptide linker sequences for separation of the first and second and, optionally, separation of the second and third functional polypeptides.
  • polypeptides encoded by a polynucleotide described herein are also provided. Also provided are cells comprising at least one polynucleotide or vector described herein.
  • a cardiac condition comprising contacting a cell with a therapeutically effective amount of a polynucleotide described herein.
  • the cell is a myocardial cell.
  • cardiac diseases and disorders for example, but not limited to, congestive heart failure (CHF), in a subject comprising providing to a subject a therapeutically effective amount of a composition comprising a polynucleotide or vector described herein.
  • CHF congestive heart failure
  • the subject is a mammal or human subject.
  • the subject is administered at least one additional therapy.
  • compositions comprising a polynucleotide described herein, or a polypeptide encoded by a polynucleotide described herein and a pharmaceutically acceptable excipient.
  • compositions comprising: at least one plasmid microbubble complex, wherein the microbubble comprises a lipid, a gas and a plasmid comprising a polynucleotide described herein.
  • the lipid forms a shell enclosing said gas and plasmid.
  • the gas is a perfluorocarbon gas, such as perfluoropropane.
  • the microbubble complex comprises at least one of l,2-dipalmitoyl-sn-glycero-3 - phosphatidylcholine and l,2-dipalmitoyl-sn-glycero-3-phosphatidylethanolamine glycerol.
  • tissue or organ is an organ, which can be the heart, liver, or kidney.
  • a method of treating a cardiac disease or disorder for example, but not limited to, congestive heart failure, cardiomyopathy, arrhythmia, pericardial disease, aorta disease, marfan syndrome and coronary artery disease.
  • a cardiac disease or disorder for example, but not limited to, congestive heart failure, cardiomyopathy, arrhythmia, pericardial disease, aorta disease, marfan syndrome and coronary artery disease.
  • a cardiac disease or disorder for example, but not limited to, congestive heart failure, cardiomyopathy, arrhythmia, pericardial disease, aorta disease, marfan syndrome and coronary artery disease.
  • FIG.1 displays ways in which non-viral delivery of cardiac effector genes is
  • FIG.2 shows persistent expression of Luciferase in cardiomyocytes from constructs comprising linkers described herein, in primary cells (in vitro) via introduction of vectors comprising att-site-luciferase with SPBc2 (recombinase) transfection. Cells lacking either att- site or recombinase rapidly returned to baseline expression levels. Day 2 (D2), Day 5 (D5), Day 9 (D9), Day 14 (D14).
  • FIG.3 shows data for luciferase expression achieved in a rodent model from a plasmid vector backbone from which cardiac effector genes (pXoX encoding biologically active SDF1 ⁇ , S100A1, and VEGF) may be expressed, via separation by linkers described herein.
  • cardiac effector genes pXoX encoding biologically active SDF1 ⁇ , S100A1, and VEGF
  • FIG.4 shows various stages of progress through heart failure conditions and the corresponding standard-of-care modes and methods for intervention and treatment.
  • FIG.5A and FIG.5B show a HUVEC proliferation assay.
  • HUVEC proliferation was measured by CellTiter-Glo.
  • FIG.6 shows HUVEC proliferation following treatment with transfected
  • Cardiomyocyte-iPSC supernatants Cardiomyocyte-iPSC supernatants. Cardiomyocyte-iPSC were obtained from patients with dilated cardiomyopathy (DCM), (hypertrophy cardiomyopathy (HCM) or healthy controls, demonstrating successful expression and activity of functional polypeptides encoded by polynucleotides described herein, comprising linkers disclosed herein.
  • DCM dilated cardiomyopathy
  • HCM hypertrophy cardiomyopathy
  • FIG.7 shows iPSC-CMs transfected with singe gene, double gene, and triple-gene SDF1 polypeptide constructs showing elevated migration of peripheral blood lymphocytes (PBLs), demonstrating successful expression and activity of functional polypeptides encoded by polynucleotides described herein, comprising linkers disclosed herein.
  • PBLs peripheral blood lymphocytes
  • FIG.8 shows a migration assay where AMD3100 (CXCR4 antagonist) specifically inhibited SDF1-CXCR4 dependent migration. Data shows that SDF1 is functional in double gene and triple-gene constructs, as migration is reduced in presence of AMD3100.
  • FIG.9 shows a porcine study in which bioluminescence images illustrate retrograde perfusion through the coronary sinus of a reporter plasmid, also incorporating a linker described herein, results in delivery to the heart and expression of the delivered reporter gene after 24 hours.
  • Three plasmid doses (40, 80, and 120 mg) were tested in triplicate.
  • FIG.10 shows a migration assay in which cardiomyocytes were transfected with double gene and triple-gene constructs expressing SDF1.
  • Jurkat cell migration using supernatant from the iPSC CMs shows that the transfected and SDF1 protein is functional and produces significant migration, demonstrating successful expression and activity of functional polypeptides encoded by polynucleotides described herein, comprising linkers disclosed herein.
  • FIG.11 shows a migration assay in which cardiomyocytes were transfected with double gene and triple-gene constructs expressing SDF1.
  • Jurkat cell migration using supernatant from the iPSC CMs shows that the transfection and SDF1 protein is functional and produces significant migration.
  • Data shows a dose dependent migration of Jurkat cells, demonstrating successful expression and activity of functional polypeptides encoded by polynucleotides described herein, comprising linkers disclosed herein.
  • FIG.12 shows cardiomyocytes from a dilated cardiomyopathy subject were transfected with double gene and triple-gene constructs encoding for SDF1. Data show SDF1 dependent Jurkat cell migration. SDF1 expressed by double gene and triple-gene vector constructs in Dilated Cardiomyopathy iPSC-CMs is functional.
  • FIG.13 shows cardiomyocytes from a hypertrophic cardiomyopathy subject were transfected with double gene and triple-gene constructs encoding for SDF1. Data show SDF1 dependent Jurkat cell migration. SDF1 expressed by double gene and triple-gene constructs in hypertrophic cardiomyopathy iPSC-CMs is functional.
  • FIG.14A and FIG.14B shows a proliferation assay performed on HUVECS.
  • A. shows that transfected cardiomyocytes from a DCM subject with double gene and triple-gene constructs produce functional VEGF protein able to induce HUVEC proliferation.
  • FIG.14B shows that transfected cardiomyocytes from a healthy subject with double gene and triple-gene constructs produce functional VEGF protein which is able to induce HUVEC proliferation.
  • FIG.15 A and FIG.15 B depict SDF1 protein expression in 293 T cells transfected with a double gene vector encoding for S100A1-SDF1.
  • FIG.16 A and FIG 16B depict VEGF protein expression in 293 T cells transfected with a double gene vector encoding for S100A1-VEGF191.
  • FIG.17 A and FIG 17B depict S100A1 protein expression in 293 T cells transfected with a double gene vector encoding for S100A1-SDF1.
  • FIG.18 shows a bar graph of S100A1 concentrations as produced by cardiomyocytes transfected with single-gene, double-gene and triple-gene constructs.
  • FIG.19 shows a bar graph of SDF-1 ⁇ concentrations as produced by cardiomyocytes transfected with single-gene, double-gene and triple-gene constructs.
  • FIG.20 shows a bar graph of VEGF concentrations as produced by cardiomyocytes transfected with single-gene, double-gene and triple-gene constructs.
  • FIG.21 shows Western blot (immunoblot) detection of S100A1 polypeptide cleavage as produced by cardiomyocytes transfected with single-gene, double-gene and triple-gene constructs.
  • FIG.22 shows Western blot (immunoblot) detection of SDF-1 ⁇ polypeptide cleavage as produced by cardiomyocytes transfected with single-gene, double-gene and triple-gene constructs.
  • FIG.23 shows Western blot (immunoblot) detection of VEGF polypeptide cleavage as produced by cardiomyocytes transfected with single-gene, double-gene and triple-gene constructs.
  • FIG.24 shows formation of dimeric S100A1 expressed from triple-gene constructs, using linkers of the invention, as detected via non-denaturing PAGE and immunoblotting.
  • FIG.25 A and FIG.25 B show a comparison of iPSC cells from a dilated
  • cardiomyopathy patients vs. a healthy control in terms of A. beat rate of iPSC cells transfected with pStuffer, a vector encoding for pS100A1, or a vector encoding for S100A1 comprising a 2A tail.
  • the data indicates that the presence of a 2A tail at the 3’ end of a vector encoding for S100A1 does not affect the function of S100A1.
  • pStuffer is a plasmid with the same backbone configuration as pXoX, with the open reading frame (ORF) replaced with a non-expressing, similar-sized stuffer sequence.
  • FIG.26 A, FIG.26 B, and FIG.26 C show a comparison of iPSC cells from a dilated cardiomyopathy patients vs. a healthy control in terms of
  • FIG.27 A and FIG.27 B show a triple-gene vector encoding for S100A1, SDF-1alpha, and VEGF165.
  • FIG.27 A shows a schematic depiction of the pXoX triple gene vector encoding biologically active SDF1 ⁇ , S100A1, and VEGF.
  • FIG.27 B identifies individual gene elements in the triple-gene vector.
  • FIG.28 shows data for expression of VEGF in a recombinase titration experiments. Data indicates integration of VEGF into genomic DNA.
  • FIG.29 shows data for expression of SDF-1 ⁇ in a recombinase titration experiments. Data indicates integration of SDF-1 ⁇ into genomic DNA.
  • FIG.30 shows data for expression of S100A1 in a recombinase titration experiments. Data indicates integration of S100A1 into genomic DNA.
  • FIGs.31 A-C show in vivo therapeutic results via echocardiographic measurement of cardiac structure and as function of fractional shortening.
  • FIG.31 A shows results as a function of percent fractional shortening.
  • FIG.31B shows left ventricle posterior wall thickness (cm) of the pStuffer construct as compared to the pXoX construct.
  • FIG.31C shows IVSd (cm) of the pStuffer construct as compared to pXoX construct. Values are presented as mean ⁇ SEM.
  • FIG.32 shows results of nuclear localization of PHH3 (phospho-histone H3 (Ser10)) Mitotic marker signal in cardiac cells demonstrating cardiomyocyte regeneration. Representative images of 4 out of 8 rats per plasmid. Scale bar is 25 ⁇ m.
  • FIG.33 shows imaging results demonstrating negative results of ISL-1, a marker of early cardiac progenitor cells confirming progenitor cells are not involved in regeneration.
  • the S100 family of proteins includes, for instance, S100A1, S100A2, S100A3, S100A4, S100A5, S100A6, S100A7, S100A8, S100A9, S100A10, S100A11, S100A12, S100A13, S100A14, S100A15, and S100A16.
  • proteins similar to a S100A protein for instance S100A7L (S100 calcium binding protein A7-like).
  • Other S100 proteins include S100B, S100G, S100P and S100Z and variants and fragments thereof which may be included in embodiments described herein.
  • S100 proteins which are the result of pseudogene products that may be expressed by vectors described herein.[61]
  • the SDF family of proteins include for instance, a protein encoded by an antimicrobial gene that can encode a stromal cell-derived alpha chemokine member of an intercrine family.
  • Embodiments described herein can comprise encoded proteins which may function as ligands for a G-protein coupled receptor, chemokine (C-X-C motif) receptor 4, and may play a role in many diverse cellular functions, including embryogenesis, immune surveillance, inflammation response, tissue homeostasis, and tumor growth and metastasis.
  • transcript variants encoding different isoforms, and said isoforms and transcript variants may be expressed by vectors described herein.
  • SDF family proteins wherein the first two cysteine residues are separated by one amino acid (C-X-C chemokine).
  • C-X-C chemokine The following protein isoforms have been identified in humans and may be expressed by vectors described herein and included in methods and compositions described herein: SDF-1 Alpha, SDF-1 Beta, SDF-1 Gamma, SDF-1 Delta, SDF-1 Epsilon and SDF-1 Theta, and fragments and variants thereof.
  • the VEGF family of proteins described herein includes members of the PDGF/VEGF growth factor family. For instance included in methods and compositions described herein, can be splice variants and isoforms and fragments and derivatives of VEGF121, VEGF121b, VEGF145, VEGF165, VEGF165b, VEGF189, VEGF191, VEGF206. [63].
  • the S100 polypeptide can be a S100A1, and any functional derivative thereof.
  • the second functional polypeptide can be an angiogenic polypeptide.
  • An angiogenic polypeptide can be a vascular endothelial growth factor (VEGF) polypeptide.
  • VEGF vascular endothelial growth factor
  • a VEGF polypeptide is selected from a group consisting of VEGF121, VEGF121b, VEGF145, VEGF165, VEGF165b, VEGF189, VEGF191, VEGF206, fragments and variants thereof.
  • VEGF 165 has a sequence comprising amino acids 27-191 of a VEGF191 sequence disclosed herein.
  • VEGF 165 has a sequence comprising amino acids 27, 28, 29, 30, 31, 32, 33, or 34 to 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, or 191 of a VEGF191 sequence disclosed herein.
  • VEGF 165 has a sequence comprising amino acids 30-185 of a VEGF191 sequence disclosed herein.
  • a VEGF polypeptide described herein can comprise a sequence with at least 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identity to the sequence of VEGF 191 or VEGF165 disclosed herein.
  • a VEGF polypeptide can comprise a sequence with at least 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identity to the sequence of VEGF191 polypeptide disclosed herein.
  • the third functional polypeptide can be a chemokine.
  • the chemokine can be a stromal cell derived factor 1 (SDF) polypeptide.
  • SDF polypeptide can be selected from the group consisting of SDF1, SDF-1 ⁇ , SDF-1 ⁇ , fragments and variants thereof.[62].
  • An SDF polypeptide can comprise a sequence with at least 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identity to the sequence of SDF1 polypeptide disclosed herein.
  • an S100 polypeptide can be connected to the second polypeptide by a first polypeptide linker.
  • the polypeptide linker can be a cleavable linker or an uncleavable linker.
  • a polypeptide construct encoded by a polynucleotide described herein can comprise a calcium-binding protein (S100) polypeptide, a second functional polypeptide, and further comprise a third functional polypeptide.
  • the third functional polypeptide can be any one of a cytokine, a chemokine, an angiogenic polypeptide, and any functional derivative thereof.
  • the third functional polypeptide can be an angiogenic polypeptide.
  • the angiogenic polypeptide can be a VEGF polypeptide.
  • a VEGF polypeptide can be selected from a group consisting of VEGF121, VEGF121b,
  • a VEGF polypeptide can comprise a sequence with at least 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identity to the sequence of the VEGF165 polypeptide. In some cases, a VEGF polypeptide can comprise a sequence with at least 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identity to the sequence of VEGF191 polypeptide.
  • the third functional polypeptide can be a chemokine.
  • the chemokine can be a SDF polypeptide.
  • the SDF polypeptide is selected from a group consisting of SDF1, SDF-1 ⁇ , SDF-1 ⁇ , fragments and variants thereof.
  • the SDF polypeptide can comprise a sequence with at least 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identity to the sequence of SDF1 polypeptide described herein.
  • the third functional polypeptide can be connected to at least one of said S100 polypeptide and said second functional polypeptide by a second polypeptide linker which can be optionally cleavable.
  • Polypeptide linkers can be independently selected from the linkers described herein.
  • polypeptide construct comprising at least a first polypeptide and a second polypeptide
  • a first polypeptide can be an angiogenic polypeptide
  • a second polypeptide can be a chemokine or variant or fragment thereof.
  • an angiogenic polypeptide can be a VEGF polypeptide selected from a group consisting of VEGF121, VEGF121b, VEGF145, VEGF165, VEGF165b, VEGF189, VEGF191, VEGF206, fragments and variants thereof.
  • a polypeptide can comprise a sequence with at least 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identity to the sequence of a VEGF polypeptide.
  • VEGF polypeptides comprising a sequence with at least 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99 % identity to the sequence of VEGF191.
  • a second polypeptide can be an SDF polypeptide.
  • An SDF polypeptide can be selected from the group consisting of SDF1, SDF-1 ⁇ , SDF-1 ⁇ , fragments and variants thereof.
  • an SDF polypeptide can comprise a sequence with at least 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identity to the sequence of SDF1.
  • kits for improving vasculogenesis in a subject comprising providing to said subject a therapeutically effective amount of a composition comprising a polynucleotide described herein or a polypeptide encoded by a polynucleotide described herein.
  • expression vectors comprising at least one promoter operably linked to at least two polypeptides selected from a SDF1 polypeptide, a S100A1 polypeptide, a VEGF polypeptide and fragments and variants thereof.
  • at least two polypeptides are connected by a linker.
  • at least one promoter can be selected from the group consisting of CAG promoter, CMV promoter, SV40 promoter, adenovirus promoter, Beta actin promoter, metallothionin promoter, EF1a promoter, myosin light chain promoter, myosin heavy chain promoter, NCX1 promoter and other suitable cardiac promoters.
  • An expression vector can be a cardiac expression vector.
  • polypeptide constructs comprising at least a first polypeptide, and a second polypeptide, wherein the first polypeptide can be a calcium binding protein, or variant or fragment thereof and the second polypeptide can be an angiogenic polypeptide, a chemokine, or variant or fragment thereof. Also disclosed are polypeptide constructs comprising at least a first polypeptide, a second polypeptide, and a third polypeptide wherein a first polypeptide can be an angiogenic polypeptide or variant or fragment thereof, a second polypeptide can be a
  • chemokine, or variant or fragment thereof; and a third polypeptide can be a calcium binding protein, or variant or fragment thereof.
  • a polypeptide construct described herein can comprise S100A1, a variant or a fragment thereof.
  • a polypeptide construct can comprise SDF1, a variant or a fragment thereof.
  • a polypeptide construct described herein can comprise VEGF, a variant or a fragment thereof.
  • polynucleotide described herein and a pharmaceutically acceptable excipient.
  • methods of treating a cardiac diseases and disorders in a subject comprising providing to the subject a therapeutically effective amount of a composition comprising a polynucleotide described herein, or a polypeptide construct provided herein, or a polypeptide construct encoded by a polynucleotide described herein.
  • a polynucleotide construct encoding a polypeptide construct described herein further comprises a third functional polypeptide connected by a second linker polypeptide to the second functional polypeptide.
  • the third functional polypeptide can be selected from a list consisting of VEGF, SDF1, S100A1, variants and derivatives thereof.
  • the second linker can be the same or different from the first linker described herein.
  • the linkers and functional polypeptides can be expressed in-frame.
  • cells comprising a polynucleotide described herein.
  • a method comprising: contacting at least one cardiac cell with a polynucleotide encoding a polypeptide construct comprising at least a first polypeptide and a second polypeptide, wherein a first polypeptide is an angiogenic polypeptide variant or fragment thereof; and a second polypeptide is at least one of a chemokine, a calcium binding protein, or variant or fragment thereof.
  • an angiogenic polypeptide variant or fragment thereof can be a VEGF polypeptide selected from a group consisting of VEGF121, VEGF121b, VEGF145, VEGF165, VEGF165b, VEGF189, VEGF191, VEGF206, fragments and variants thereof.
  • a VEGF polypeptide can comprise a sequence with at least 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identity to the sequence of
  • VEGF 165 has a sequence comprising amino acids 27-191 of a VEGF191 sequence disclosed herein. In certain embodiments, VEGF 165 has a sequence comprising amino acids 27, 28, 29, 30, 31, 32, 33, or 34 to 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, or 191 of a VEGF191 sequence disclosed herein. In certain embodiments, VEGF 165 has a sequence comprising amino acids 30-185 of a VEGF191 sequence disclosed herein.
  • a VEGF polypeptide described herein can comprise a sequence with at least 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identity to the sequence of VEGF 191 or VEGF165 disclosed herein.
  • a VEGF polypeptide can comprise a sequence with at least 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identity to the sequence of VEGF191.
  • a second polypeptide can be a chemokine.
  • a chemokine can be a stromal cell-derived factor 1 (SDF) polypeptide.
  • an SDF polypeptide useful in compositions and methods provided herein can be selected from the group consisting of SDF1, SDF-1 ⁇ , SDF-1 ⁇ , fragments and variants thereof.
  • An SDF polypeptide can comprise a sequence with at least 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identity to SDF1- ⁇ .
  • a polynucleotide encoding a polypeptide construct can be introduced ex vivo.
  • a polynucleotide encoding a polypeptide construct can be introduced in vivo.
  • An introduction in vivo can be selected from a group consisting of percutaneous coronary artery catheterization, coronary venous blockade, cardiac recirculation, antegrade coronary artery infusion, retrograde perfusion, direct injection, and any combination thereof.
  • a cardiac disease or disorder in a subject for example, but not limited to, by improving vasculogenesis, cardiac function or cardiac remodeling
  • methods of treating a cardiac disease or disorder in a subject comprising administering to said subject an amount of a polynucleotide encoding a construct comprising a VEGF polypeptide, and at least one of a SDF polypeptide and a S100 polypeptide.
  • a VEGF polypeptide in an embodiment described herein can be selected from a group consisting of VEGF121, VEGF121b, VEGF145, VEGF165, VEGF165b,
  • a VEGF polypeptide can comprise a sequence with at least 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identity to the sequence of VEGF165.
  • VEGF 165 has a sequence comprising amino acids 27-191 of a VEGF191 sequence disclosed herein.
  • a VEGF polypeptide can comprise a sequence with at least 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identity to the sequence of VEGF191.
  • An SDF polypeptide can be selected from the group consisting of SDF1, SDF-1 ⁇ , SDF-1 ⁇ , fragments and variants thereof.
  • An S100 polypeptide can be S100A1, fragment or variant thereof.
  • a subject treated with methods and compositions of the invention can have a congestive heart failure (CHF).
  • CHF congestive heart failure
  • a subject can have a left ventricular assist device (LVAD) in place.
  • LVAD left ventricular assist device
  • a subject can have a cardiomyopathy.
  • a cardiomyopathy can be selected from the group consisting of dilated cardiomyopathy (DCM), hypertrophic
  • HCM hypertension
  • RCM restrictive cardiomyopathy
  • ARVC arrhythmogenic right ventricular cardiomyopathy
  • a subject treated with methods and compositions of the invention can have any one or more of: aneurysm, atherosclerosis, congenital heart defect, pericardial disorder, acute decompensated heart failure, angina, arteriosclerotic heart disease, athletic heart syndrome, atrioventricular fistula, autoimmune heart disease, brown atrophy of the heart, cardiac amyloidosis, cardiac arrhythmia , cardiac asthma, cardiac contractility modulation, cardiac syndrome x, cardiogenic shock, cardiomegaly , cardiomyopathy , cardiophobia, cardiorenal syndrome, cardiotoxicity, cardiovascular disease, carditis, chronic rheumatic heart diseases , c ⁇ ur en sabot, coronary artery aneurysm, coronary artery anomaly, coronary artery disease, coronary artery dissection, coronary artery ectasia, coronary occlusion, coronary steal, coronary thrombosis, coronary vasospasm, coxsackievirus
  • a cardiovascular condition in a subject comprising: administering to a subject an amount of a construct comprising a S100A polypeptide, and a second functional polypeptide, wherein said second functional polypeptide is at least one of a cytokine, a chemokine and an angiogenic polypeptide.
  • an administration to a subject can be performed preventively.
  • an administration to a subject can be performed therapeutically.
  • a subject can be administered at least one additional treatment to said subject.
  • a second functional polypeptide can be VEGF, SDF, or a combination thereof.
  • kits for administering to a subject comprising administering to a subject at least one non-viral vector comprising a polynucleotide encoding a polypeptide sequence described herein comprising at least two functional proteins or portions thereof; at least one promotor; and at least one engineered recombination site; wherein said at least one promoter drives expression of said at least two functional proteins.
  • at least one promotor can be constitutive.
  • at least one promoter can be tissue-specific.
  • at least one promoter can be inducible.
  • at least one tissue-specific promotor is a myosin light chain (MLC) promoter.
  • an inducible promoter is a small molecule ligand-inducible two polypeptide ecdysone receptor-based gene switch. [0089] An inducible promoter utilizes a ligand for dose-regulated control of expression of said at least two genes.
  • a ligand can be selected from a group consisting of ecdysteroid, 9-cis-retinoic acid, synthetic analogs of retinoic acid, N,N’-diacylhydrazines, oxadiazolines, dibenzoylalkyl cyanohydrazines, N-alkyl-N,N’-diaroylhydrazines, N-acyl-N- alkylcarbonylhydrazines, N-aroyl-N-alkyl-N’-aroylhydrazines, arnidoketones, 3,5-di-tert-butyl- 4-hydroxy-N-isobutyl-benzamide, 8-O-acetylharpagide, oxysterols, 22(R) hydroxycholesterol, 24(S) hydroxycholesterol, 25-epoxycholesterol, T0901317, 5-alpha-6-alpha-epoxycholesterol-3- sulfate (
  • a first functional polypeptide and a second functional polypeptide connected by a first linker polypeptide wherein the first linker polypeptide comprises a sequence with at least 40%, 50%, 60%, 80% or 100% identity to the sequence APVKQ (SEQ ID NO: 42).
  • the linker polypeptide comprises a sequence selected from the group consisting of APVKQ (SEQ ID NO: 42), GPVKQ (SEQ ID NO: 43), VPVKQ (SEQ ID NO: 44), IPVKQ (SEQ ID NO: 45), MPVKQ (SEQ ID NO: 46), APIKQ (SEQ ID NO: 47), GPIKQ (SEQ ID NO: 48), VPIKQ (SEQ ID NO: 49), IPIKQ (SEQ ID NO: 50), MPIKQ (SEQ ID NO: 51), APAKQ (SEQ ID NO: 52), GPAKQ (SEQ ID NO: 53), VPAKQ (SEQ ID NO: 54), IPAKQ (SEQ ID NO: 55), MPAKQ (SEQ ID NO: 56), APVRQ (SEQ ID NO: 57), GPVRQ (SEQ ID NO: 58), VPVRQ (SEQ ID NO: 59), IPVRQ (SEQ ID NO: 60), MPVRQ (SEQ ID
  • a polypeptide linker may also include one or more GS linker sequences, for instance (GS)n (SEQ ID NO: 109), (SG)n (SEQ ID NO: 110), (GSG)n (SEQ ID NO: 111) and (SGS)n (SEQ ID NO: 112) wherein n can be any number from zero to fifteen.
  • the first functional polypeptide can be different from the second functional polypeptide.
  • a method can further comprise administering to a subject at least one secondary vector.
  • At least one secondary vector can be an mRNA.
  • At least one secondary vector can be a plasmid.
  • at least one secondary vector can comprise at least one recombinase.
  • a recombinase can be selected from the group consisting of a Listeria monocytogenes phage recombinase, a Streptococcus pyogenes phage recombinase, a Bacillus subtilis phage recombinase, a Mycobacterium tuberculosis phage recombinase and a
  • Mycobacterium smegmatis phage recombinase can be integrated into a genome of a subject by a recombinase.
  • at least one recombination site can be a phage genomic recombination attachment site (attP) or a bacterial genomic recombination attachment site (attB).
  • a recombinase used as described in the invention herein comprises a site-specific serine recombinase; such as, but not limited to, SpBC2 recombinase (see, for example, U.S. Patent No.9,034,650 issued May 19, 2015 (U.S. Pub. No.2006/0172377) which is hereby incorporated by reference herein in its entirety).
  • a vector can be good manufacturing practices (GMP) compatible.
  • polypeptides comprising a sequence with at least 40%, 50% 60%, 80%, or 100% identity to a sequence selected from the group consisting of SEQ ID NO: 32, SEQ ID NO: 34, SEQ ID NO: 36, SEQ ID NO: 38, and SEQ ID NO: 40.
  • the polypeptide comprises a sequence with at least 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identity to a sequence selected from the group consisting of SEQ ID NO: 32, SEQ ID NO: 34, SEQ ID NO: 36, SEQ ID NO: 38, and SEQ ID NO: 40.
  • polypeptides comprising a sequence with at least 40%, 50%, 60%, 80%, or 100% identity to a sequence selected from the group consisting of SEQ ID NO: 102, SEQ ID NO: 104 and SEQ ID NO: 106.
  • a polypeptide comprising a sequence with at least 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identity to a sequence selected from the group consisting of SEQ ID NO: 102, SEQ ID NO: 104 and SEQ ID NO: 106.
  • polypeptide comprising a sequence with at least 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identity to a polypeptide sequence encoded by the nucleic acid sequence of SEQ ID NO.108.
  • polynucleotides encoding a polypeptide construct comprising a first functional polypeptide and a second functional polypeptide connected by a first linker polypeptide, wherein the first linker polypeptide comprises a sequence with at least 40%, 50%, 60%, 80%, or 100% identity to the sequence APVKQ.
  • the linker polypeptide comprises a sequence selected from the group consisting of APVKQ (SEQ ID NO: 42). In some cases, the linker polypeptide comprises a sequence selected from the group consisting of APVKQ (SEQ ID NO: 42), GPVKQ (SEQ ID NO: 43), VPVKQ (SEQ ID NO: 44), IPVKQ (SEQ ID NO: 45), MPVKQ (SEQ ID NO: 46), APIKQ (SEQ ID NO: 47), GPIKQ (SEQ ID NO: 48), VPIKQ (SEQ ID NO: 49), IPIKQ (SEQ ID NO: 50), MPIKQ (SEQ ID NO: 51), APAKQ (SEQ ID NO: 52), GPAKQ (SEQ ID NO: 53), VPAKQ (SEQ ID NO: 54), IPAKQ (SEQ ID NO: 55), MPAKQ (SEQ ID NO: 56), APVRQ (SEQ ID NO: 57), GPVRQ (SEQ ID NO:
  • a polypeptide linker may also include one or more GS linker sequences, for instance (GS)n (SEQ ID NO: 113), (SG)n (SEQ ID NO: 114), (GSG)n (SEQ ID NO: 115) and (SGS)n (SEQ ID NO: 116) wherein n can be any number from one to fifteen.
  • the first functional polypeptide can be different from the second functional polypeptide.
  • at least one of said first and second functional polypeptides can be a protein, hormone, antibody, glycoprotein or derivative or fragment thereof.
  • polypeptide construct comprising a furin polypeptide and a 2A polypeptide, wherein the furin polypeptide and the 2A polypeptide are connected by a polypeptide linker comprising at least three hydrophobic amino acids.
  • At least three hydrophobic amino acids are selected from the list consisting of glycine (Gly)(G), alanine (Ala)(A), valine (Val)(V), leucine (Leu)(L), isoleucine (Ile)(I), proline (Pro)(P), phenylalanine (Phe)(F), methionine (Met)(M), tryptophan (Trp)(W).
  • polypeptides encoded by polynucleotides described herein are provided.
  • compositions comprising these polypeptides.
  • therapeutic, and/or diagnostic methods comprising contacting an individual with a polynucleotide disclosed herein or a polypeptide expressed therefrom or derivative, or conjugate thereof.
  • a polypeptide construct comprising: providing a polynucleotide encoding said polypeptide construct comprising a first functional polypeptide and a second functional polypeptide, wherein said first functional polypeptide and second functional polypeptide are connected by a linker polypeptide comprising a sequence with at least 60% identity to the sequence APVKQ (SEQ ID NO: 42); and expressing said polynucleotide in a host cell, wherein said expressing results in an improved expression of the polypeptide construct as compared to a corresponding polypeptide construct that does not have a linker polypeptide comprising a sequence with at least 60% identity to the sequence APVKQ (SEQ ID NO: 42).
  • the term“about” in relation to a reference numerical value and its grammatical equivalents as used herein can include the numerical value itself and a range of values plus or minus 10% from that numerical value.
  • the amount“about 10” includes 10 and any amounts from 9 to 11.
  • the term“about” in relation to a reference numerical value can also include a range of values plus or minus 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or 1% from that value.
  • cardiac disease and“circulatory disorder” are used interchangeably, and are used herein to describe a disease or disorder which is caused by damage to the circulatory system and which damage can be reduced and/or alleviated by providing a therapeutically effective amount of a polynucleotide described herein or a polypeptide construct encoded by a polynucleotide disclosed herein, to damaged areas of the heart and/or circulatory system of the subject.
  • the term“circulatory damage” is used to refer to injury to the circulatory system that may be caused be any of a number of diseases or disorders.
  • Exemplary cardiovascular diseases which may be treated using a polynucleotide described herein or a polypeptide construct encoded by a polynucleotide disclosed herein and methods according to the present invention include for example, myocardial infarct, cardiomyopathy, peripheral vascular disease, congenital heart disease, other genetic diseases, and injury or trauma caused by ischemia, accidents, environmental insult.
  • a therapeutically effective amount polynucleotide described herein or a polypeptide construct encoded by a polynucleotide disclosed herein may be used to reduce and/or eliminate the effects on the central nervous system of a heart attack in a subject, which is otherwise caused by lack of blood flow or ischemia to a site in the brain of said subject or which has occurred from physical injury to the brain and/or spinal cord.
  • vector or grammatical equivalents as used herein can refer any
  • polynucleotide construct capable of directing the expression of a polypeptide construct of interest and which is useful in transferring the polypeptide construct of interest into target cells.
  • the term includes cloning and expression vehicles, as well as integrating vectors.
  • one embodiment of the present invention provides a triple effector plasmid-based DNA - pXoX (SDF1 ⁇ , S100A1, and VEGF) to improve cardiac performance (for, example, but not limited to, as assessed by measuring the number and duration of temporary weans from LVAD support in patients who have been implanted with destination LVADS at least thirty days post-surgery).
  • Implantation of LVADs alone can result in improved cardiac function, most of which occurs within the first 30 days or so following implantation.
  • inflammatory processes which are normally associated with surgery recover to a new baseline by 30 days post- surgery, which may result in decreased risk of treatment with pXoX to this high risk patient population.
  • the pXoX plasmid constitutively expresses three proteins (S100A1, SDF-1 ⁇ , and VEGF165) under the control of a CAG promoter, as a single mRNA that is processed into the individual effector proteins during translation via cleavage by the combined activity of furin and 2A self-cleaving peptides (fp2a).
  • the plasmid backbone contains a kanamycin selection marker and an origin of replication derived from pBR322. An illustration of the pXoX plasmid is provided below in FIG.27A and FIG.27B.
  • the present invention also provides linkers for use, for instance, in compositions and methods useful for treatment of cardiac pathologies, conditions, and disorders (e.g., heart failure, cardiomyopathy, arrhythmia, pericardial disease, aorta disease, marfan syndrome and coronary artery disease.) using novel multigenic vectors, combinations of genetic sequences, proteins (polypeptides), and techniques described and provided for herein.
  • cardiac pathologies, conditions, and disorders e.g., heart failure, cardiomyopathy, arrhythmia, pericardial disease, aorta disease, marfan syndrome and coronary artery disease.
  • linker can mean any polynucleotide or polypeptide sequence that is used to connect any one polynucleotide or polypeptide sequence with another polynucleotide or polypeptide sequence, respectively (e.g., First GOI-Linker-Second GOI-Linker-Third GOI-Linker-etc).
  • a linker may be a polynucleotide open-reading frame encoding a fusion protein such that a first polypeptide sequence is covalently linked (“fused") by an intervening amino acid sequence to a second polypeptide sequence (and so on for third, fourth, fifth, etc... subsequent polypeptides in the same open-reading frame).
  • a "linker” may also be a non-coding, linking polynucleotide sequence such as a promoter (e.g., CAG promoter or CMV promoter) or an IRES (Internal Ribosome Entry Site) which function to couple a first polynucleotide coding region (ORF) to a second polynucleotide coding region (ORF) (and so on for third, fourth, fifth, etc... subsequent polynucleotide open-reading frames).
  • a promoter e.g., CAG promoter or CMV promoter
  • IRES Internal Ribosome Entry Site
  • Gene therapy refers to the transfer of polynucleotide described herein (e.g., DNA or RNA) of interest into a subject to treat or prevent a genetic or acquired disease or condition.
  • Polynucleotide of interest can encode a product (e.g., a polypeptide construct) whose in vivo production is desired.
  • the polynucleotide of interest also encodes a suicide gene.
  • gene therapy can be used to treat a cardiovascular condition described herein.
  • vectors for gene therapy of a disorder comprising using a polynucleotide described herein.
  • a vector can be utilized for introducing exogenous nucleic acids such as DNA, mRNA, small interfering RNA (siRNA), microRNA (miRNA) or antisense oligonucleotides. Given the large size and the negative charge of these macromolecules, their delivery can be mediated by carriers or vectors.
  • Vectors of interest include, in particular, any episomal vector, e.g. viral vectors, plasmid vectors, artificial chromosomes, mini-circles and the like.
  • Non-viral vectors can include naked plasmid DNA, liposomal DNA complexes, polymer-carried DNA, and oligonucleotides. Plasmids can be double-stranded circular DNA-containing transgenes encoding proteins of interest, and also have enhancer and promoter sequences.
  • a vector can be a non-viral vector.
  • a vector can comprise genes or fragments or variants thereof, wherein at least one gene, fragment or variant thereof is connected to another gene, fragment or variant thereof by a linker disclosed herein.
  • a vector can comprise a single-gene or multiple genes, or fragments or variants thereof.
  • a vector can comprise genes, or fragments or variants thereof, wherein at least one gene, fragment or variant thereof can be connected to another gene, fragment or variant thereof by a linker disclosed herein.
  • a vector can be singe gene, double gene (see, e.g. Table 1), or triple-gene, wherein at least one gene, fragment or variant thereof is connected to another gene, fragment or variant thereof by a linker disclosed herein.
  • a vector can comprise a number of genes from 1 to 10, or fragments or variants thereof.
  • a vector can comprise 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 genes, fragments or variants thereof.
  • An exemplary triple-gene vector is shown in FIG.20 A and FIG.20 B
  • An exemplary vector sequence is shown in Table 5.
  • a vector can allow the simultaneous expression of two, three, or more polypeptides separately but from the same RNA transcript.
  • a vector can also comprise a reporter polypeptide.
  • a vector can express one, two, three or more polypeptides and a reporter polypeptide.
  • a vector can be constructed with at least one gene or fragment thereof.
  • a vector may contain up to 10 genes or fragments thereof. Genes or fragments thereof that can be expressed may be described by SEQ ID No.102 to 107. Any homologs, isoforms, precursors, or modified portions thereof of SEQ ID No.102 to 107 may also be expressed by vectors described herein. Genes or any fragment thereof can be separated by a linker described herein.
  • Various linkers that may be utilized in a vector can comprise sequences shown in for instance SEQ ID No.32 to SEQ ID No.41. In other cases, relevant linkers that can be utilized in a vector can comprise for instance a sequence shown in any of SEQ ID No.42 to 101.
  • a portion of a gene can be at least one of a SDF gene (encoded by SEQ ID NO: 103 or 60%, 70%, 80%, 90%, or 95% identity thereto), a VEGF gene (encoded by SEQ ID NO: 105 or 60%, 70%, 80%, 90%, or 95% identity thereto) and a S100A gene (encoded by SEQ ID NO: 107 or 60%, 70%, 80%, 90%, or 95% identity thereto), which can be followed by a first linker sequence, a second gene or portion thereof which is selected from a SDF gene (encoded by SEQ ID NO: 103 or 60%, 70%, 80%, 90%, or 95% identity thereto), a VEGF gene (encoded by SEQ ID NO: 105 or 60%, 70%, 80%, 90%, or 95% identity thereto) and a S100A gene (encoded by SEQ ID NO: 107 or 60%, 70%, 80%, 90%, or 95% identity thereto), optionally followed by a SDF
  • a vector can be modular.
  • a modular vector can allow for the replacement of one gene or nucleic acid segment for a different gene or nucleic acid segment, for example, using restriction enzyme digestion.
  • Multigenic expression of genes and proteins of interest can be mediated by a vector.
  • Any vector system can be used including, but not limited to, plasmid vectors, retroviral vectors, lentiviral vectors, adenovirus vectors, poxvirus vectors, herpesvirus vectors, adeno-associated virus vectors, etc.
  • Plasmid vectors are advantageous in avoiding host anti-viral immune responses. Plasmids can be episomal and non-integrating, which can reduce the risk of insertional mutagenesis compared with viral vectors.
  • an enhancer may be used in polynucleotide constructs of the invention.
  • An enhancer can refer to a sequence that can function at no fixed distance from a transcription start site and can be either 5′ or 3′ to the transcription unit. Furthermore, enhancers can be within an intron as well as within the coding sequence itself. Enhancers are usually between 10 and 300 base pairs in length, and they function in cis. An enhancer can be from 10 bp to 50bp, 50bp to 100bp, 100bp to 150bp, 150 bp to 200bp, 200bp to 250 bp, 250bp to 300bp. Enhancers can function to increase transcription from nearby promoters. Enhancers can also contain response elements that mediate the regulation of transcription.
  • enhancer sequences are now known from mammalian genes (globin, elastase, albumin, fetoprotein and insulin), one may also use an enhancer from a eukaryotic cell virus for general expression.
  • An enhancer can be a simian virus 40 (SV40) enhancer, a human immunodeficiency virus I (HIV-I) enhancer, ground squirrel hepatitis virus (GHV) enhancer, adenovirus enhancer, human prothrombin (hTHGB) enhancer, or human C2 complement gene (hC2) enhancer to name a few.
  • SV40 simian virus 40
  • HAV-I human immunodeficiency virus I
  • GMV ground squirrel hepatitis virus
  • hTHGB human prothrombin
  • an enhancer sequence can be used to increase expression of a gene.
  • a CMV enhancer can increase transgene expression under different cell- specific promoters and different cell types making it a broadly applicable tool to increase transgene expression levels.
  • a mini-circle vector can be used.
  • Minicircle vectors can differ from bacterial plasmid vectors in that they may lack an origin of replication, and may lack drug selection markers commonly found in bacterial plasmids, e.g. ⁇ -lactamase, tet, and the like.
  • a minicircle may be substantially free of vector sequences other than the recombinase hybrid product sequence, and the sequence of interest, i.e. a transcribed sequence and regulatory sequences required for expression.
  • a dog bone vector may be utilized.
  • a dog bone vector may be generated without the use of bacteria and may have reduced bacterial elements when compared to a plasmid. Reduced bacterial elements may reduce toxicity of vector introduction into a cell, into a subject, or a combination of both.
  • polynucleotides and polypeptides encoded by said polynucleotides
  • vectors including non-viral and viral vectors (including DNA and RNA/mRNA vectors, which may be linear or circular vectors)
  • said polynucleotides comprise a construct configuration selected from the group consisting of: a) 5'-(promoter)-S100-(linker)-SDF-(linker)-VEGF-3';
  • promoter is any transcriptional promoter sequence
  • S100 encodes any polypeptide, isoform, or fragment thereof in the S100 family of proteins
  • SDF encodes any polypeptide, isoform, or fragment thereof in the SDF family of proteins
  • VEGF encodes any polypeptide, isoform, or fragment thereof in the VEGF family of proteins
  • parenthetical symbols " ( " and “ ) " indicate any number of additional nucleotides (nts) (from 0 to 1000 nts) whether coding sequences or non-coding sequences;
  • linker indicates any linker useful for expression of adjacent biologically active polypeptides
  • S100A1 is at least 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% identical or is 100% identical to the nucleotide sequence of SEQ ID NO: 105 or to the amino acid sequence of SEQ ID NO: 104, in the, respective, context of polynucleotide or polypeptide sequences;
  • SDF-1 ⁇ is at least 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% identical or is 100% identical to the nucleotide sequence of SEQ ID NO: 103 or to the amino acid sequence of SEQ ID NO: 102, in the, respective, context of polynucleotide or polypeptide sequences;
  • VEGF165 is at least 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% identical or is 100% identical to the nucleotide sequence of SEQ ID NO: 127 or to the amino acid sequence of SEQ ID NO: 126, in the, respective, context of polynucleotide or polypeptide sequences;
  • VEGF191 is at least 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% identical or is 100% identical to the nucleotide sequence of SEQ ID NO: 107 or to the amino acid sequence of SEQ ID NO: 106, in the, respective, context of polynucleotide or polypeptide sequences;
  • fp2a is at least 40%, 45%, 50%, 55%, 65%, 70%, 75%, 80%, 85%, 90%, 95% identical or is 100% identical to the nucleotide sequence of SEQ ID NO: 41 or to the amino acid sequence of SEQ ID NO: 40, in the, respective, context of polynucleotide or polypeptide sequences;
  • fmdv is at least 40%, 45%, 50%, 55%, 65%, 70%, 75%, 80%, 85%, 90%, 95% identical or is 100% identical to the nucleotide sequence of SEQ ID NO: 35 or to the amino acid sequence of SEQ ID NO: 34, in the, respective, context of polynucleotide or polypeptide sequences;
  • p2a is at least 40%, 45%, 50%, 55%, 65%, 70%, 75%, 80%, 85%, 90%, 95% identical or is 100% identical to the nucleotide sequence of SEQ ID NO: 37 or to the amino acid sequence of SEQ ID NO: 36, in the, respective, context of polynucleotide or polypeptide sequences; and, wherein "GSG-p2a” is at least 40%, 45%, 50%, 55%, 65%, 70%, 75%, 80%, 85%, 90%, 95% identical or is 100% identical to the nucleotide sequence of SEQ ID NO: 39 or to the amino acid
  • lead candidate therapeutic polynucleotides of the invention comprise polynucleotides (and polypeptides encoded by said polynucleotides) which may be incorporated into vectors (including non-viral and viral vectors (including DNA and RNA/mRNA vectors, which may be linear or circular vectors)) wherein said polynucleotides comprise a construct configuration selected from the group consisting of:
  • promoter is any transcriptional promoter sequence
  • S100 encodes any polypeptide, isoform, or fragment thereof in the S100 family or proteins
  • SDF encodes any polypeptide, isoform, or fragment thereof in the SDF family of proteins
  • VEGF encodes any polypeptide, isoform, or fragment thereof in the VEGF family of proteins
  • parenthetical symbols " ( " and “ ) " indicate any number of additional nucleotides (nts) (from 0 to 1000 nts) whether coding sequences or non-coding sequences;
  • linker indicates any linker useful for expression of adjacent biologically active polypeptides
  • S100A1 is at least 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% identical or is 100% identical to the nucleotide sequence of SEQ ID NO: 105 or to the amino acid sequence of SEQ ID NO: 104, in the, respective, context of polynucleotide or polypeptide sequences;
  • SDF-1 ⁇ is at least 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% identical or is 100% identical to the nucleotide sequence of SEQ ID NO: 103 or to the amino acid sequence of SEQ ID NO: 102, in the, respective, context of polynucleotide or polypeptide sequences;
  • VEGF165 is at least 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% identical or is 100% identical to the nucleotide sequence of SEQ ID NO: 127 or to the amino acid sequence of SEQ ID NO: 126, in the, respective, context of polynucleotide or polypeptide sequences;
  • VEGF191 is at least 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% identical or is 100% identical to the nucleotide sequence of SEQ ID NO: 107 or to the amino acid sequence of SEQ ID NO: 106, in the, respective, context of polynucleotide or polypeptide sequences;
  • fp2a is at least 40%, 45%, 50%, 55%, 65%, 70%, 75%, 80%, 85%, 90%, 95% identical or is 100% identical to the nucleotide sequence of SEQ ID NO: 41 or to the amino acid sequence of SEQ ID NO: 40, in the, respective, context of polynucleotide or polypeptide sequences;
  • fmdv is at least 40%, 45%, 50%, 55%, 65%, 70%, 75%, 80%, 85%, 90%, 95% identical or is 100% identical to the nucleotide sequence of SEQ ID NO: 35 or to the amino acid sequence of SEQ ID NO: 34, in the, respective, context of polynucleotide or polypeptide sequences;
  • p2a is at least 40%, 45%, 50%, 55%, 65%, 70%, 75%, 80%, 85%, 90%, 95% identical or is 100% identical to the nucleotide sequence of SEQ ID NO: 37 or to the amino acid sequence of SEQ ID NO: 36, in the, respective, context of polynucleotide or polypeptide sequences; and, wherein "GSG-p2a” is at least 40%, 45%, 50%, 55%, 65%, 70%, 75%, 80%, 85%, 90%, 95% identical or is 100% identical to the nucleotide sequence of SEQ ID NO: 39 or to the amino acid
  • compositions of the present invention may be used to treat congestive heart failure (e.g., compositions of the present invention may be used to treat congestive heart failure in patients with implanted destination left ventricular assist devices (LVAD)).
  • LVAD left ventricular assist devices
  • compositions of the present invention are administered to patients through retrograde coronary sinus infusion (RCSI).
  • RCSI retrograde coronary sinus infusion
  • compositions of the present invention are administered to animal models (for example, but not limited to, pigs (porcine model)) wherein retrograde coronary sinus infusion (RCSI) is used to study an animal model of myocardial ischemia.
  • animal models for example, but not limited to, pigs (porcine model)
  • RCSI retrograde coronary sinus infusion
  • each effector in pXoX was verified in transfected healthy and diseased patient-induced pluripotent stem cell (iPSC)-derived
  • VEGF165 demonstrated an increase in proliferation of human umbilical endothelial cells (HUVECs).
  • transfection of pXoX in vitro safety testing in healthy and diseased patient-induced pluripotent stem cell (iPSC)-derived cardiomyocytes did not demonstrate risks for adverse effects on cardiac conduction, based on assessments of changes in Field Potential Duration (MEA), which correlate closely with effects on QT intervals of the electrocardiogram (ECG).
  • MEA Field Potential Duration
  • transfection of pXoX restored beat rate, contraction duration and contraction rate in dilated cardiomyopathy patient iPSC-CMs to levels comparable to those seen in iPSC-CM from a healthy phenotype.
  • the best improvements in contractile properties were observed for the pXoX triple effector plasmid, relative to single or dual effector plasmids.
  • vectors and polynucleotide constructs of the invention comprise dual-gene (double-gene) sequences (and polypeptides encoded by same) such as those described in Table 1.
  • Table 1 Vector Features - Dual-Gene (Double-Gene) Constructs
  • Promoters are a major cis-acting element within the vector genome design that can dictate the overall strength of expression as well as cell-specificity.
  • a promotor can be a ubiquitous promotor, a cell-specific promotor, or a combination thereof.
  • a ubiquitous or constitutive promoter can be a CMV, CBA (CAG and CBh), EF-1alpha, PKG, UBC, GUSB (hGBp), UCOE, to name a few.
  • a promotor can be a promotor that has activity within a target cell of interest, e.g., cardiac promotor. In some cases a promotor is a CAG. In other cases a promoter is a constitutive promoter such as Ef1a.
  • a promoter can be a human promotor, such as human Ef1a (hEf1a).
  • a bidirectional promoter can also be used.
  • a constitutive bidirectional promoter can be a human cytomegalovirus promoter.
  • Constitutive promoters such as the human elongation factor 1 ⁇ -subunit (EF1 ⁇ ), immediate-early cytomegalovirus (CMV), chicken ⁇ -actin (CBA) and its derivative CAG, the ⁇ glucuronidase (GUSB), or ubiquitin C (UBC) can be used to promote expression in most tissues (Husain et al., 2009; Qin et al., 2010; Norrman et al., 2010).
  • EF1 ⁇ human elongation factor 1 ⁇ -subunit
  • CBA immediate-early cytomegalovirus
  • CBA chicken ⁇ -actin
  • GUSB ⁇ glucuronidase
  • UBC ubiquitin C
  • CBA and CAG promote the larger expression among the constitutive promoters (Xu et al., 2001; Yin et al., 2011); however, their size of ⁇ 1.7 kbs in comparison to CMV ( ⁇ 0.8 kbs) or EF1 ⁇ ( ⁇ 1.2 kbs) can limit its use in vectors with packaging constraints.
  • a GUSB or UBC promoter can provide ubiquitous gene expression with a smaller size of 378 bps and 403 bps, respectively, but they can be considerably weaker than a CMV or CBA promoter (Husain et al., 2009; Qin et al., 2010).
  • Viral enhancers and promoters derived from cytomegalovirus (CMV), respiratory syncytial virus (RSV) and simian virus 40 (SV40) can be used to achieve high levels of expression in a range of mammalian cell and tissue types, such as in cardiomyocytes.
  • CMV cytomegalovirus
  • RSV respiratory syncytial virus
  • SV40 simian virus 40
  • Constitutive mammalian promoters such as the human ubiquitin C (UBC) and the eukaryotic translation elongation factor 1 alpha 1 (EEF1A1) promoters can have more persistent expression.
  • Tissue-specific promoters can be utilized to reduce off-target transgene expression.
  • Numerous cis-acting sequences, including polyadenylation signals, introns and scaffold/matrix attachment regions (S/MARs) 52 can increase the level and persistence of transgene expression in some cases.
  • Compact DNA vectors that lack a bacterial backbone e.g., minicircles
  • a dog bone vector may also be utilized.
  • a dog bone vector can be generated without the use of bacteria.
  • a lipid-based DNA vectors can also be used in some cases, a transposon system can be utilized.
  • a transposition system can be or can be based on the recombinases phiC31, PiggyBac57, Sleeping Beauty, or combinations thereof.
  • cardiac gene effector vectors described herein can be integrated into a cell genome via use of recombinase, FIG.2.
  • a recombinase can be an att-site recombinase.
  • a recombinase can be selected from recombinases as described in: US Patent No. 9,034,650; US Pub. No.2015/0275232; and, W02008/073154, each of which is incorporated by reference herein in its entirety.
  • a recombinase can be introduced into a cell via an mRNA encoding a recombinase.
  • integration of a recombinase into a cell genome can be prevented by introduction and expression of a recombinase via use of an mRNA encoding a recombinase.
  • an mRNA encoding a recombinase can be a synthetic or a cGMP-grade mRNA, FIG.1.
  • a recombinase can be introduced into a cell via an expression plasmid comprising a“suicide gene” and a gene encoding a recombinase.
  • a suicide gene and recombinase gene can be separated by an intervening internal ribosome entry site (IRES).
  • a cell in which vectors can be introduced or genomically integrated can be a primary cell (e.g., such as, but not limited to, a cardiomyocyte, FIG. 2).
  • a gene encoded within a vector can be genomically inserted at a targeted genomic location in a cell.
  • IRES Internal ribosome entry site
  • IRES Internal ribosome entry site
  • a first gene can be translated by a cap-dependent, ribosome scanning, mechanism with its own 5′-UTR, whereas translation of a subsequent gene can be accomplished by direct recruitment of a ribosome to an IRES in a cap-independent manner.
  • An IRES sequence can allow eukaryotic ribosomes to bind and begin translation without binding to a 5′ capped end.
  • an IRES region can be derived from a virus, such as picornavirus, encephalomyocarditis virus, hepatitis C virus IRES sequence.
  • IRES sequence can be derived from an encephalomyocarditis virus.
  • the term“EMCV” or “encephalomyocarditis virus” as used herein refers to any member isolate or strain of the encephalomyocarditis virus species of the genus of the family Picornaviridae. Examples are: EMCV-R (Rueckert) strain virus, Columbia-SK virus.
  • a cellular IRES element such as eukaryotic initiation factor 4G, immunoglobulin heavy chain binding protein, c-myc proto-oncogene, vascular endothelial growth factor, fibroblast growth factor-1 IRES, or any combination or modification thereof can be used.
  • a cellular IRES can have increased gene expression when compared to a viral IRES.
  • CAP refers to a modified nucleotide, generally a 7- methyl guanosine, linked 3′ to 5′ (7meG-ppp-G), to the 5′ end of a eukaryotic mRNA, that serves as a required element in the normal translation initiation pathway during expression of protein from that mRNA.
  • An IRES sequence of viral, cellular or a combination thereof can be utilized in a vector.
  • An IRES can be from encephalomyocarditis (EMCV) or poliovirus (PV).
  • an IRES element is selected from a group consisting of Poliovirus (PV), Encephalomyelitis virus (EMCV), Foot-and-mouth disease virus (FMDV), Porcine teschovirus- 1 (PTV-1), Aichivirus (AiV), Seneca Valley virus (SVV), Hepatitis C virus (HCV), Classical swine fever virus (CSFV), Human immunodeficiency virus-2 (HIV-2), Human
  • HIV-1 immunodeficiency virus-1
  • MoMLV Moloney murine leukemia virus
  • FMV Feline immunodeficiency virus
  • MMTV Mouse mammary tumor virus
  • cytomegalovirus latency pUL138
  • Epstein-Barr virus EBNA-1
  • Herpes virus Marek’s disease MDV RLORF9
  • SV40 polycistronic 19S SV4019S
  • RhPV Rhopalosiphum padi virus
  • CePV Cricket paralysis virus
  • Ectropis obliqua picorna-like virus EoPV
  • Plautia stali intestine virus PSIV
  • Triatoma virus TrV
  • Bee paralysis dicistrovirus IAPV, KBV
  • Black currant reversion virus BRV
  • Pelargonium flower break virus PFBV
  • Hibiscus chlorotic ringspot virus HCRSV
  • Crucifer-infecting tobamovirus CrTMV
  • Potato leaf roll polerovirus PRV
  • TMV Tobacco etch virus
  • GLV Giardiavirus
  • LDV-1 Leishmania RNA virus-1
  • an IRES is selected from a group consisting of Apaf-1, XIAP, HIAP2/c- IAP1, DAP5, Bcl-2, c-myc, CAT-1, INR, Differentiation LEF-1, PDGF2, HIF-1a, VEGF, FGF2, BiP, BAG-1, CIRP, p53, SHMT1, PITSLREp58, CDK1, Rpr, hid, hsp70, grim, skl, Antennapedia, dFoxO, dInR, Adh-Adhr, HSP101, ADH, URE-2,GPR1, NCE102, YMR181a, MSN1, BOI1, FLO8, GIC1, and any combination or modification thereof.
  • IRES element When an IRES element is included between two open reading frames (ORFs), initiation of translation can occur by a canonical 5′- m7GpppN cap-dependent mechanism in a first ORF and a cap-independent mechanism in a second ORF downstream of the IRES element.
  • genes can be linked by an internal ribosomal entry site (IRES).
  • IRES internal ribosomal entry site
  • An IRES can allow simultaneous expression of multiple genes.
  • an IRES sequence can permit production of multiple proteins from a single mRNA transcript.
  • a ribosomes can bind to an IRES in a 5′-cap independent manner and initiate translation.
  • an IRES sequence can be or can be about 500 base pairs.
  • An IRES sequence can be from 300 base pairs to 1000 base pairs.
  • an IRES can be 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, or 1000 base pairs long.
  • expression of a downstream gene within a vector comprising an IRES sequence can be reduced.
  • a gene following an IRES sequence can have reduced expression over a gene preceding an IRES sequence.
  • Reduced expression can be from 1% to 99% reduction over a preceding gene.
  • a viral 2A sequence can be used.
  • a 2A sequence can be derived from a picornaviral 2A sequence.
  • a picornaviral 2A sequence can be selected from the group consisting of the Enteroviral 2A sequences, Rhinoviral 2A sequences, Cardioviral 2A sequences, Aphthoviral 2A sequences, Hepatoviral 2A sequences, Erboviral 2A sequences, Kobuviral 2A sequences, Teschoviral 2A sequences, and the Parechoviral 2A sequences.
  • 2A elements can be shorter than IRES, having from 5 to 100 base pairs.
  • a 2A sequence can have 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, or 100 base pairs in length.
  • 2A linked genes can be expressed in one single open reading frame and “self-cleavage” can occur co-translationally between the last two amino acids, GP, at the C- terminus of the 2A polypeptide, giving rise to equal amounts of co-expressed proteins.
  • a polypeptide comprising a 2A sequence may not give rise to equal amounts of protein post cleavage.
  • a first protein may be 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or up to 100% greater in concentration when compared to a second protein.
  • a second protein may be 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or up to 100% greater in concentration when compared to a second protein.
  • a viral 2A sequence can be about 20 amino acids.
  • a viral 2A sequence can contain a consensus motif Asp-Val/Ile-Glu-X-Asn-Pro-Gly-Pro (SEQ ID NO: 117).
  • a consensus motif sequence can act co-translationally. For example, formation of a normal peptide bond between a glycine and proline residue can be prevented, which can result in ribosomal skipping and, thereby, "cleavage" of a nascent polypeptide. This effect can produce multiple genes at equimolar levels.
  • a 2A peptide can allow translation of multiple proteins in a single open reading frame into a polypeptide that can be subsequently "cleaved” into individual polypeptide through a ribosome-skipping mechanism (Funston, Kallioinen et al.2008).
  • a "2A" sequence can include: p2a, GSG-p2a, T2A, E2A, F2A, and BmCPV2A, BmIFV2A, and any combination thereof.
  • a vector can also include additional a 2A/furin sequence located between polycistronic genes to permit production of expression products originating from e.g., a second gene by enzymatic cleavage of a polypeptide product.
  • additional linkers may be utilized to facilitate cleavage between multiple genes in a multigene vector.
  • a vector can comprise an IRES sequence and a 2A sequence.
  • expression of multiple genes linked with 2A peptides can be facilitated by a spacer sequence (GSG) ahead of the 2A peptides.
  • constructs can combine a spacers, linkers, adaptors, promotors, or combinations thereof.
  • a construct can have a spacer (SGSG (SEQ ID NO: 118) or GSG) and furin linker (RAKR (SEQ ID NO: 32)) cleavage site with different 2A peptides.
  • a spacer can be an I-Ceui (intron encoding endonuclease).
  • two or more of the cardiac effector genes are separated by an intervening internal ribosome entry site (IRES).
  • a polynucleotide linker can be utilized in a
  • a polynucleotide linker can be a double-stranded segment of DNA containing desired restriction sites that may be added to create end structures that are compatible with a vector comprising a polynucleotide described herein.
  • a polynucleotide linker can be useful for modifying vectors comprising polynucleotides described herein.
  • a vector modification comprising a polynucleotide linker can be a change in a multiple cloning site, or the addition of a poly-histidine tail.
  • Polynucleotide linkers can also be used to adapt the ends of blunt insert DNA for cloning into a vector cleaved with a restriction enzyme with cohesive end termini.
  • the use of polynucleotide linkers can be more efficient than a blunt ligation into a vector and can provide a method of releasing an insert from a vector in downstream applications.
  • an insert can be a polynucleotide sequence encoding polypeptides useful for therapeutic applications (e.g., SDF1 polypeptide, a S100A1 polypeptide, a VEGF polypeptide and fragments and variants thereof).
  • a polynucleotide linker can be an oligomer.
  • a linker can be from about 5 to 20 nucleotides in length.
  • a polynucleotide linker can be or can be about from 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 nucleotides in length.
  • a polynucleotide linker can be a DNA double strand, single strand, or a combination thereof.
  • a linker can be RNA.
  • a polynucleotide linker can be ligated into a vector comprising a polynucleotide described herein by a T4 ligase in some cases.
  • an excess of polynucleotide linkers can be added to a composition comprising an insert and a vector.
  • an insert and vector are pre-treated before a linker is introduced.
  • pre- treatment with a methylase can prevent unwanted cleavage of insert DNA.
  • two or more polypeptides encoded by a polynucleotide described herein can be separated by an intervening sequence encoding a linker polypeptide.
  • the linker is a cleavage-susceptible linker.
  • polypeptides of interest are expressed as fusion proteins linked by a cleavage-susceptible linker polypeptide.
  • cleavage-susceptible linker polypeptide(s) can be any one or two of:
  • a linker is APVKQGSG (SEQ ID NO: 119).
  • a linker polypeptide can comprise an amino acid sequence“RAKR” (SEQ ID NO: 32).
  • a Furin linker polypeptide can be encoded by a
  • polynucleotide sequence polynucleotide sequence comprising“CGTGCAAAGCGT.” (SEQ ID NO: 33).
  • a linker polypeptide can be a linker comprising a sequence disclosed in the table below: Table 2 Linker amino acid sequences and polynucleotide sequences
  • a linker can be utilized in a polynucleotide described herein.
  • a linker can be a flexible linker, a rigid linker, an in vivo cleavable linker, or any combination thereof.
  • a linker may link a functional domains together (as in flexible and rigid linkers) or releasing free functional domain in vivo as in in vivo cleavable linkers.
  • Linkers may improve biological activity, increase expression yield, and achieving desirable pharmacokinetic profiles.
  • a linker can also comprise hydrazone, peptide, disulfide, or thioesther.
  • a linker sequence described herein can include a flexible linker.
  • Flexible linkers can be applied when a joined domain requires a certain degree of movement or interaction.
  • Flexible linkers can be composed of small, non-polar (e.g., Gly) or polar (e.g., Ser or Thr) amino acids.
  • a flexible linker can have sequences consisting primarily of stretches of Gly and Ser residues (“GS” linker).
  • GS Gly- Gly-Gly-Gly-Ser
  • SEQ ID NO: 120 sequence of (Gly- Gly-Gly-Gly-Ser)n
  • flexible linkers can be utilized for recombinant fusion proteins.
  • flexible linkers can also be rich in small or polar amino acids such as Gly and Ser, but can contain additional amino acids such as Thr and Ala to maintain flexibility.
  • polar amino acids such as Lys and Glu can be used to improve solubility.
  • Flexible linkers included in linker sequences described herein can be rich in small or polar amino acids such as Gly and Ser to provide good flexibility and solubility. Flexible linkers can be suitable choices when certain movements or interactions are desired for fusion protein domains. In addition, although flexible linkers may not have rigid structures, they can serve as a passive linker to keep a distance between functional domains. The length of a flexible linkers can be adjusted to allow for proper folding or to achieve optimal biological activity of the fusion proteins.
  • a linker described herein can further include a rigid linker in some cases.
  • a rigid linker may be utilized to maintain a fixed distance between domains of a polypeptide.
  • Rigid linkers can exhibit relatively stiff structures by adopting ⁇ -helical structures or by containing multiple Pro residues in some cases.
  • a linker described herein can be cleavable in some cases. In other cases a linker is not cleavable. Linkers that are not cleavable may covalently join functional domains together to act as one molecule throughout an in vivo processes or an ex vivo process. A linker can also be cleavable in vivo. A cleavable linker can be introduced to release free functional domains in vivo. A cleavable linker can be cleaved by the presence of reducing reagents, proteases, to name a few. For example, a reduction of a disulfide bond may be utilized to produce a cleavable linker.
  • a cleavage event through disulfide exchange with a thiol, such as glutathione could produce a cleavage.
  • an in vivo cleavage of a linker in a recombinant fusion protein may also be carried out by proteases that can be expressed in vivo under pathological conditions (e.g. cancer or inflammation), in specific cells or tissues, or constrained within certain cellular compartments.
  • a cleavable linker may allow for targeted cleavage.
  • the specificity of many proteases can offer slower cleavage of a linker in constrained compartments.
  • a cleavable linker can also comprise hydrazone, peptides, disulfide, or thioesther.
  • a hydrazone can confer serum stability.
  • a hydrazone can allow for cleavage in an acidic compartment.
  • An acidic compartment can have a pH up to 7.
  • a linker can also include a thioether.
  • a thioether can be nonreducible
  • a thioether can be designed for intracellular proteolytic degradation.
  • an fmdv linker polypeptide comprises a sequence that can be at least about 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical to SEQ ID NO.34.
  • an fmdv linker polypeptide is one or more of the linkers encoded in a single vector linking two or more fusion proteins.
  • an fmdv linker polypeptide can be encoded by a polynucleotide open-reading frame (ORF) nucleic acid sequence.
  • ORF polynucleotide open-reading frame
  • an ORF encoding fmdv comprises or consists of a sequence of SEQ ID NO.35.
  • a polynucleotide encoding fmdv is at least 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical to SEQ ID NO.35.
  • a linker polypeptide can be a“p2a” linker.
  • a p2a polypeptide can comprise a sequence that can be about at least 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 36.
  • the p2a linker polypeptide can be one or more of the linkers encoded in a single vector linking two or more fusion proteins.
  • a p2a linker polypeptide can be encoded by a polynucleotide open-reading frame (ORF) nucleic acid sequence.
  • an ORF encoding p2a comprises or consists of the sequence of SEQ ID NO.37.
  • a polynucleotide encoding p2a can be or can be about at least 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 37.
  • a linker polypeptide can be a“GSG-p2a” linker.
  • a GSG-p2a linker polypeptide can comprise a sequence that can be about at least 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 38.
  • a GSG-p2a linker polypeptide can be one or more of the linkers encoded in a single vector linking two or more fusion proteins.
  • a GSG- p2a linker polypeptide can be encoded by a polynucleotide open-reading frame (ORF) nucleic acid sequence.
  • An ORF encoding GSG-p2a can comprises the sequence of SEQ ID NO.39.
  • a polynucleotide encoding GSG-p2a can be or can be about at least 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 39.
  • a linker polypeptide can be an“fp2a” linker as provided herein.
  • a fp2a linker polypeptide can comprise a sequence that can be about at least 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 40.
  • an fp2a linker polypeptide can be one or more of the linkers encoded in a single vector linking two or more fusion proteins.
  • a fp2a linker polypeptide can be encoded by a polynucleotide open-reading frame (ORF) nucleic acid sequence.
  • a polynucleotide encoding an fp2a linker can be or can be about at least 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 41.
  • a linker can be engineered.
  • a linker can be designed to comprise chemical characteristics such as hydrophobicity.
  • at least two linker sequences can produce the same protein.
  • a sequence can be or can be about 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% , or 100% identical to a sequence of SEQ ID NO: 42 to SEQ ID NO:101.
  • multiple linkers can be used in a vector.
  • genes of interest e.g., S100A1, SDF-1 ⁇ , and VEGF165
  • FIG 20A and FIG 20B genes can be separated by 2, 3, 4, 5, 6, 7, 8, 9, or up to 10 linkers.
  • a linker can be an engineered linker.
  • Methods of designing linkers can be computational.
  • computational methods can include graphic techniques.
  • Computation methods can be used to search for suitable peptides from libraries of three-dimensional peptide structures derived from databases. For example, a Brookhaven Protein Data Bank (PDB) can be used to span the distance in space between selected amino acids of a linker.
  • PDB Brookhaven Protein Data Bank
  • polypeptide construct comprising a furin polypeptide and a 2A polypeptide, wherein the furin polypeptide and the 2A polypeptide are connected by a polypeptide linker comprising at least three hydrophobic amino acids.
  • At least three hydrophobic amino acids are selected from the list consisting of glycine (Gly)(G), alanine (Ala)(A), valine (Val)(V), leucine (Leu)(L), isoleucine (Ile)(I), proline (Pro)(P), phenylalanine (Phe)(F), methionine (Met)(M), tryptophan (Trp)(W).
  • the linker comprises a sequence provided in Table 3 disclosed herein.
  • a polypeptide linker may also include one or more GS linker sequences, for instance (GS)n (SEQ ID NO: 109), (SG)n (SEQ ID NO: 110), (GSG)n (SEQ ID NO: 111) and (SGS)n (SEQ ID NO: 112) wherein n can be any number from zero to fifteen.
  • GS linker sequences for instance (GS)n (SEQ ID NO: 109), (SG)n (SEQ ID NO: 110), (GSG)n (SEQ ID NO: 111) and (SGS)n (SEQ ID NO: 112) wherein n can be any number from zero to fifteen.
  • a polypeptide construct comprising: providing a polynucleotide encoding said polypeptide construct comprising a first functional polypeptide and a second functional polypeptide, wherein said first functional polypeptide and second functional polypeptide are connected by a linker polypeptide comprising a sequence with at least 60% identity to the sequence APVKQ (SEQ ID NO: 42); and expressing said polynucleotide in a host cell, wherein said expressing results in an improved expression of the polypeptide construct as compared to a corresponding polypeptide construct that does not have a linker polypeptide comprising a sequence with at least 60% identity to the sequence APVKQ (SEQ ID NO: 42).
  • the linker comprises a sequence provided in Table 3 disclosed herein.
  • a polypeptide linker may also include one or more GS linker sequences, for instance (GS)n (SEQ ID NO: 109), (SG)n (SEQ ID NO: 110), (GSG)n (SEQ ID NO: 111) and (SGS)n (SEQ ID NO: 112) wherein n can be any number from zero to fifteen.
  • the improved expression is at least about 10%, 15%, 20%, 25%, 30% ,35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or 100% higher as compared to a corresponding polypeptide construct that does not have a linker polypeptide comprising a sequence with at least 60% identity to the sequence APVKQ (SEQ ID NO: 42).
  • a unique aspect of the present invention is provided and enabled by the specific sequential order of polypeptides encoded by constructs of the invention.
  • specifically placing S100A1 protein first achieves and allows functional expression of biologically active S100A1 molecules because the remaining 2A tail on S100A1 was, surprisingly, discovered not to interfere with S100A1 biological activity.
  • placing S100A1 as the second gene resulted in incomplete cleavage of genes expressed via the construct.
  • the C-terminal linker tail on S100A1 as expressed from pXoX comprises the sequence (from N- to C-terminus) S101A1 polypeptide fused to (N-terminus)-RAKRAPVKQGSGATNFSLLKQAGDVEENPG- (C-terminus) (SEQ ID NO: 123) which may be referred to herein as the "2A tail".
  • a first GOI of the invention comprises the sequence:
  • MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDK VMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENSRAKRAPVKQGSGATNFSLLK QAGDVEENPG (SEQ ID NO: 124), which may be encoded by a polynucleotide sequence: ATGGGCAGCGAACTGGAAACCGCCATGGAGACTTTGATAAATGTTTTCCACGCGCA TAGCGGCAAAGAAGGGGACAAGTACAAGCTGTCAAAAAAAAGGAGCTGAAAGAACTG CTGCAGACCGAATTGAGCGGCTTCCTGGACGCTCAGAAAGATGTCGATGCCGTCGA CAAAGTGATGAAAGAGCTTGACGAGAACGGTGACGGTGAAGTCGATTTTCAGGAAT ATGTGGTGCTGGTGGCCGCCCTTACTGTAGCATGCAACAATTTCTTTTGGGAAAATT CACGTGCAAAGCGTGCACCGGTGAAACAGGGAAGCGGAG
  • a polynucleotide vector useful for the methods and compositions described herein can be a good manufacturing practices (GMP) compatible vector.
  • GMP good manufacturing practices
  • a GMP vector may be purer than a non-GMP vector.
  • purity can be measured by bioburden.
  • bioburden can be the presence or absence of aerobes, anaerobes, sporeformers, fungi, or combinations thereof in a vector composition.
  • a pure vector can be endotoxin low or endotoxin free. Purity can also be measured by double-stranded primer-walking sequencing. Plasmid identity can be a source of determining purity of a vector.
  • a GMP vector of the invention can be from 10% to 99% more pure than a non-GMP vector.
  • a GMP vector can be from 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% more pure than a non-GMP vector as measured by the presence of bioburden, endotoxin, sequencing, or combinations thereof.
  • a terminator sequence at the end of the first gene program is used.
  • a terminator sequence can ensure that a transcript is terminating prior to initiating a second gene program.
  • an expression vectors may contain sequences necessary for the termination of transcription and for stabilizing an mRNA. Such sequences are commonly available from the 5′ and, occasionally 3′, untranslated regions of eukaryotic or viral DNAs or cDNAs. These regions can contain nucleotide segments transcribed as polyadenylated fragments in the untranslated portion of the mRNA. Cells comprising the expression vector are grown under conditions that provide for expression of the desired polypeptide, either in vivo or in vitro.
  • a spacer sequence can be used at the end of a first polypeptide encoded by a polynucleotide in a vector. In other cases, a spacer sequence can be used at the end of a second gene in a vector. A spacer sequence can also be used following a first gene and a second gene in a vector.
  • vectors can be used to express a polypeptide encoded by a gene, or portion of a gene of interest.
  • a gene of portion or a gene can be inserted by using any method, viral or non- viral.
  • a method can be a non-viral based technique.
  • vector modifications can be made.
  • a modification can include the addition of an inducible gene switch for controlled gene expression, changes in order and/or selection of cardiac effector genes to be combined, promoter replacement (e.g., strong, left ventricle specific expression), and combinations thereof.
  • polypeptides such as SDF1, S100A1 and VEGF191 may be driven via a constitutive or inducible promoter.
  • expression of at least two genes is equal. In other cases, expression of at least two genes is not equal.
  • an upstream gene may be expressed at a higher concentration than a downstream gene. In other cases, a downstream gene may be expressed at a higher concentration than an upstream gene.
  • a linker may be involved in controlling levels of expression. For example, a cleavable linker may be engineered such that cleavage is more efficient or less efficient.
  • an inducible promoter can be a small molecule ligand-inducible two polypeptide ecdysone receptor-based gene switch.
  • a gene switch can be selected from ecdysone-based receptor components as described in, but without limitation to, any of the systems described in: PCT/US2001/009050 (WO 2001/070816); U.S. Pat. Nos.7,091,038; 7,776,587; 7,807,417; 8,202,718; PCT/US2001/030608 (WO 2002/029075); U.S. Pat. Nos.
  • a ligand used for dose-regulated control of ecdysone receptor-based inducible gene switch regulation can be selected from any of, but without limitation to, an ecdysteroid, such as ecdysone, 20-hydroxyecdysone, ponasterone A, muristerone A, and the like, 9-cis-retinoic acid, synthetic analogs of retinoic acid, N,N’-diacylhydrazines such as those disclosed in U.S. Pat. Nos.6,013,836; 5,117,057; 5,530,028; and 5,378,726 and U.S. Published Application Nos.2005/0209283 and 2006/0020146; oxadiazolines as described in U.S.
  • an ecdysteroid such as ecdysone, 20-hydroxyecdysone, ponasterone A, muristerone A, and the like
  • 9-cis-retinoic acid synthetic analogs of reti
  • diacylhydrazine ligands useful in the present invention include RG- 115819 (3,5 -Dimethyl-benzoic acid N-(1-ethy1-2,2-dimethyl-propy1)-N’-(2-methyl-3- methoxy-benzoy1)-hydrazide- ), RG-115932 ((R)-3,5-Dimethyl-benzoic acid N-(1-tert-butyl- buty1)-N’-(2-ethy1-3-methoxy-benzoy1)-hydrazide), and RG-115830 (3,5 -Dimethyl-b enzoic acid N-(1-tert-butyl-buty1)-N’-(2-ethy1-3-methoxy-benzoy1)-hydrazide). See, e.g., U.S. patent application Ser. No.12/155,111, and PCT Appl. No. PCT/US2008/006757, both of which are incorporated herein by reference
  • two or three genes of interest that express polypeptides of interest, can be incorporated into and/or expressed from a single vector under control of a single promoter.
  • the single promoter is a constitutive promoter.
  • the single promoter is a constitutive tissue-specific promoter.
  • the single promoter is a small molecule ligand-inducible ecdysone receptor-based promoter.
  • expression of the gene switch polypeptides is under control of a myosin light chain (MLC) promoter.
  • MLC myosin light chain
  • Vectors can be delivered in vivo by administration to a subject, typically by systemic administration (e.g., intravenous, intraperitoneal, intramuscular, subdermal, or intracranial infusion) or topical application, as described below.
  • vectors can be delivered to cells ex vivo, such as cells explanted from a subject (e.g., cardiomyocytes, cardiac tissue biopsy), followed by reimplantation of the cells into a subject, usually after selection for cells which have incorporated the vector. Prior to or after selection, the cells can be expanded.
  • the transfection efficiency of cells with any of the nucleic acid delivery platforms described herein, for example, nucleofection or electroporation can be or can be about 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.9%, or more than 99.9%.
  • cardiomyocyte can be or can be about 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.9%, or more than 99.9%.
  • vectors that can be used include, but not limited to, Bacterial: pBs, pQE-9 (Qiagen), phagescript, PsiX174, pBluescript SK, pBsKS, pNH8a, pNH16a, pNH18a, pNH46a (Stratagene); pTrc99A, pKK223- 3, pKK233-3, pDR54O, pRIT5 (Pharmacia).
  • Bacterial pBs, pQE-9 (Qiagen), phagescript, PsiX174, pBluescript SK, pBsKS, pNH8a, pNH16a, pNH18a, pNH46a (Stratagene); pTrc99A, pKK223- 3, pKK233-3, pDR54O, pRIT5 (Pharmacia).
  • Eukaryotic pWL-neo, pSv2cat, pOG44, pXT1, pSG (Stratagene) pSVK3, pBPv, pMSG, pSVL (Pharmiacia).
  • any other plasmids and vectors can be used as long as they are replicable and viable in a selected host.
  • Any vector and those commercially available (and variants or derivatives thereof) can be engineered to include one or more recombination sites for use in the methods.
  • Such vectors can be obtained from, for example, Vector Laboratories Inc., Invitrogen, Promega, Novagen, NEB, Clontech, Boehringer Mannheim, Pharmacia, EpiCenter, OriGenes Technologies Inc., Stratagene, PerkinElmer, Pharmingen, and Research Genetics.
  • vectors of interest include eukaryotic expression vectors such as pFastBac, pFastBacHT, pFastBacDUAL, pSFV, and pTet-Splice (Invitrogen), pEUK-C1, pPUR, pMAM, pMAMneo, pBI101, pBI121, pDR2, pCMVEBNA, and pYACneo (Clontech), pSVK3, pSVL, pMSG, pCH110, and pKK232-8 (Pharmacia, Inc.), p3'SS, pXT1, pSG5, pPbac, pMbac, pMClneo, and pOG44 (Stratagene, Inc.), and pYES2, pAC360, pBlueBa- cHis A, B, and C, pVL1392, pBlueBac111,
  • vectors include pUC18, pUC19, pBlueScript, pSPORT, cosmids, phagemids, YAC's (yeast artificial chromosomes), BAC's (bacterial artificial chromosomes), P1 (Escherichia coli phage), pQE70, pQE60, pQE9 (quagan), pBS vectors, PhageScript vectors, BlueScript vectors, pNH8A, pNH16A, pNH18A, pNH46A (Stratagene), pcDNA3 (Invitrogen), pGEX, pTrsfus, pTrc99A, pET-5, pET-9, pKK223-3, pKK233-3, pDR540, pRIT5 (Pharmacia), pSPORT1, pSPORT2, pCMVSPORT2.0 and pSYSPORT1 (Invitrogen) and variants or derivatives thereof.
  • Additional vectors of interest can also include pTrxFus, pThioHis, pLEX, pTrcHis, pTrcHis2, pRSET, pBlueBa-cHis2, pcDNA3.1/His, pcDNA3.1(-)/Myc-His, pSecTag, pEBVHis, pPIC9K, pPIC3.5K, pA081S, pPICZ, pPICZA, pPICZB, pPICZC, pGAPZA, pGAPZB, pGAPZC, pBlue- Bac4.5, pBlueBacHis2, pMelBac, pSinRep5, pSinHis, pIND, pIND(SP1), pVgRXR, pcDNA2.1, pYES2, pZEr01.1, pZErO-2.1, pCR-Bl
  • a cardiovascular disease can be cardiomyopathy.
  • Cardiomyopathy can be defined by a pathologically abnormal myocardium. There can be four major classifications of cardiomyopathy: dilated (DCM), hypertrophic (HCM), restrictive (RCM), and arrhythmogenic RV (ARVC).
  • DCM dilated
  • HCM hypertrophic
  • RCM restrictive
  • ARVC arrhythmogenic RV
  • Vectors comprising polynucleotides described herein can be used to treat cardiomyopathy using gene therapy.
  • at least one additional therapy is also administered before, during, after, or any combination thereof of a gene therapy treatment.
  • a polypeptide can be incorporated in a polynucleotide sequence described herein and introduced to a subject with a disorder, or in need of improved vasculogenesis.
  • a subject can have a cardiomyopathy disorder and can be treated by administration of a polynucleotide described herein to treat the disorder.
  • a polynucleotide encoding a gene or a polypeptide described herein can be introduced by gene therapy.
  • Genes and polypeptides that can be introduced to a subject with a cardiomyopathy can include for instance: ATP-binding cassette, sub-family C, member 9 (ABCC9), Actin, ⁇ , cardiac muscle 1 (ACTC1), Actinin, ⁇ 2 (ACTN2), Ankyrin repeat domain 1 (cardiac muscle) (ANKRD1), BCL2-associated athanogene 3 (BAG3), Calsequestrin 2 (cardiac muscle) (CASQ2), Caveolin 3 (CAV3), COX15 homolog, cytochrome c oxidase assembly protein (COX15), Crystallin ⁇ B Cysteine and glycine-rich protein 3 (CRYAB), Cysteine and glycine-rich protein 3 (CSRP3), Cardiotrophin 1 (CTF1), Desmin (DES), Dystrophin (DMD), DnaJ (Hsp40) homolog, subfamily C, member 19 (DNAJC19), Desmocollin 2 (DSC2), Desmog
  • LAMP2 LIM domain binding 3 (LDB3), Lamin A/C (LMNA), Myosin binding protein C, cardiac (MYBPC3), Myosin, heavy chain 6, cardiac muscle, ⁇ (MYH6), Myosin, heavy chain 7, cardiac muscle, ⁇ (MYH7), Myosin, light chain 2, regulatory, cardiac, slow (MYHl2), Myosin, light chain 3, alkali; ventricular, skeletal, slow (MYL3), Myosin light chain kinase 2 (MYLK2), Myozenin 2 (MYOZ2), Nexilin (F actin binding protein) (NEXN), Plakophilin 2 (PKP2), Phospholamban (PLN), Protein kinase, AMP-activated, ⁇ 2, non-catalytic subunit (PRKAG2), Presenilin 1 (PSEN1), Presenilin 2 (PSEN2), RNA binding motif protein 20 (RBM20),
  • Ryanodine receptor 2 (cardiac) (RYR2), Sodium channel, voltage-gated, type V, ⁇ subunit (SCN5A) Succinate dehydrogenase complex, subunit A, flavoprotein (SDHA), Sarcoglycan, ⁇ (SGCD,) Spectrin repeat containing, nuclear envelope 1(SYNE 1), Spectrin repeat containing, nuclear envelope 2 (SYNE2), Tafazzin (TAZ), Titin-cap (telethonin) (TCAP), Transmembrane protein 43 (TMEM43), Thymopoietin (TMPO), Troponin C type 1 (slow) (TNNC1), Troponin I type 3 (cardiac) (TNNi3), Troponin T type 2 (cardiac) (TNNT2), Tropomyosin 1 ( ⁇ )Titin (TPM1), TransthyreTIN (TTR), Titin (TTN), Vinculin (VCL), and any combination of portion thereof.
  • polynucleotide constructs comprising functional polypeptides attached by a linker construct disclosed herein.
  • methods for treatment, diagnosis and other therapeutic purposes comprising using or administering to a subject a polynucleotide described herein, or a polypeptide encoded thereby, or conjugates or derivatives thereof.
  • the disclosed methods and compositions may be applied for treatment of diseases and conditions.
  • An example of a condition can be cancer.
  • a cancer or malignancy can include, but is not limited to: acute childhood lymphoblastic leukemia, acute lymphoblastic leukemia, acute lymphocytic leukemia, acute myeloid leukemia, adrenocortical carcinoma, adult (primary) hepatocellular cancer, adult (primary) liver cancer, adult acute lymphocytic leukemia, adult acute myeloid leukemia, adult Hodgkin’s lymphoma, adult lymphocytic leukemia, adult non- Hodgkin’s lymphoma, adult primary liver cancer, adult soft tissue sarcoma, aids-related lymphoma, aids-related malignancies, anal cancer, astrocytoma, bile duct cancer, bladder cancer, bone cancer, brain stem glioma, brain tumors, breast cancer, cancer of the renal pelvis and ureter, central nervous system (primary) lymphoma, central nervous system lymphoma, cerebellar astrocytoma, cerebral astrocyto
  • childhood (primary) liver cancer childhood acute lymphoblastic leukemia, childhood acute myeloid leukemia, childhood brain stem glioma, childhood cerebellar astrocytoma, childhood cerebral astrocytoma, childhood extracranial germ cell tumors, childhood Hodgkin’s disease, childhood Hodgkin’s lymphoma, childhood hypothalamic and visual pathway glioma, childhood lymphoblastic leukemia, childhood medulloblastoma, childhood non-Hodgkin’s lymphoma, childhood pineal and supratentorial primitive
  • neuroectodermal tumors childhood primary liver cancer, childhood rhabdomyosarcoma, childhood soft tissue sarcoma, childhood visual pathway and hypothalamic glioma, chronic lymphocytic leukemia, chronic myelogenous leukemia, colon cancer, cutaneous t-cell lymphoma, endocrine pancreas islet cell carcinoma, endometrial cancer, ependymoma, epithelial cancer, esophageal cancer, Ewing’s sarcoma and related tumors, exocrine pancreatic cancer, extracranial germ cell tumor, extragonadal germ cell tumor, extrahepatic bile duct cancer, eye cancer, female breast cancer, Gaucher's disease, gallbladder cancer, gastric cancer,
  • gastrointestinal carcinoid tumor gastrointestinal tumors, germ cell tumors, gestational trophoblastic tumor, hairy cell leukemia, head and neck cancer, hepatocellular cancer,
  • lymphoproliferative disorders macroglobulinemia, male breast cancer, malignant mesothelioma, malignant thymoma, medulloblastoma, melanoma, mesothelioma, metastatic occult primary squamous neck cancer, metastatic primary squamous neck cancer, metastatic squamous neck cancer, multiple myeloma, multiple myeloma/plasma cell neoplasm, myelodysplastic syndrome, myelogenous leukemia, myeloid leukemia, myeloproliferative disorders, nasal cavity and paranasal sinus cancer, nasopharyngeal cancer, neuroblastoma, non-Hodgkin’s lymphoma, nonmelanoma skin cancer, non-small cell lung cancer, occult primary metastatic squamous neck cancer, oropharyngeal cancer, osteo-/malignant fibrous sarcoma, osteosarcoma/
  • Dysplasia can frequently be a forerunner of cancer, and is found mainly in the epithelia. It is the most disorderly form of non-neoplastic cell growth, involving a loss in individual cell uniformity and in the architectural orientation of cells. Dysplasia characteristically occurs where there exists chronic irritation or inflammation.
  • Dysplastic disorders which can be treated include, but are not limited to, anhidrotic ectodermal dysplasia, anterofacial dysplasia, asphyxiating thoracic dysplasia, atriodigital dysplasia, bronchopulmonary dysplasia, cerebral dysplasia, cervical dysplasia, chondroectodermal dysplasia, cleidocranial dysplasia, congenital ectodermal dysplasia, craniodiaphysial dysplasia, craniocarpotarsal dysplasia, craniometaphysial dysplasia, dentin dysplasia, diaphysial dysplasia, ectodermal dysplasia, enamel dysplasia, encephalo-ophthalmic dysplasia, dysplasia epiphysialis hemimelia, dysplasia epiphysialis multiplex, dysplasia epiphysialis punctata, epi
  • Additional pre-neoplastic disorders which can be treated include, but are not limited to, benign dysproliferative disorders (e.g., benign tumors, fibrocystic conditions, tissue hypertrophy, intestinal polyps or adenomas, and esophageal dysplasia), leukoplakia, keratoses, Bowen's disease, Farmer's Skin, solar cheilitis, and solar keratosis.
  • a polypeptide construct encoded by a polynucleotide disclosed herein, comprising at least two functional polypeptides connected by a linker disclosed herein is used to inhibit growth, progression, and/or metastasis of cancers, in particular those listed above.
  • Additional hyperproliferative diseases, disorders, and/or conditions include, but are not limited to, progression, and/or metastases of malignancies and related disorders such as leukemia (including acute leukemias (e.g., acute lymphocytic leukemia, acute myelocytic leukemia (including myeloblastic, promyelocytic, myelomonocytic, monocytic, and erythroleukemia)) and chronic leukemias (e.g., chronic myelocytic (granulocytic) leukemia and chronic lymphocytic leukemia)), polycythemia vera, lymphomas (e.g., Hodgkin's disease and non-Hodgkin's disease), multiple myeloma, Waldenstrom’ s macroglobulinemia, heavy chain disease, and solid tumors including, but not limited to, sarcomas and carcinomas such as fibrosarcoma, myosarcoma, liposarcoma
  • lymphangiosarcoma lymphangioendotheliosarcoma, synovioma, mesothelioma, Ewing's tumor, leiomyosarcoma, rhabdomyosarcoma, colon carcinoma, pancreatic cancer, breast cancer, ovarian cancer, prostate cancer, squamous cell carcinoma, basal cell carcinoma,
  • adenocarcinoma sweat gland carcinoma, sebaceous gland carcinoma, papillary carcinoma, papillary adenocarcinomas, cystadenocarcinoma, medullary carcinoma, bronchogenic carcinoma, renal cell carcinoma, hepatoma, bile duct carcinoma, choriocarcinoma, seminoma, embryonal carcinoma, Wilm's tumor, cervical cancer, testicular tumor, lung carcinoma, small cell lung carcinoma, bladder carcinoma, epithelial carcinoma, glioma, astrocytoma,
  • medulloblastoma craniopharyngioma, ependymoma, pinealoma, emangioblastoma, acoustic neuroma, oligodendroglioma, meningioma, melanoma, neuroblastoma, and retinoblastoma.
  • a polypeptide construct encoded by a polynucleotide disclosed herein, comprising at least two functional polypeptides connected by a linker disclosed herein is used to treat diseases including, but are not limited to immune dysregulation disease and related autoimmune diseases, including Class III autoimmune diseases such as immune-mediated thrombocytopenias, such as acute idiopathic thrombocytopenic purpura and chronic idiopathic thrombocytopenic purpura, dermatomyositis, Sjögren's syndrome, multiple sclerosis, Sydenham's chorea, myasthenia gravis, systemic lupus erythematosus, lupus nephritis, rheumatic fever, polyglandular syndromes, bullous pemphigoid, diabetes mellitus, Henoch-Schonlein purpura, post-streptococcal nephritis, erythema nodo
  • autoimmune diseases including, but are
  • thromboangitis obliterans Sjögren's syndrome, primary biliary cirrhosis, Hashimoto's thyroiditis, thyrotoxicosis, scleroderma, chronic active hepatitis, rheumatoid arthritis, polymyositis/dermatomyositis, polychondritis, pemphigus vulgaris, Wegener's granulomatosis, membranous nephropathy, amyotrophic lateral sclerosis, tabes dorsalis, giant cell
  • a polypeptide construct encoded by a polynucleotide disclosed herein, comprising at least two functional polypeptides connected by a linker disclosed herein is used to treat infectious diseases.
  • Infectious diseases can be infection by pathogens such as bacteria, rickettsia, mycoplasma, protozoa, fungi, viruses, parasites, or other microbial agents.
  • HIV human immunodeficiency virus
  • examples include human immunodeficiency virus (HIV) causing AIDS, Mycobacterium of tuberculosis, Streptococcus agalactiae, methicillin-resistant Staphylococcus aureus, Legionella pneumophilia, Streptococcus pyogenes, Escherichia coli, Neisseria gonorrhoeae, Neisseria meningitides, Pneumococcus, Cryptococcus neoformans, Histoplasma capsulatum, Hemophilis influenzae B, Treponema pallidum, Lyme disease spirochetes, West Nile virus, Pseudomonas aeruginosa, Mycobacterium leprae, Brucella abortus, rabies virus, influenza virus,
  • HCV human immunodeficiency virus
  • herpes simplex virus I herpes simplex virus II
  • human serum parvo-like virus respiratory syncytial virus
  • varicella-zoster virus hepatitis B virus
  • hepatitis C virus measles virus
  • human T-cell leukemia viruses Epstein-Barr virus
  • murine leukemia virus mumps virus
  • vesicular stomatitis virus Sindbis virus
  • lymphocytic choriomeningitis virus wart virus, blue tongue virus
  • Sendai virus feline leukemia virus, reo virus, polio virus, simian virus 40
  • mouse mammary tumor virus dengue virus
  • rubella virus Plasmodium falciparum
  • Trypanosoma rhodesiensei Trypanosoma brucei, Schistosoma mansoni, Schistosoma japanicum, Babesia bovis, Elmeria tenella, Onchocerca volvulus, Leishmania tropica,
  • Trichinella spiralis Theileria parva, Taenia hydatigena, Taenia ovis, Taenia saginata,
  • Echinococcus granulosus Mesocestoides corti, Mycoplasma arthritidis, M. hyorhinis, M. orale, M. arginini, Acholeplasma laidlawii, M. salivarium and M. pneumoniae.
  • a polypeptide construct encoded by a polynucleotide disclosed herein, comprising at least two functional polypeptides connected by a linker disclosed herein is used in conjugation with a chemotherapeutic agent, or in addition to, or simultaneously with a chemotherapeutic agent.
  • A“chemotherapeutic agent” or“chemotherapeutic compound” and their grammatical equivalents as used herein, can be a chemical compound useful in the treatment of cancer.
  • Genes and polypeptides encoded by polynucleotides useful for gene therapy can be introduced into a subject sequentially, concurrently, or a combination thereof.
  • Genes and polypeptides to be administered to a subject can be on a single polynucleotide vector or on separate polynucleotide vectors. In some cases, a multigene vector is used to introduce multiple genes using a single vector construct.
  • a molecular target for cardiovascular therapy can be VEGF-A, FGF4, Sarcoplasmic reticulum Ca 2+ ATPase, S100A1, beta- adrenergic receptor, Adenylyl-cyclase 6, or combinations thereof.
  • genes to be introduced for cardiovascular gene therapy can be SDF1, S100A1, VEGF191, or any combination thereof.
  • S100 is part of a family of Ca ⁇ +-modulated proteins implicated in intracellular regulatory activities.
  • S100A1 can be the most abundant S100 protein isoform in a heart. It can promote cardiac contractile and relaxation function by enhancing activity of both ryanodine receptors (RYRs) and SERCA2a.
  • RYRs ryanodine receptors
  • SERCA2a SERCA2a
  • S100 can exert profound ionotropic actions through modulation of cardiomyocyte Ca2+ homeostasis and myofilament function independent of beta-adrenergic stimulation.
  • S100A1 can interact in a Ca2+-dependent manner with the RyR and stabilizes the SERCA2a-PLN complex.
  • S100A1 can also diminish the diastolic leak of Ca2+ and influences cardiac titin and
  • an angiogenic polypeptide or gene can be utilized for angiogenic purposes.
  • angiogenic growth factors such as VEGF-A165, angiopoietins, FGF, 126, HIF-1a26, or combinations thereof.
  • VEGF-A165 vascular endothelial growth factor
  • FGF vascular endothelial growth factor
  • 126 vascular endothelial growth factor
  • HIF-1a26 vascular endothelial growth factor
  • polypeptides can promote the development of collateral blood vessels in ischemia-related conditions, such as chronic critical limb ischemia, myocardial ischemia, angina, or peripheral arterial occlusive disease.
  • Angiogenic factors can also induce formation of new vascular networks, which can make them suitable therapeutic options for treating acute coronary syndromes and peripheral vascular diseases.
  • Several types of angiogenic factors can exhibit different properties have been explored in therapeutic applications for cardiovascular disease.
  • VEGF and subtypes of VEGF can be used.
  • Subtypes of VEGF can comprise: VEGF-A, VEGF-B, VEGF-C, VEGF-D, placental growth factor (PlGF), and combinations thereof. Some of these factors also yield distinct isoforms.
  • the intracellular signals of these VEGF subtypes can be mediated mainly by three different tyrosine kinase receptors: VEGFR1, VEGFR2, and VEGFR3. Specific interaction between these VEGF subtypes and their cognate cellular receptors can evoke a differential cellular response in endothelial cells and cardiomyocytes.
  • an isoform of VEGF-A can have high angiogenic.
  • VEGF-A165 can interact with VEGFR1 and VEGFR2.
  • Interaction of VEGF-A165 with VEGFR1 on endothelial cells can contribute to vascular stability of newly formed vessels. Its interaction with VEGFR2 on endothelial cells can induce angiogenesis, vasculogenesis, and arteriogenesis, vasodilation, cell survival, and increase of cell permeability.
  • Activation of VEGFR2 in newly formed cardiomyocytes can increase expression of anti- apoptotic proteins and reduced expression of pro-apoptotic proteins.
  • VEGFR2 activation can induce recruitment of local cardiac stem cells in ischemic areas.
  • a pro-angiogenic factor or gene can be expressed with a vector of the invention.
  • a pro-angiogenic factor can be VEGF, basic fibroblast growth factor (bFGF), or transforming growth factor ⁇ -1(TGF ⁇ -1), acidic fibroblast growth factor, angiogenin, hepatocyte growth factor, interleukin-8, placental growth factor, platelet-derived growth factor, pleiotropin, proliferin, tumor necrosis factor-alpha, to any combination thereof.
  • cardiac effector genes or polypeptides used and incorporated into cardiac expression vectors of the invention can be selected from any one of as SDF1, S100A1 and VEGF191.
  • a cardiac expression vector of the invention comprises or consists of any two genes selected from SDF1, S100A1 and VEGF191, in any combination of sequential order on the vector.
  • a cardiac expression vector comprises a polynucleotide encoding SDF1, S100A1 and; VEGF191, in any combination of sequential order on the vector.
  • an SDF1 coding sequence comprises a polynucleotide encoding an SDF1 polypeptide.
  • the SDF1 polypeptide is at least 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 102.
  • an SDF1 coding sequence comprises of an SDF1 codon optimized open reading frame (ORF), SEQ ID NO: 103.
  • a polynucleotide encoding SDF1 is at least 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 103.
  • a S100A1 coding sequence comprises a polynucleotide encoding an S100A1 polypeptide.
  • the S100A1 polypeptide is at least 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 104.
  • the S100A1 coding sequence comprises or consists of the S100A1 open reading frame (ORF).
  • a polynucleotide encoding S100A1 is at least 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 105.
  • a VEGF191 coding sequence can comprises a polynucleotide encoding a VEGF191 polypeptide.
  • the VEGF191 polypeptide is at least 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 106.
  • a VEGF191 coding sequence can comprises a VEGF191 open reading frame (ORF).
  • the polynucleotide encoding VEGF191 is at least 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 107.
  • Table 4 Pol peptide sequences and pol nucleotide sequences
  • compositions described throughout can be formulation into a pharmaceutical medicament and be used to treat a human or mammal, in need thereof, diagnosed with a disease, e.g., cardiovascular disease.
  • a disease e.g., cardiovascular disease.
  • These medicaments can be co-administered with one or more vectors.
  • Vectors comprising polynucleotides described herein, including viral and non-viral vectors containing nucleic acids encoding engineered CRISPR, TALEN, Argonaut, transposon- based, ZEN, meganuclease, or Mega-TAL molecules, transposon and/or transgenes can also be administered directly to an organism for transfection or transduction of cells in vivo.
  • naked DNA or mRNA comprising polynucleotides described herein can be administered.
  • Administration is by any of the routes normally used for introducing a molecule into ultimate contact with blood or tissue cells including, but not limited to, injection, infusion, topical application and electroporation. More than one route can be used to administer a particular composition.
  • Pharmaceutically acceptable carriers are determined in part by the particular composition being administered, as well as by the particular method used to administer the composition.
  • vectors comprising polynucleotides described herein can be administered to a subject in need thereof in conjunction with, or separately with secondary therapies.
  • a secondary therapy can be an agent for improved vasculogenesis, pulmonary hypertension, aldosterone receptor antagonists, angiotensin converting enzyme inhibitors, angiotensin receptor blockers, angiotensin receptor blockers and neprilysin inhibitors, antiadrenergic agents, centrally acting, antiadrenergic agents, peripherally acting antianginal agents, antiarrhythmic agents, group I antiarrhythmic agents, group II antiarrhythmics, group III antiarrhythmics, group IV antiarrhythmics, group V antiarrhythmics, anticholinergic chronotropic agents, antihypertensive combinations, ACE inhibitors with calcium channel blocking agents, ACE inhibitors with thiazides, angiotensin II inhibitors with calcium channel blockers, angiotensin II inhibitors with thiazides, antiadrene
  • Anti-angiogenic agents can also be used in conjunction with polynucleotides described herein. Suitable anti-angiogenic agents for use in the disclosed methods and compositions include anti-VEGF antibodies, including humanized and chimeric antibodies, anti-VEGF aptamers and antisense oligonucleotides. In some cases, for example, in the compositions, formulations and methods of treating cancer, the unit dosage of the composition or formulation administered can be 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95 or 100 mg.
  • angiogenesis Other inhibitors of angiogenesis include angiostatin, endostatin, interferons, interleukin 1 (including ⁇ and ⁇ ) interleukin 12, retinoic acid, and tissue inhibitors of metalloproteinase-1 and -2. (TIMP-1 and -2).
  • tissue inhibitors of metalloproteinase-1 and -2 tissue inhibitors of metalloproteinase-1 and -2.
  • TIMP-1 and -2 tissue inhibitors of metalloproteinase-1 and -2.
  • Small molecules including topoisomerases such as razoxane, a topoisomerase II inhibitor with anti-angiogenic activity, can also be used.
  • the unit dosage of the composition or formulation administered can be 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95 or 100 mg.
  • the total amount of the composition or formulation administered can be 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 40, 50, 60, 70, 80, 90, or 100 g.
  • Vectors comprising polynucleotides described herein can be constructed and introduced into a subject as described herein. These vectors can be used for gene therapy. These vectors can be used to treat disease in a recipient (e.g., a human).
  • a recipient e.g., a human
  • polynucleotides described herein and/or polypeptides encoded by polynucleotides described herein can be administered to a subject to treat cardiovascular disease or improve vasculogenesis in the subject.
  • a subject treated by a method described herein, or by contact with or administration of a composition described herein can be a mammalian subject who can be a human subject, a non- human primate, a canine mammal, a felid mammal or any other mammal.
  • Described herein is a method of treating a disease (e.g., cardiovascular disease) in a recipient comprising introducing at least one vector comprising at least one polynucleotides described herein into a subject with cardiovascular disease.
  • a vector is introduced to a cell.
  • a cardiovascular disease can be cardiomyopathy.
  • Cardiomyopathy can be defined by a pathologically abnormal myocardium. There can be four major classifications of cardiomyopathy: dilated (DCM), hypertrophic (HCM), restrictive (RCM), and arrhythmogenic RV (ARVC). Cardiomyopathy can be diagnosed through in vivo imaging, with either echocardiography or, increasingly, cardiac MRI. DCM can refer to enlargement of the heart, which often affects all four chambers, especially late in the disease. Most commonly, DCM can be associated with reduced LV function or systolic function, although early in the disease the LV may be dilated, with only minimally reduced function. In contrast, HCM can be
  • RCM characterized by increased LV wall thickness, often targeting the septum that separates the LV from the RV.
  • RCM can be elusive in some cases, in part because the heart may appear morphologically close to normal, with only minor increased wall thickness or modestly decreased LV ejection fraction. The infiltrative process underlying RCM may not be readily detectable in vivo with even the most sensitive imaging technique.
  • RCM can be characterized by impaired filling of the heart, known as diastolic dysfunction, which reduces cardiac output.
  • ARVC can be characterized by reduced function and thinning of the RV with a fibrofatty infiltration that can be seen on MRI.
  • a cardiomyopathy patient can be treated with a vector of the invention.
  • a method provided herein can be used for treating or preventing disease including, but not limited to, cancer, cardiovascular diseases, lung diseases, liver diseases, skin diseases, or neurological diseases.
  • a method provided herein can be used for improved vasculogenesis in a subject.
  • “Improving” and its grammatical equivalents as used herein can mean any improvement recognized by one of skill in the art.
  • improving cardiovascular disease can mean lessening arrhythmia, which can encompass a decrease, lessening, or diminishing of an undesirable effect or symptom.
  • improving disease can mean lessening tumor load, which can encompass a decrease, lessening, or diminishing of an undesirable effect or symptom.
  • a subject may experience reduction of a tumor load, extended survival, complete remission, stabilization to name a few improvements.
  • Another indication of improvement can be the days a subject does not require therapy.
  • a recipient can require no therapy for at least or at least about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more days. This can indicate that a treatment was successful. This can also indicate that there is no toxicity associated with the administration of the polynucleic acids described herein.
  • a subject can require no therapy for at least 1 day.
  • a recipient can also require no therapy for at least 7 days.
  • a recipient can require no therapy for at least 14 days.
  • a recipient can require no therapy for at least 21 days.
  • a recipient can require no therapy for at least 28 days.
  • a recipient can require no therapy for at least 60 days.
  • a recipient can require no therapy for at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more years.
  • Another indication of improvement can be the days a recipient requires reduced therapy.
  • a recipient can require reduced therapy administrations for at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more days. This can indicate that treatment was successful.
  • a recipient can require reduced therapy for at least 1 day.
  • a recipient can also require reduced therapy for at least 7 days.
  • a recipient can require reduced therapy for at least 14 days.
  • a recipient can require reduced therapy for at least 21 days.
  • a recipient can require reduced therapy for at least 28 days.
  • a recipient can require reduced therapy for at least 60 days.
  • a recipient can require reduced therapy for at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more years.
  • percutaneous coronary artery catheterization can be a minimally invasive procedure that can allow for homogeneous gene delivery to each region of a heart.
  • gene delivery can be impeded in patients with severe coronary artery disease.
  • a vector can be injected in a catheter without interruption of coronary flow.
  • enhanced vector residence time in coronary circulation can be achievable with coronary venous blockade.
  • antegrade coronary infusion with a short occlusion of both a coronary artery and a coronary vein enhanced myocardial gene expression can enhance vector residence time.
  • an extracorporeal device can drain blood from a coronary sinus using an occlusion catheter and return oxygenated coronary venous blood to a left main coronary artery via a peristaltic pump (V-Focus; Osprey Medical Inc.) Utilizing this method can allow for selective administration of endothelial permeabilizing agents without systemic side effects.
  • transfection efficacy can correlate with coronary flow as well as exposure time and vector concentration.
  • antegrade coronary artery infusion supported by an increased coronary flow for example using an intra-aortic balloon pump, might further enhance cardiac gene transfer
  • a direct injection of a vector into the heart can be performed.
  • a vector can be injected epicardially or endocardially into a target area.
  • a direct injection can bypass an endothelial barrier. This can result in a high local concentration at an injection site.
  • direct injection can avoid exposure to circulating blood.
  • a direct injection of a vector into a heart can avoid deactivation of a vector by circulating DNases or neutralizing antibodies.
  • a direct vector injection can also reduce exposure of a vector to off- target organs, although local administration cannot completely avoid some systemic vector distribution. Low volumes at high vector concentrations may also increase vector retention in a myocardium.
  • a vector can be introduced during a thoracotomy.
  • a vector can also be introduced pericardially.
  • a vector can be introduced using retrograde perfusion, for instance as disclosed in FIG.9.
  • the transfected cells can be functional in the recipient. Functionality can in some cases determine whether gene therapy was successful. For example, the transfected cells can be functional for at least or at least about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more days. This can indicate that gene therapy was successful. This can also indicate that there is no rejection of the transplanted cells or vectors.
  • transfected cells can be functional for at least 1 day. Transfected cells can also functional for at least 7 days. Transfected cells can be functional for at least 14 days. Transfected cells can be functional for at least 21 days. Transfected cells can be functional for at least 28 days. Transfected cells can be functional for at least 60 days.
  • Routes of Administration [0227] Previously, delivery techniques of therapeutics into the heart have included intramyocardial administration (transepicardially or transendocardially) or antegrade delivery into the coronary artery. The transepicardial route suffers the drawback of surgical invasiveness.
  • the transendocardial approach requires complex electromagnetic mapping using systems such as the NOGA device which is not applicable for patients with thinned myocardium, as this technique may cause perforation.
  • Other devices such as the Biocardia– Helical infusion catheter or the Celyad– C-Cath also have the limitations of wall thickness.
  • Antegrade administration into the coronary artery is associated with a lower biologic retention [12], as compared to intramyocardial administration. Additionally, administration of biologics into the coronary artery has been shown to increase risk of coronary embolism and ST segment elevations [13] [14] [15] [16] [17]. Also with pDNA administration, the direct contact with a large blood volume may decrease the effect before entering into the target tissue.
  • the coronary sinus drains the venous system of the ventricular cavities, which are responsible for the majority of cardiac contraction.
  • the technique of retrograde delivery into the coronary sinus has been widely used for the administration of cardioplegia solution due in part to superior distribution of the solution throughout the myocardium as compared to antegrade delivery [18]. Additionally, the procedure has been demonstrated clinically safe for administration of oxygenated blood during high risk percutaneous transluminal coronary angioplasty [19] [20] [21].
  • the process of retrograde administration into the coronary sinus involves temporary occlusion of afferent coronary circulation by means of a balloon catheter followed by administration against the outflowing blood. This results in the solution entering the myocardium via post capillary venules.
  • post-capillary venules In contrast to arterioles or capillaries, post-capillary venules have the smallest vessel diameter and conceptually would allow for greatest transfer of material into the interstitium [22]. Physiologically, it is known that post-capillary venules are a major target of immune/inflammatory cell migration across the endothelium, in part due to expression of adhesion molecules such as ELAM-1 [23], ICAM-1 [24], CD18 [25], and CD44 [26], and in part because of biomechanical properties.
  • adhesion molecules such as ELAM-1 [23], ICAM-1 [24], CD18 [25], and CD44 [26]
  • Boekstegers et al [32] delivered adenovirus expressing beta-gal and Luciferase into the porcine myocardium comparing antegrade delivery into the coronary artery or retrograde via the anterior cardiac vein. Significantly elevated expression of the gene in infarct tissue in a homogenous manner was observed via the retrograde method as compared to antegrade. Similar results were reported by Alino et al [33], who observed interstitial expression of eGFP in porcine hearts that were injected in the retrograde manner with naked DNA.
  • a preferred embodiment of the present invention comprises use of retrograde administration via the coronary sinus.
  • Another embodiment of the present invention comprises use of intracoronary or intramyocardial routes of administration.
  • Ultrasound targeted microbubble destruction gene delivery (UTMD)
  • microbubbles are useful ultrasound contrast agents.
  • microbubbles are used for delivering vectors, genes and/or constructs described herein to tissues and/or organs in a subject.
  • the delivery can be organ or tissue-specific.
  • microbubbles oscillate. With higher ultrasound energies, oscillation amplitudes increase, leading to microbubble destruction.
  • This phenomenon is used to deliver a vector or composition described herein into a target organ, for instance, by administering microbubbles loaded with compositions or gene therapy vectors described herein, for instance by i.v. injection, and subsequently exposing to ultrasound energy resulting in microbubble destruction at a target site.
  • bioactive molecules such as plasmid vectors described herein, polynucleotides encoding gene constructs described herein, are added to, for instance, the cationic shells of lipid microbubble contrast agents.
  • These vector-carrying microbubbles can be administered to the subject for instance, intravenously or directly to the left ventricle of the heart amongst other administration options.
  • the microbubbles they can be infused through an intracoronary catheter. The subsequent delivery from the circulation to a target organ occurs by acoustic cavitation at a resonant frequency of the microbubbles.
  • the mechanical energy generated by the microbubble destruction may result in transient pore formation in or between the endothelial cells of the microvasculature of the targeted region.
  • the transfection efficiency into and across the endothelial cells is enhanced, and transgene-encoding vectors are deposited into the surrounding tissue.
  • any additional plasmid DNA remaining in the circulation can be degraded by nucleases in the blood, thereby resulting in highly specific target-organ transfection to the organs exposed to ultrasound sonication, and reducing the likelihood of delivery to non-sonicated tissues.
  • Cardiomyocytes were transfected with luciferase vectors with or without (i.e., plus (+) or minus ( - )) att-site, and plus ( + ) or minus ( - ) SpBC2 recombinase. Luciferase expression was then monitored over time to assess att-site mediated recombination. To determine site specificity and efficacy of SpBC2 and its proposed site of activity (Att-site), cardiomyocytes were co-transfected with a SpBC2 plasmid and a Firefly luciferase ("FLUC" or "Luc”) plasmid vector containing att-site around the gene of interest.
  • FLUC Firefly luciferase
  • Controls included were Att-Luc plasmid without SpBC2 (to measure random integration), No-Att-Luc plasmid with SpBC2 (to measure non-att-site specific integration), and No-Att-Luc plasmid without SpBC2 (to measure transient expression).
  • Cells were transfected via DNAfectin (Applied Biological Materials Inc.,
  • Transfection was performed by utilizing complete growth media and transfection media (Prigrow I without FBS/antibiotics). At least 1 hour prior to transfection, media was removed from cardiomyocytes and replaced with fresh growth media. 3 mL/well in 6 well plate or 1.5 mL/well in 12 well plates. The DNAfectin reagent was warmed to room temperature prior to use and vortexed briefly to mix. The various combinations of DNAfectin-plasmid DNA complexes were prepared in transfection media as follows:
  • a Human Umbilical Vein Endothelial Cell (HUVEC) proliferation assay was used to assess the functionality of VEGF165 expressed by pXoX. Serum-starved HUVECs were treated with conditioned media from patients (dilated, hypertrophic), or healthy iPSC-derived cardiomyocytes transfected with pXoX or a single effector control (pVEGF165 positive control, pSDF-1 ⁇ negative control). After 96 hours of incubation, HUVEC proliferation was quantitated using a luminescence assay. Assay were repeated three times (e.g., CM-1, CM-2, CM-3).
  • iPSC cardiomyocyte cells were transfected with singe gene, dual-gene, or triple-gene vectors encoding for S100A1 and VEGF; S100A1, SDF1, and VEGF; or VEGF alone. 48 hours post transfection cellular supernatant was collected. HUVECs were seeded on 6-well plates at a density of approximately 1:10, 1:100, and 1:1000 in the supernatant collected from the transfected iPSC cells. 96 hours following introduction of the supernatant, HUVEC
  • FIG.5A and FIG.5B show experimental data.
  • FIG.14A and FIG.14B show similar results for iPSC cells derived from a dilated cardiomyopathy patient.
  • Cardiomyocyte-iPSC cells were obtained from patients with dilated cardiomyopathy (DCM), hypertrophy cardiomyopathy (HCM) or healthy controls. iPSC cells were transfected with singe gene, dual-gene, or triple-gene vectors encoding for S100A1 and VEGF; S100A1, SDF1, and VEGF; or VEGF alone. 48 hours post transfection cellular supernatant was collected. HUVECs were seeded on 6-well plates at a density of approximately 1:10, 1:100, and 1:1000 in the supernatant collected from the transfected iPSC cells. 96 hours following introduction of the supernatant, HUVEC proliferation was measured by CellTiter-Glo Assay, FIG.6 shows experimental data.
  • iPSC-CMs transfected with singe gene, dual-gene, or triple-gene vector constructs showed 4-10-fold increase in HUVEC proliferation in both cases.
  • linkers provided herein i.e., induce HUVEC proliferation similar to that observed with a single VEGF165 effector plasmid.
  • Endothelial Tube Formation Assay (CBA200, Cell Biolabs Inc., San Diego, CA, USA) will be used in addition to the HUVEC proliferation assay. ECM gel will be thawed at 4°C and mixed to homogeneity using cooled pipette tips. Cell culture plates (96-well) were bottom-coated with a thin layer of ECM gel (50 ⁇ l/well), which will be left to polymerize at 37°C for 60 min.
  • HUVEC (2–3 ⁇ 10 4 cells) will be seeded into the cell culture plate in supernatant collected from iPSC cardiomyocyte cells that were transfected with singe gene, dual-gene, or triple-gene vectors encoding for S100A1 and VEGF connected by a linker described herein; S100A1, SDF1, and VEGF connected by a linker described herein; or VEGF alone.
  • 150 ⁇ l of the supernatant-HUVEC mixture will be added to each well on the solidified ECM gel.
  • the plates will be incubated at 37°C for 12–18 hr. and the endothelial tubes will be quantified using a fluorescent microscope after staining with Calcein AM.
  • Tube forming ability will be quantified by counting the total number of cell clusters (knots) and branches under a 4 ⁇ objective and four different fields per well. The results will be expressed as mean fold change of branching compared with the control groups. Each experiment will performed at least three times.
  • CI chemotactic index
  • Transfected Jurkat cells produce functional SDF1 protein that supports cellular migration
  • SDF-1 ⁇ was examined for functionality by demonstrating CXCR4-mediated migration of two cell types: Jurkat cells and peripheral blood lymphocytes (PBLs).
  • Jurkat cell migration cells in serum-free media were seeded onto the top of transwell inserts.
  • the lower chambers were filled with conditioned media from patients (dilated, hypertrophic) or healthy iPSC-derived cardiomyocytes transfected with pXoX or single effector controls.
  • the number of cells that migrated through the trans-well insert into the lower chamber containing the conditioned media after two hours was quantitated using a luminescence assay.
  • Jurkat cells were transfected with singe gene, double gene, and triple-gene gene constructs encoding for SDF1.
  • Jurkat control cells and Jurkat exposed to AMD3100 (CXCR4 antagonist) were measured for migration efficiency 2 hours after the drug was added.
  • FIG.8 and FIG.10 show experimental data.
  • a similar experiment performed on Jurkat cells cultured with supernatant from transfected human iPSC with double gene and triple-gene vectors encoding for SDF1 show similar results, FIG.11.
  • iPSC-CM Cardiomyocyte-iPSC cells
  • DCM dilated cardiomyopathy
  • HCM hypertrophy cardiomyopathy
  • iPSC cells were transfected with singe gene, dual-gene (double-gene), or triple-gene vectors encoding for S100A1 and VEGF connected by a linker described herein; S100A1, SDF1, and VEGF connected by a linker described herein; or VEGF alone.
  • 48 hours post transfection cellular supernatant was collected.
  • Jurkat cells were seeded on 6-well plates at a density of
  • FIG.12 shows experimental data in a dilated cardiomyopathy model.
  • FIG.13 shows experimental data in a hypertrophy cardiomyopathy model.
  • iPSC-CM transfected with singe gene, dual-gene, or triple-gene vector constructs showed 4-10-fold increase in HUVEC proliferation in both cases.
  • Example 6 ELISA
  • 293T cells were transfected via Fugene 6 (Promega) with Xogenex single-gene, dual- gene (double-gene), triple (triple-gene) gene constructs and the appropriate control constructs. Cell supernatant and lysate were harvested at desired time point(s).293T cells were transfected with vector constructs encoding for S100A, SDF1, VEGF191, or various combinations thereof connected by a linker described herein, utilizing vectors differing in the presence or absence of Kozak sequences, linkers (Furin-AP-F2A, GSG-P2A, Furin-APVKQGSG-P2A) (SEQ ID NO: 119), or none, as summarized in FIGS.15-17. Concentrations of protein produced were measured by ELISA.
  • FIG.15A and FIG.15 B show levels of SDF1 protein.
  • FIG.16A and FIG.16 B show levels of VEGF protein.
  • FIG.17A and FIG.17 B show levels of S100A1 protein.
  • Example 7 Triple-Gene Expression Constructs
  • a matrix (variety) of dual-gene (double-gene), triple-gene, and quadruple-gene (four- gene) constructs were designed as shown below in Table 5.
  • ELISA assays were performed to quantify expression of S100A1 from triple-gene pXoX constructs in comparison to single-gene pXoX controls and previously identified lead candidate, dual-gene constructs.
  • SV40 transformed cardiomyocytes were transfected with each of the test plasmid constructs and cell supernatants and lysates were harvested at desired time point(s).
  • the cardiomyocytes were transfected with vector constructs encoding for S100A, SDF1 ⁇ , VEGF191, or various combinations thereof connected by linker sequences described herein and indicated below in Table 7 as respective first, second, and third linker sequences (e.g., fp2a, fmdv, p2a, IRES, CMV, or no linking sequence). Concentrations of protein produced were measured by ELISA. See, FIG.18; sample numbers correspond to sample numbers shown in Table 7 below.
  • ELISA assays were performed to quantify expression of SDF1 ⁇ ⁇ from triple-gene pXoX constructs in comparison to single-gene pXoX controls and previously identified lead candidate, dual-gene constructs.
  • SV40 transformed cardiomyocytes were transfected with each of the test plasmid constructs and cell supernatants and lysates were harvested at desired time point(s).
  • the cardiomyocytes were transfected with vector constructs encoding for S100A, SDF1 ⁇ , VEGF191, or various combinations thereof connected by linker sequences described herein and indicated below in Table 8 as respective first, second, and third linker sequences (e.g., fp2a, fmdv, p2a, IRES, CMV, or no linking sequence). Concentrations of protein produced were measured by ELISA. See, FIG.19; sample numbers correspond to sample numbers shown in Table 8 below.
  • ELISA assays were performed to quantify expression of VEGF191 from triple-gene pXoX constructs in comparison to single-gene pXoX controls and previously identified lead candidate, dual-gene constructs.
  • SV40 transformed cardiomyocytes were transfected with each of the test plasmid constructs and cell supernatants and lysates were harvested at desired time point(s).
  • the cardiomyocytes were transfected with vector constructs encoding for S100A, SDF1 ⁇ , VEGF191, or various combinations thereof connected by linker sequences described herein and indicated below in Table 9 as respective first, second, and third linker sequences (e.g., fp2a, fmdv, p2a, IRES, CMV, or no linking sequence). Concentrations of protein produced were measured by ELISA. See, FIG.20; sample numbers correspond to sample numbers shown in Table 9 below.
  • S100A1 detection - Anti-S100A1 antibody (R&D Systems, Inc.) diluted 1:200, incubated with blot overnight at 4 degrees C; anti-sheep HRP (horse radish peroxidase) antibody (KPL Inc., Gaithersburg, MD, USA) diluted 1:20,000, incubated with blot at room temperature (RT) 30 minutes; signal detection via LUMIGLO® Ultra (KPL Inc.);
  • SDF-1 ⁇ detection - Anti-SDF-1 ⁇ antibody (R&D Systems, Inc.) diluted 1:2000, incubated with blot overnight at 4 degrees C; anti-goat HRP (Jackson ImmunoResearch Laboratories, Inc., West Grov, PA, USA) antibody diluted 1:20,000, incubated with blot at room temperature (RT) 30 minutes; signal detection via LUMIGLO® Ultra (KPL Inc.).
  • VEGF detection - Anti-VEGF antibody (Abcam, Plc., Cambridge, MA) diluted 1:2000, incubated with blot overnight at 4 degrees C; anti-rabbit HRP (Jackson ImmunoResearch Laboratories, Inc.) antibody diluted 1:20,000, incubated with blot at room temperature (RT) 30 minutes; signal detection via LUMIGLO® Ultra (KPL Inc.).
  • Example immunoblots are shown in FIGs.21, 22 and 23.
  • Table 10 Samples from cells expressing the various constructs are shown in lanes 1-9 (lane “L” showing a polypeptide molecular weight control ladder (220, 120, 100, 80, 60, 50, 40, 30, 20, 14, 6, and 3 kDa markers)).
  • Results indicate that each of the three GOIs are cleaved efficiently as expressed from triple-gene constructs.
  • Mass Spectometry Assay - Multi-gene expression products were evaluated by mass spectrometry.
  • Cleavage products of lead candidates were verified using mass spectrometry. Trypsin, chymotrypsin and elastase digestion was performed using standard procedures. Each gel digest was further analyzed by nano LC/MS/MS* with a Waters NanoAcquity HPLC system (Waters Corp., Milford, MA, USA) interfaced to a ThermoFisher Q Exactive HF (ThermoFisher Scientific, Waltham, MA, USA). Data was processed using Mascot database. Mascot DAT files were parsed into the Scaffold software for validation, filtering and to create a nonredundant list per sample.
  • MS/MS indicates liquid chromatography (LC) with mass spectrometry (MS).
  • MS/MS is a combination of two mass analyzers in one mass spectrometry instrument. The first MS filters for precursor ions followed by a fragmentation of the precursor ion with high energy and, for example, nitrogen gas. A second mass analyzer then filters for product ions generated by the fragmentation. Advantage of MS/MS is increased sensitivity.
  • MS Mass spectrometry
  • Non-denaturing PolyAcrylamide Gel Electrophoresis was performed to assess dimer formation of S100A1 polypeptides expressed from dual-gene and triple gene constructs.
  • Conditioned media of transfected 293T cells was analyzed by native-PAGE/immunoblot for monomeric and dimeric levels of S100A1.
  • Results demonstrate that the S100A1 cleaved from lead dual and lead triple candidates is predominantly in a dimeric form, whereas S100A1 expressed by the single effector construct pS100A1 and by triple-gene constructs having a CMV linker C-terminal to S100A1 is predominantly monomeric; see, FIG.24.
  • a unique aspect of the present invention is provided and enabled by the specific sequential order of polypeptides encoded by constructs of the invention.
  • specifically placing S100A1 protein first achieves and allows functional expression of biologically active S100A1 molecules because the remaining 2A tail on S100A1 was, surprisingly, discovered not to interfere with S100A1 biological activity.
  • placing S100A1 as the second gene resulted in incomplete cleavage of genes expressed via the construct.
  • the C-terminal linker tail on S100A1 as expressed from pXoX comprises the sequence (from N- to C-terminus) S101A1 polypeptide fused to-RAKRAPVKQGSGATNFSLLKQAGDVEENPG (SEQ ID NO: 123); which may be referred to herein as the "2A tail”.
  • a first GOI of the invention comprises the sequence: MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDK VMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENSRAKRAPVKQGSGATNFSLLK QAGDVEENPG (SEQ ID NO: 124).
  • 293T cells were plated at 750,000 cells per well in a 6 well plate and incubated overnight at plates to 37°C/5% CO 2 incubator overnight. The following day, the cells were transfected using FuGENE 6 (Promega) with single (singe-gene), dual (double-gene), triple (triple-gene), Table 14, gene constructs and the appropriate control constructs using plasmid vector at 100 ng/ml diluted in OptiMEM media (LifeTechnologies). After transfection, the cells were incubated. Cell supernatant and lysate were harvested at desired at 72 hours.
  • effectors from pXoX are expressed as single multigene mRNA, the relative expression of each effector is fixed. To determine the relative expression levels of each effector of pXoX, several relevant cell lines were transfected, and protein expression assessed by ELISA. Cells were transfected with plasmids for each individual effector (pS100A1, pSDF-1 ⁇ or pVEGF165) or all three effectors (pXoX). [0282] Accordingly, as shown in Table 16, a variety of cells transfected with pXoX triple-gene vector encoding S100A1, SDF-1 ⁇ , and VEGF165, produced measurable levels of protein as detected via ELISA assays. Cell types tested included 293T cells, SV40 transformed
  • Cardiomyocytes iPSC-CMs (Cardiomyocytes) from healthy individual, iPSC-CMs from dilated cardiomyopathy patient, and iPSC-CMs from hypertrophy cardiomyopathy patient.
  • iPSC-CMs Cardiomyocytes
  • iPSC-CMs from healthy individual
  • iPSC-CMs from dilated cardiomyopathy patient
  • iPSC-CMs from hypertrophy cardiomyopathy patient.
  • SV40 Immortalized Cardiomyocytes were transfected via DNAfectin Plus (ABM) with Xogenex single-gene, dual-gene (double-gene), triple-gene constructs wherein at least two genes are connected by a linker described herein, and the appropriate control constructs.
  • a 6 well plate was coated with extracellular matrix (ABM) overnight.24 hours later, cardiomyocytes were seeded on the 6 well plate at 225,000 cells/well into each ECM-coated well. The cells were incubated overnight at 37°C/5% CO2. 72 hours later, media was collected from the cells into a 2 mL deep well block and stored for ELISA for detected and quantification of protein production.
  • iPSC Cardiomyocytes were transfected via DNAfectin Plus (ABM) with Xogenex single-gene, dual-gene (double-gene), triple-gene constructs wherein at least two genes are connected by a linker described herein, and the appropriate control constructs.
  • a 6 well plate was
  • iPSC Cardiomyocytes were transfected via GeneJammer transfection reagent (Agilent) with Xogenex single-gene, dual-gene (double-gene), triple-gene constructs and the appropriate control constructs.
  • a 12 well plate was coated with Fibronectin (ThermoScientific) and incubated at 37°C/5% CO 2 for 1 hour.
  • DNase was reconstituted in UltraPure water to a final concentration of 10 mg/mL Cardiomyocytes were trypsinzed using TrypLE and 1X DNase I and incubated for 5 minutes at 37°C or until cells detached from the flask.
  • iPSC cells were seeded at 4e5 cells/well into each Fibronectin-coated well of the 12 well plates. Plated cells were incubated at 37°C/5% CO 2 incubator for 24 hours. The following day, the cardiomyocytes were transfected using plasmid DNA at 2 ⁇ g (pXoX and controls).
  • S100A1, SDF-1 ⁇ , and VEGF165 proteins were detected in cellular lysates of transfected 293T cells, SV40 CMs and iPSC CMs, FIG.21.
  • Example 10 Beating rate and contractile duration
  • Isoproterenol ISO, 100 nM was measured based on contraction properties that were recorded within 30-minutes of incubation. Three contraction parameters were evaluated during the study: beat rate, contraction rate (velocity), and contraction duration.
  • the beating rate and contractile duration indicate that the presence of a 2A tail at the 3’ end of a vector encoding for S100A1 does not affect the function of S100A1, FIG.18A and FIG.18 B.
  • the beating rate and contractile duration shown, FIG.19A, FIG.19B, and FIG.19C show the restoration of DCM contractile properties to healthy control levels by the protein produced from transfected iPSC-CM cells.
  • pStuffer is a plasmid with the same backbone configuration as pXoX, with the open reading frame (ORF) replaced with a non-expressing, similar-sized stuffer sequence.
  • pS100A1 and pS100A1-SDF-1 ⁇ displayed comparable functional output (increased beating rate, improved contractile duration), suggesting that presence of 2A tail at 3’ end of S100A1 in pS100A1-SDF-1 ⁇ and pXoX does not affect S100A1 function.
  • FIG.28 shows data for expression of VEGF in a recombinase titration experiments in which ELISA analysis was performed to detect the persistence of expression of VEGF when transfected into SV40 transformed cardiomyocytes with varying ratios of the pXoX triple-gene expression vector to recombinase.
  • ELISA analysis was performed to detect the persistence of expression of VEGF when transfected into SV40 transformed cardiomyocytes with varying ratios of the pXoX triple-gene expression vector to recombinase.
  • FIG.29 shows data for expression of SDF-1 ⁇ in a recombinase titration experiments in which ELISA analysis was performed to detect the persistence of expression of SDF-1 ⁇ when transfected into SV40 transformed cardiomyocytes with varying ratios of the pXoX triple-gene expression vector to recombinase.
  • ELISA analysis was performed to detect the persistence of expression of SDF-1 ⁇ when transfected into SV40 transformed cardiomyocytes with varying ratios of the pXoX triple-gene expression vector to recombinase.
  • FIG.30 shows data for expression of S100A1 in cardiomyocytes transfected with and without recombinase.
  • S100A1 in cardiomyocytes transfected with and without recombinase.
  • the SPBc2 groups On Days 10, 17, and 24 post-transfection, the SPBc2 groups showed significantly more S100A1 secretion than the control (Stuffer) groups.
  • Example 12 Plasmid Backbone Expression Study in Rats
  • pXoX has a standard plasmid backbone with a kanamycin resistance gene. Additionally, expression of the effector proteins is driven by the hybrid CAG promoter and utilizes a synthetic 3’UTR/polyA tail as described in Table 15. To verify the ability of this backbone configuration to maintain gene expression in the heart over time, the effector ORF in pXoX was replaced with a luciferase (fLuc) reporter gene (pCAG-fLuc) and was evaluated by live animal imaging for duration of luciferase expression after plasmid injection into the heart. A similar plasmid with the CMV promoter and a non-expressing stuffer sequence (pCMV-stuffer) was used as a control for plasmid size and background fLuc expression.
  • fLuc luciferase reporter gene
  • Example 13 Delivery Method - Retrograde Infusion via the Coronary Sinus in Pigs
  • Retrograde infusion via the coronary sinus is the proposed method of delivery for non- viral plasmid constructs (such as, but not limited to, pXoX) to the heart.
  • non- viral plasmid constructs such as, but not limited to, pXoX
  • the technical complexity of this delivery method precludes its assessment in small animal models such as mice and rats. As such, pigs are proposed for use in pharmacology and
  • Example 14 In Vivo Cardiomyocytes regeneration by pXoX in adriamycin-induced cardiomyopathy using ultrasound targeted microbubble destruction (UTMD) method
  • Adriamycin induced cardiomyopathy in rats is a well established model for congestive heart failure (CHF).
  • Ultrasound targeted microbubble destruction (UTMD) method was used to deliver pXoX (which expresses biologically active SDF1 ⁇ , S100A1, and VEGF) to rat hearts in adriamycin-induced cardiomyopathy.
  • pXoX which expresses biologically active SDF1 ⁇ , S100A1, and VEGF
  • a total of 16 rats with established adriamycin-induced cardiomyopathy were divided into 2 groups of eight. Each group was treated with one of the 2 plasmids: (1) pStuffer, or (2) pXoX.
  • Plasmid-containing lipid-stabilized microbubbles were prepared in a solution of 1,2-dipalmitoylsn-glycero-3-phosphatidylcholine 2.5 mg/ml,1,2- dipalmitoyl-sn-glycero-3-phosphatidylethanolamine 0.5 mg/ml, and 10% glycerol mixed with 2mg of plasmid dissolved in 50ml of lipofectamine 3000 (Invitrogen, Carlsbad,CA).
  • Results of echocardiographic measurement of cardiac structure and function demonstrate that UTMD-pXoX gene therapy restores fractional shortening index, LV posterior wall diameter, and IVSd, FIG.31A, FIG.31B, and FIG.31C. Values are presented as mean ⁇ SEM. **P ⁇ 0.001 vs pStuffer. Results show that echocardiographic measurement demonstrated reversal of established ADM cardiomyopathy after a single UTMD-pXoX treatment, thereby indicating successful in vivo treatment of cardiomyopathy in a congestive heart failure model by administration of the (triple-gene with linkers) pXoX construct which expresses biologically active SDF1 ⁇ , S100A1, and VEGF.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • Medicinal Chemistry (AREA)
  • Organic Chemistry (AREA)
  • Zoology (AREA)
  • Molecular Biology (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Epidemiology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • Toxicology (AREA)
  • Immunology (AREA)
  • Wood Science & Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Vascular Medicine (AREA)
  • Physics & Mathematics (AREA)
  • Microbiology (AREA)
  • Plant Pathology (AREA)
  • Cardiology (AREA)
  • Marine Sciences & Fisheries (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Peptides Or Proteins (AREA)
  • Enzymes And Modification Thereof (AREA)
PCT/US2016/061668 2015-11-11 2016-11-11 Compositions and methods for expression of multiple biologically active polypeptides from a single vector for treatment of cardiac conditions and other pathologies Ceased WO2017083750A1 (en)

Priority Applications (14)

Application Number Priority Date Filing Date Title
RU2018117674A RU2758489C2 (ru) 2015-11-11 2016-11-11 Композиции и способы для экспрессии нескольких биологически активных полипептидов с одного вектора для лечения заболеваний сердца и других патологий
CN201680078586.0A CN108713025A (zh) 2015-11-11 2016-11-11 用于治疗心脏病况和其他病理的从单个载体表达多种生物活性多肽的组合物和方法
BR112018009645A BR112018009645A2 (pt) 2015-11-11 2016-11-11 composições e métodos para a expressão de vários polipeptídeos biologicamente ativos a partir de um único vetor para tratamento de condições cardíacas e outras patologias
MX2018005886A MX2018005886A (es) 2015-11-11 2016-11-11 Composiciones y metodos para la expresion de polipeptidos biologicamente activos a partir de un vector unico para tratamiento de condiciones cardiacas y otras patologias.
JP2018524443A JP6976244B2 (ja) 2015-11-11 2016-11-11 心臓状態および他の病態の処置のための複数の生物学的に活性なポリペプチドを単一のベクターから発現させるための組成物および方法
CA3004742A CA3004742A1 (en) 2015-11-11 2016-11-11 Compositions and methods for expression of multiple biologically active polypeptides from a single vector for treatment of cardiac conditions and other pathologies
AU2016353342A AU2016353342B2 (en) 2015-11-11 2016-11-11 Compositions and methods for expression of multiple biologically active polypeptides from a single vector for treatment of cardiac conditions and other pathologies
HK19101096.0A HK1259137A1 (zh) 2015-11-11 2016-11-11 用於治療心臟病況和其他病例的從單個載體表達多種生物活性多肽的組合物和方法
EP16810130.1A EP3387010A1 (en) 2015-11-11 2016-11-11 Compositions and methods for expression of multiple biologically active polypeptides from a single vector for treatment of cardiac conditions and other pathologies
SG11201803934YA SG11201803934YA (en) 2015-11-11 2016-11-11 Compositions and methods for expression of multiple biologically active polypeptides from a single vector for treatment of cardiac conditions and other pathologies
KR1020187016185A KR20180069081A (ko) 2015-11-11 2016-11-11 심장 이상 및 기타 병리 이상의 치료를 위한 복수의 생물학적으로 활성화된 폴리펩티드를 단일 벡터로부터 발현하기 위한 조성물 및 방법
US15/978,036 US11154622B2 (en) 2015-11-11 2018-05-11 Compositions and methods for expression of multiple biologically active polypeptides from a single vector for treatment of cardiac conditions and other pathologies
US17/481,938 US20220072159A1 (en) 2015-11-11 2021-09-22 Compositions and methods for expression of multiple biologically active polypeptides from a single vector for treatment of cardiac conditions and other pathologies
US18/485,838 US20240148908A1 (en) 2015-11-11 2023-10-12 Compositions and methods for expression of multiple biologically active polypeptides from a single vector for treatment of cardiac conditions and other pathologies

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201562254139P 2015-11-11 2015-11-11
US62/254,139 2015-11-11

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US15/978,036 Continuation US11154622B2 (en) 2015-11-11 2018-05-11 Compositions and methods for expression of multiple biologically active polypeptides from a single vector for treatment of cardiac conditions and other pathologies

Publications (1)

Publication Number Publication Date
WO2017083750A1 true WO2017083750A1 (en) 2017-05-18

Family

ID=57543150

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2016/061668 Ceased WO2017083750A1 (en) 2015-11-11 2016-11-11 Compositions and methods for expression of multiple biologically active polypeptides from a single vector for treatment of cardiac conditions and other pathologies

Country Status (14)

Country Link
US (3) US11154622B2 (https=)
EP (1) EP3387010A1 (https=)
JP (1) JP6976244B2 (https=)
KR (1) KR20180069081A (https=)
CN (1) CN108713025A (https=)
AU (1) AU2016353342B2 (https=)
BR (1) BR112018009645A2 (https=)
CA (1) CA3004742A1 (https=)
HK (1) HK1259137A1 (https=)
MA (1) MA43404A (https=)
MX (1) MX2018005886A (https=)
RU (1) RU2758489C2 (https=)
SG (1) SG11201803934YA (https=)
WO (1) WO2017083750A1 (https=)

Cited By (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2019218091A1 (en) * 2018-05-18 2019-11-21 UNIVERSITé LAVAL Vectors for dna vaccination
WO2019227106A1 (en) * 2018-05-25 2019-11-28 The Wistar Institute Tumor-specific neoantigens and methods of using the same
CN111465697A (zh) * 2017-09-29 2020-07-28 贝特基因 用于预防或治疗心力衰竭的药物组合物
WO2020232527A1 (en) * 2019-05-21 2020-11-26 UNIVERSITé LAVAL Crimean-congo hemorrhagic fever virus immunogenic compositions
WO2021053222A1 (en) * 2019-09-20 2021-03-25 Ucl Business Ltd Gene therapy composition and treatment of right ventricular arrythmogenic cardiomyopathy
US11608362B2 (en) 2018-03-06 2023-03-21 Precigen, Inc. Hepatitis B vaccines and uses of the same
US11692194B2 (en) 2017-01-10 2023-07-04 Precigen, Inc. Modulating expression of polypeptides via new gene switch expression systems
WO2023232984A1 (en) * 2022-06-02 2023-12-07 Patrick Most S100a1 protein for use in treating and preventing infarct extension
US11883506B2 (en) 2020-08-07 2024-01-30 Spacecraft Seven, Llc Plakophilin-2 (PKP2) gene therapy using AAV vector
US12404306B2 (en) 2018-03-06 2025-09-02 Precigen, Inc. Human papillomavirus vaccines and uses of the same
US12552838B2 (en) 2020-04-20 2026-02-17 Tenaya Therapeutics, Inc. Adeno-associated virus with engineered capsid

Families Citing this family (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA3021572A1 (en) 2016-04-20 2017-10-26 Centro De Investigaciones Energeticas, Medioambientales Y Tecnologicas Compositions and methods for enhanced gene expression of pklr
EP3697452A4 (en) 2017-10-16 2021-11-24 Centro de Investigaciones Energéticas, Medioambientales y Tecnológicas, O.A., M.P. LENTIVIRAL VECTORS FOR ADMINISTRATION OF PKLR TO TREAT PYRUVATE KINASE DEFECTS
BR112020020841A2 (pt) 2018-04-11 2021-01-19 Fundacion Para La Investigacion Biomedica Del Hospital Infantil Universitario Nino Jesus Composições e métodos para transplante de célulastronco
CA3096293A1 (en) 2018-04-27 2019-10-31 Rocket Pharmaceuticals, Ltd. Gene therapy for cns degeneration
AU2019354391A1 (en) 2018-10-01 2021-05-06 Adicet Therapeutics, Inc. Compositions and methods regarding engineered and non- engineered γδ-Τ cells for treatment of hematological tumors
CN113272016A (zh) 2018-10-01 2021-08-17 阿迪塞特生物股份有限公司 关于治疗实体肿瘤的工程化和非工程化γδ-T细胞的组合物和方法
IL286675B2 (en) * 2019-03-29 2026-02-01 Abiomed Inc Systems and methods for left ventricular unloading in biological therapy or vector gene therapy
CN114450411A (zh) 2019-04-01 2022-05-06 特纳亚治疗股份有限公司 具有工程化衣壳的腺相关病毒
JP7717677B2 (ja) * 2019-08-07 2025-08-04 ノースウェスタン ユニバーシティ 心臓内遺伝子送達のための材料及び方法
IL301675A (en) 2020-10-09 2023-05-01 Tenaya Therapeutics Inc Methods and preparations for placophilin-2 gene therapy
US11781156B2 (en) * 2020-10-09 2023-10-10 Tenaya Therapeutics, Inc. Plakophillin-2 gene therapy methods and compositions
AU2022325237A1 (en) * 2021-08-12 2024-03-21 Renovacor, Inc. Retrograde coronary venous or sinus administration of therapeutics

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2002083851A2 (en) * 2001-04-10 2002-10-24 Genvec, Inc. Vegf fusion proteins
WO2014089121A2 (en) * 2012-12-03 2014-06-12 Thomas Ichim Retrograde delivery of cells and nucleic acids for treatment of cardiovascular diseases

Family Cites Families (36)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4985461A (en) 1985-10-21 1991-01-15 Rohm And Haas Company Insecticidal N'-substituted-N,N'-diacylhydrazines
US5117057A (en) 1985-10-21 1992-05-26 Rohm And Haas Company Insecticidal N' substituted-N-N'-disubstituted-hydrazines
US5225443A (en) 1986-05-01 1993-07-06 Rohm And Haas Company Insecticidal N'-substituted-N'-substituted N,N'-diacylhydrazines
US5542935A (en) * 1989-12-22 1996-08-06 Imarx Pharmaceutical Corp. Therapeutic delivery systems related applications
IL100643A (en) 1991-01-25 1996-10-31 Nippon Kayaku Kk History of hydrazine and pesticides containing these histories as an active ingredient
US5530028A (en) 1992-11-23 1996-06-25 Rohm And Haas Company Insecticidal N'-substituted-N,N'-diacylhydrazines
US6013836A (en) 1992-02-28 2000-01-11 Rohm And Haas Company Insecticidal N'-substituted-N,N'-disubstitutedhydrazines
JP5031967B2 (ja) 2000-03-22 2012-09-26 イントレキソン コーポレーション 新規エクジソン受容体ベースの誘導性遺伝子発現系
US20040033600A1 (en) 2001-03-21 2004-02-19 Palli Subba Reddy Ecdysone receptor-based inducible gene expression system
US8105825B2 (en) 2000-10-03 2012-01-31 Intrexon Corporation Multiple inducible gene regulation system
ES2424812T3 (es) 2001-02-20 2013-10-08 Intrexon Corporation Receptores X retinoides quiméricos y su uso en un sistema inducible de expresión génica basado en receptores de ecdisona novedoso
CA2438133C (en) 2001-02-20 2015-01-27 Rheogene, Inc. Novel substitution mutant receptors and their use in a nuclear receptor-based inducible gene expression system
EP1373470B1 (en) 2001-02-20 2013-04-24 Intrexon Corporation Novel substitution mutant receptors and their use in a nuclear receptor-based inducible gene expression system
WO2002066613A2 (en) 2001-02-20 2002-08-29 Rheogene Holdings, Inc Novel ecdysone receptor/invertebrate retinoid x receptor-based inducible gene expression system
WO2003027289A1 (en) 2001-09-26 2003-04-03 Rheo Gene Holdings, Inc. Leafhopper ecdysone receptor nucleic acids, polypeptides, and uses thereof
CA2459807C (en) 2001-09-26 2013-09-03 Jianzhong Zhang Whitefly ecdysone receptor nucleic acids, polypeptides, and uses thereof
US7375093B2 (en) 2002-07-05 2008-05-20 Intrexon Corporation Ketone ligands for modulating the expression of exogenous genes via an ecdysone receptor complex
US7304161B2 (en) 2003-02-10 2007-12-04 Intrexon Corporation Diaclhydrazine ligands for modulating the expression of exogenous genes in mammalian systems via an ecdysone receptor complex
US7304162B2 (en) 2003-02-21 2007-12-04 Intrexon Corporation Oxadiazoline ligands for modulating the expression of exogenous genes via an ecdysone receptor complex
US7456315B2 (en) 2003-02-28 2008-11-25 Intrexon Corporation Bioavailable diacylhydrazine ligands for modulating the expression of exogenous genes via an ecdysone receptor complex
US7935510B2 (en) 2004-04-30 2011-05-03 Intrexon Corporation Mutant receptors and their use in a nuclear receptor-based inducible gene expression system
US9034650B2 (en) 2005-02-02 2015-05-19 Intrexon Corporation Site-specific serine recombinases and methods of their use
PL2043662T3 (pl) 2006-07-26 2016-03-31 Intrexon Corp Sposoby i kompozycje do leczenia choroby
US7719424B2 (en) 2007-01-19 2010-05-18 Igt Table monitoring identification system, wager tagging and felt coordinate mapping
CN104761466A (zh) 2007-05-29 2015-07-08 英特拉克森公司 通过蜕皮素受体复合物调节外源性基因表达的手性二酰基肼配体
KR101666228B1 (ko) * 2007-09-28 2016-10-13 인트렉손 코포레이션 생물치료학적 분자를 발현시키기 위한 치료학적 유전자-스위치 작제물 및 생물반응기, 및 이의 용도
HUE035406T2 (en) 2007-10-08 2018-05-02 Intrexon Corp Engineered dendritic cells and uses for the treatment of cancer
WO2009114702A2 (en) * 2008-03-14 2009-09-17 Humanzyme Limited Recombinant production of authentic human proteins using human cell expression systems
CN102575227A (zh) 2008-10-08 2012-07-11 英特瑞克斯顿股份有限公司 表达多种免疫调节剂的工程改造细胞及其应用
CA2772610C (en) 2009-08-28 2018-01-23 The Cleveland Clinic Foundation Sdf-1 delivery for treating ischemic tissue
CA2794196A1 (en) 2010-03-23 2011-09-29 Intrexon Corporation Vectors conditionally expressing therapeutic proteins, host cells comprising the vectors, and uses thereof
SG10201600912SA (en) 2011-03-04 2016-03-30 Intrexon Corp Vectors conditionally expressing protein
AU2012394394A1 (en) * 2012-11-16 2015-06-04 United Biomedical, Inc. Synthetic peptide-based emergency vaccine against foot and mouth disease (FMD)
CN105377268A (zh) 2013-03-15 2016-03-02 克利夫兰临床医学基金会 用于治疗心肌梗塞的sdf-1的逆行递送
WO2016187585A1 (en) 2015-05-20 2016-11-24 Viventia Bio Inc. Deimmunized linker and methods of use
CN105754990A (zh) * 2016-01-29 2016-07-13 深圳精准医疗科技有限公司 一种pd-1/ctla-4双特异性抗体的制备方法及其应用

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2002083851A2 (en) * 2001-04-10 2002-10-24 Genvec, Inc. Vegf fusion proteins
WO2014089121A2 (en) * 2012-12-03 2014-06-12 Thomas Ichim Retrograde delivery of cells and nucleic acids for treatment of cardiovascular diseases

Non-Patent Citations (84)

* Cited by examiner, † Cited by third party
Title
A. N. PATEL; S. MITTAL; G. TURAN; A. A. WINTERS; T. D. HENRY; H. INCE; N. TREHAN: "REVIVE Trial: Retrograde Delivery of Autologous Bone Marrow in Patients With Heart Failure", STEM CELLS TRANSL MED, vol. 4, 2015, pages 1021 - 1027
A. REMPPIS; T. GRETEN; B. SCHAFER; P. HUNZIKER: "Altered expression of the Ca 2+-binding protein S 100A1 in human cardiomyopathy", BIOCHIM BIOPHYS ACTA, vol. 1313, no. 3, 1996, pages 253 - 257, XP000953069, DOI: doi:10.1016/0167-4889(96)00097-3
AMALIA A. WINTERS ET AL: "Evaluation of Multiple Biological Therapies for Ischemic Cardiac Disease", CELL TRANSPLANTATION, vol. 25, no. 9, 2 September 2016 (2016-09-02), US, pages 1591 - 1607, XP055334465, ISSN: 0963-6897, DOI: 10.3727/096368916X691501 *
B. RUSTER; S. GOTTIG; R. J. LUDWIG; R. BISTRIAN; S. MULLER; E. SEIFRIED; J. GILLE; R. HENSCHLER: "Mesenchymal stem cells display coordinated rolling and adhesion behavior on endothelial cells", BLOOD, vol. 108, no. 12, 2006, pages 3938 - 3944, XP008131786, DOI: doi:10.1182/blood-2006-05-025098
BRINKS H; D. ROHDE; M. VOELKERS; G. QIU; S. PLEGER: "S100A1 genetically targeted therapy reverses dysfunction of human failing cardiomyocytes", J AM COLL CARDIOL, vol. 58, no. 9, 2011, pages 966 - 973, XP028266058, DOI: doi:10.1016/j.jacc.2011.03.054
C. HART; D. DREWEL; G. MUELLER; J. GRASSINGER; M. ZAISS; L. A. KUNZ-SCHUGHART; R. ANDREESEN; A. REICHLE; E. HOLLER; B. HENNEMANN: "Expression and function of homing-essential molecules and enhanced in vivo homing ability of human peripheral blood-derived hematopoietic progenitor cells after stimulation with stem cell factor", STEM CELLS, vol. 22, no. 4, 2004, pages 580 - 589
C. RAMPON; N. WEISS; C. DEBOUX; N. CHAVEROT; F. MILLER; D. BUCHET; H. TRICOIRE-LEIGNEL; S. CAZAUBON; B.-V. EVERCOOREN; P.-0. COURA: "Molecular mechanism of systemic delivery of neural precursor cells to the brain: assembly of brain endothelial apical cups and control of transmigration by CD44", STEM CELLS, vol. 26, no. 7, 2008, pages 1673 - 1682
C. THOMPSON; B. A. NASSERI; J. MAKOWER; S. HOUSER; M. MCGARRY; T. LAMSON; I. POMERANTSEVA; J. Y. CHANG; H. K. GOLD; J. P. VACANTI: "Percutaneous transvenous cellular cardiomyoplasty: A novel nonsurgical approach for myocardial cell transplantation", J AM COLL CARDIOL, vol. 41, no. 11, 2003, pages 1964 - 1971
C. WEBER; I. NEACSU; B. KRAUTZ; P. SCHLEGEL; S. SAUER; P. RAAKE; J. RITTERHOFF; A. JUNGMANN; A. B. REMPPIS; M. STANGASSINGER: "Therapeutic safety of high myocardial expression levels of the molecular inotrope S100A1 in a preclinical heart failure model", GENE THER, vol. 21, 2014, pages 131 - 138
C.R. MAYER ET AL: "Ultrasound targeted microbubble destruction for drug and gene delivery", EXPERT OPIN DRUG DELIV., vol. 5, no. 10, 2008, pages 1121 - 1138, XP008121905, DOI: doi:10.1517/17425247.5.10.1121
CHINESE JOURNAL OF BIOLOGICALS, vol. 24, no. 5, May 2011 (2011-05-01), pages 566 - 570, ISSN: 1004-5503 *
CHUNG ET AL., EUR HEART J, vol. 36, 2015, pages 2228 - 2238
D. B. ZIMMER; P. WRIGHT SADOSKY; D. J. WEBER: "Molecular mechanisms of S100-target protein interactions", MICROSC RES TECH, vol. 60, no. 6, 2003, pages 552 - 559
D. ROHDE; H. BRINKS; J. RITTERHOFF; G. QUI; S. REN; P. MOST: "S100A1 gene therapy for heart failure: a novel strategy on the verge of clinical trials", J MOL CELL CARDIOL, vol. 50, no. 5, 2011, pages 777 - 784, XP028189049, DOI: doi:10.1016/j.yjmcc.2010.08.012
D. ROHDE; J. RITTERHOFF; M. VOELKERS; H. KATUS; T. G. PARKER; P. MOST: "S100A1: a multifaceted therapeutic target in cardiovascular disease", J CARDIOVASC TRANSL RES, vol. 3, no. 5, 2010, pages 525 - 537, XP055018358, DOI: doi:10.1007/s12265-010-9211-9
D. ROHDE; W. SCHLIITER-WIGGER; V. MIELKE; P. VON DEN DRIESCH; B. VON GAUDECKER; W. STERRY: "Infiltration of both T cells and neutrophils in the skin is accompanied by the expression of endothelial leukocyte adhesion molecule-1 (ELAM-1): an immunohistochemical and ultrastructural study", J INVEST DERMATOL, vol. 98, no. 5, 1992, pages 794 - 799
DATABASE BIOSIS [online] BIOSCIENCES INFORMATION SERVICE, PHILADELPHIA, PA, US; May 2011 (2011-05-01), JIANG PAN ET AL: "Cloning and Prokaryotic Expression of VEGF-SLC Fusion Gene", XP002766362, Database accession no. PREV201100484946 *
DAVID I.R. ET AL: "The Vascular Endothelial Growth Factor (VEGF) Family: Angiogenic Factors in Health and Disease", GENOME BIOL, vol. 6, no. 2, 2005, pages 209, XP009067450
DAVID ROHDE ET AL: "S100A1 gene therapy for heart failure: A novel strategy on the verge of clinical trials", JOURNAL OF MOLECULAR AND CELLULAR CARDIOLOGY, ACADEMIC PRESS, GB, vol. 50, no. 5, 13 August 2010 (2010-08-13), pages 777 - 784, XP028189049, ISSN: 0022-2828, [retrieved on 20100820], DOI: 10.1016/J.YJMCC.2010.08.012 *
E. BACHRACH; A. L. PEREZ; Y. H. CHOI; B. M. ILLIGENS; S. J. JUN; P. D. NIDO; F. X. MCGOWAN; S. LI; A. FLINT; J. CHAMBERLAIN: "Muscle engraftment of myogenic progenitor cells following intraarterial transplantation", MUSCLE NERVE, vol. 34, no. 1, pages 44 - 52
E. PERIN; G. V. SILVA; J. A. ASSAD; D. VELA; L. M. BUJA; A. L. SOUSA; S. LITOVSKY; J. LIN; W. K. VAUGHN; S. COULTER: "Comparison of intracoronary and transendocardial delivery of allogeneic mesenchymal cells in a canine model of acute myocardial infarction", J MOL CELL CARDIOL, vol. 44, no. 3, 2008, pages 486 - 95, XP022524894, DOI: doi:10.1016/j.yjmcc.2007.09.012
E. S. CHUNG; L. MILLER; A. N. PATEL; R. D. ANDERSON; F. O. MENDELSOHN; J. TRAVERSE; K. H. SILVER; J. SHIN; G. EWALD; M. J. FARR: "Changes in ventricular remodelling and clinical status during the year following a single administration of stromal cell-derived factor-1 non-viral gene therapy in chronic ischaemic heart failure patients: the STOP-HF randomized Phase II trial", EUR HEART J, vol. 36, 2015, pages 2228 - 2238
E. YOUSSEF; P. ZHANG; P. I. ROGERS; P. TREMBLE; J. ROKOVICH; B. H. JOHNSTONE; K. L. MARCH; D. HOU: "Enhancing myocardial plasmid expression by retrograde coronary venous delivery", CATH CARDIOVASC INTERVENT, vol. 65, no. 4, 2005, pages 528 - 534
F. J. GIORDANO: "Retrograde coronary perfusion: a superior route to deliver therapeutics to the heart?", J AM COLL CARDIOL, vol. 42, no. 6, 2003, pages 1129 - 1131
G. VON DEGENFELD; P. RAAKE; C. KUPATT; C. LEBERHZ; R. HINKEL; F. J. GILDEHAUS; W. MIINZING; A. KRANZ; J. WALTENBERGER; M. SIMOES: "Selective pressure- regulated retroinfusion of fibroblast growth factor-2 into the coronary vein enhances regional myocardial blood flow and function in pigs with chronic myocardial ischemia", J AM COLL CARDIOL, vol. 42, no. 6, 2003, pages 1120 - 1128
H. HABAZETTL; C. KUPATT; S. ZAHLER; B. F. BECKER; K. MESSMER: "Selectins and beta 2-integrins mediate post-ischaemic venular adhesion of polymorphonuclear leukocytes, but not capillary plugging, in isolated hearts", PFLUGERS ARCH, vol. 438, no. 4, 1999, pages 479 - 485
I. MARENHOLZ ET AL: "SIOO proteins in mouse and man: from evolution to function and pathology (including an update of the nomenclature", BIOCHEM BIOPHYS RES COMMUN., vol. 322, no. 4, 2004, pages 1111 - 1122, XP004536595, DOI: doi:10.1016/j.bbrc.2004.07.096
J. A. WOLFRAM ET AL: "Gene Therapy to Treat Cardiovascular Disease", JOURNAL OF THE AMERICAN HEART ASSOCIATION, vol. 2, no. 4, 20 August 2013 (2013-08-20), pages e000119 - e000119, XP055334487, DOI: 10.1161/JAHA.113.000119 *
J. GEORGE; J. GOLDBERG; M. JOSEPH; N. ABDULHAMEED; J. CRIST; H. DAS; V. J. POMPILI: "Transvenous intramyocardial cellular delivery increases retention in comparison to intracoronary delivery in a porcine model of acute myocardial infarction", J INTERV CARDIOL, vol. 21, no. 5, 2008, pages 424 - 431
J. J. LOPEZ ET AL: "VEGF administration in chronic myocardial ischemia in pigs", CARDIOVASC RES, 1998, pages 272 - 281
J. JAMES; Y. ZHANG; K. WRIGHT; S. WITT; E. GLASCOCK: "Transgenic rabbits expressing mutant essential light chain do not develop hypertrophic cardiomyopathy", J MOL CELL CARDIOL, vol. 34, no. 7, 2002, pages 872 - 882
J. L. HELLAWELL; K. B. MARGUILES: "Myocardial reverse remodeling", CARDIOVASC THER, vol. 30, no. 3, 2012, pages 172 - 181
J. LESLEY; I. GAL; D. J. MAHONEY; M. R. CORDELL; M. S. RUGG; R. HYMAN; A. J. DAY; K. MIKECZ: "TSG-6 modulates the interaction between hyaluronan and cell surface CD44", J BIOL CHEM, vol. 279, no. 24, 2004, pages 25745 - 25754
J. TUMA; R. FERNANDEZ-VINA; A. CARRASCO; J. CASTILLO; C. CRUZ; A. CARRILLO; J. ERCILLA; C. YARLEQUE; J. CUNZA; T. D. HENRY: "Safety and feasibility of percutaneous retrograde coronary sinus delivery of autologous bone marrow mononuclear cell transplantation in patients with chronic refractory angina", J TRANSL MED, vol. 9, 2011, pages 183, XP021113607, DOI: doi:10.1186/1479-5876-9-183
J. WODA; S. J. FISHER; J. PASTORE; A. N. PATEL: "Coronary Sinus Delivery of SDF-1 Plasmid for the Treatment of Heart Failure", AMERICAN SOCIETY OF GENE AND CELL THERAPY, 2014
J. X. YU; X. F. HUANG; W. M. LV; C. S. YE; X. Z. PENG; H. ZHANG; L. B. XIAO; S. M. WANG: "Combination of stromal-derived factor-la and vascular endothelial growth factor gene-modified endothelial progenitor cells is more effective for ischemic neovascularization", J VASC SURG, vol. 50, no. 3, 2009, pages 608 - 616, XP026494118, DOI: doi:10.1016/j.jvs.2009.05.049
JIAN-XING YU ET AL: "Combination of stromal-derived factor-1[alpha] and vascular endothelial growth factor gene-modified endothelial progenitor cells is more effective for ischemic neovascularization", JOURNAL OF VASCULAR SURGERY, vol. 50, no. 3, 1 September 2009 (2009-09-01), pages 608 - 616, XP055014974, ISSN: 0741-5214, DOI: 10.1016/j.jvs.2009.05.049 *
K. SUZUKI; B. MURTUZA; N. SUZUKI; R. T. SMOLENSKI; M. H. YACOUB: "Intracoronary infusion of skeletal myoblasts improves cardiac function in doxorubicin-induced heart failure", CIRCULATION, vol. 104, no. 12, pages 1213 - 1217
K. SUZUKI; B. MURTUZA; S. FUKUSHIMA; R. T. SMOLENSKI; A. VARELA-CARVER; S. R. COPPEN; M. H. YACOUB: "Targeted cell delivery into infarcted rat hearts by retrograde intracoronary infusion: distribution, dynamics, and influence on cardiac function", CIRCULATION, vol. 110, no. 11, 2004, pages 11225 - 11230
K. SUZUKI; N. J. BRAND; R. T. SMOLENSKI; J. JAYAKUMAR; B. MURTUZA; M. H. YACOUB: "Development of a novel method for cell transplantation through the coronary artery", CIRCULATION, vol. 102, no. 19, 2000, pages 111359 - 111364
K.-I. HIASA: "Gene Transfer of Stromal Cell-Derived Factor-1 Enhances Ischemic Vasculogenesis and Angiogenesis via Vascular Endothelial Growth Factor/Endothelial Nitric Oxide Synthase-Related Pathway: Next-Generation Chemokine Therapy for Therapeutic Neovascularization", CIRCULATION, vol. 109, no. 20, 25 May 2004 (2004-05-25), US, pages 2454 - 2461, XP055358338, ISSN: 0009-7322, DOI: 10.1161/01.CIR.0000128213.96779.61 *
L. HOVE-MADSEN; D. M. BERS: "Sarcoplasmic reticulum Ca2+ uptake and thapsigargin sensitivity in permeabilized rabbit and rat ventricular myocytes", CIRC RES, vol. 73, no. 5, 1993, pages 820 - 828
L. NOYEZ ET AL: "Retrograde versus antegrade delivery of cardioplegic solution in myocardial revascularization. A clinical trial in patients with three-vessel coronary artery disease who underwent myocardial revascularization with extensive use of the internal mammary art", J THORAC CARDIOVASC SURG, vol. 105, no. 5, 1993, pages 854 - 863
M. C. SCIMIA; A. M. GUMPERT; W. J. KOCH: "Cardiovascular gene therapy for myocardial infarction", EXPERT OPIN BIOL THER, vol. 14, no. 2, 2014, pages 183 - 195
M. G. KATZ; A. S. FARGNOLI; A. P. KENDLE; R. J. HAJJAR; C. R. BRIDGES: "Gene Therapy in Cardiac Surgery: Clinical Trials, Challenges and Perspectives", ANN THORAC SURG, vol. 101, 2016, pages 2407 - 2416
M. HEDMAN; J. HARTIKAINEN; M. SYVANNE; J. STJERNVALL; A. HEDMAN; A. KIVELA; E. VANNINEN; H. MUSSALO; E. KAUPPILA; S. SIMULA: "Safety and Feasibility of Catheter-Based Local Intracoronary Vascular Endothelial Growth Factor Gene Transfer in the Prevention of Postangioplasty and In-Stent Restenosis and in the Treatment of Chronic Myocardial Ischemia. Phase II Results of the Kuopio", CIRCULATION, vol. 107, 2003, pages 2677 - 2683
M. KATZ ET AL: "Gene Therapy Delivery Systems for Enhancing Viral and Nonviral Vectors for Cardiac Diseases:and Nonviral Vectors for Cardiac Diseases: Current Concepts and Future Applications", HUMAN GENE THER, vol. 24, 2013, pages 914 - 927
M. RUEL; R. S. BEANLANDS; M. LORTIE; V. CHAN; N. CAMACK; E. J. SUURONEN; F. D. RUBENS; J. N. DASILVA; F. W. SELLKE; D. J. STEWART: "Concomitant treatment with oral L-arginine improves the efficacy of surgical angiogenesis in patients with severe diffuse coronary artery disease: the Endothelial Modulation in Angiogenic Therapy randomized controlled trial", J THORAC CARDIOVASC SURG, vol. 135, 2008, pages 762 - 770
M. S. PENN; F. O. MENDELSOHN; G. L. SCHAER; W. SHERMAN; M. FARR; J. PASTORE; D. ROUY; R. CLEMENS; R. ARAS; D. W. LOSORDO: "An open-label dose escalation study to evaluate the safety of administration of nonviral stromal cell-derived factor-1 plasmid to treat symptomatic ischemic heart failure", CIRC RES, vol. 112, no. 5, 2013, pages 816 - 825, XP055284331, DOI: doi:10.1161/CIRCRESAHA.111.300440
M. S. PENN; J. PASTORE; T. MILLER; R. ARAS: "SDF-1 in myocardial repair", GENE THER, vol. 19, no. 6, 2012, pages 583 - 587, XP055312601, DOI: doi:10.1038/gt.2012.32
MALECKI MACIEJ ET AL: "Construction of a bicistronic proangiogenic expression vector and its application in experimental angiogenesis in vivo", ACTA BIOCHIMICA POLONICA, POLSKIE TOWARZYSTWO BIOCHEMICZNE, PL, vol. 50, no. 3, 1 January 2003 (2003-01-01), pages 875 - 882, XP002581638, ISSN: 0001-527X *
N. T. WRIGHT; K. M. VARNEY; K. C. ELLIS; J. MARKOWITZ; R. K. GITTI; D. B. ZIMMER; D. J. WEBER: "The three-dimensional solution structure of Ca(2+)-bound S 100A1 as determined by NMR spectroscopy", J MOL BIOL, vol. 353, no. 2, 2005, pages 410 - 426, XP005086544, DOI: doi:10.1016/j.jmb.2005.08.027
P. BOEKSTEGERS ET AL: "Selective suction and pressure-regulated retroinfusion: an effective and safe approach to retrograde protection against myocardial ischemia in patients undergoing normal and high risk percutaneous transluminal coronary angioplasty", J AM COLL CARDIOL, vol. 31, no. 7, 1998, pages 1525 - 1533, XP002939445, DOI: doi:10.1016/S0735-1097(98)00135-1
P. BOEKSTEGERS; G. VON DEGENFELD; D. GIEHRL; R. HEINRICH; C. HULLIN; G. KUPATT; G. STEINBECK; G. BARETTON; G. MIDDELER; H. KATUS: "Myocardial gene transfer by selective pressure-regulated retroinfusion of coronary veins", GENE THER, vol. 7, no. 3, 2000, pages 232 - 240, XP002939442, DOI: doi:10.1038/sj.gt.3301079
P. KOLSUT; M. MALECKI; P. ZELAZNY; B. TERESINSKA; P. FIREK; P. JANIK; Z. RELIGA: "Gene therapy of coronary artery disease with phvegf165-early outcome", KARDIOL POL, vol. 59, 2003, pages 373 - 384
P. MUSIALEK; L. TEKIELI; M. KOSTKIEWICZ; M. MAJKA; W. SZOT; Z. WALTER; M. OLSZOWSKA: "Randomized transcoronary delivery of CD34(+) cells with perfusion versus stop-flow method in patients with recent myocardial infarction: Early cardiac retention of (m)Tc-labeled cells activity", J NUCLEAR CARDIOL, vol. 18, no. 1, 2011, pages 104 - 116
P. RAAKE; G. VON DEGENFELD; R. HINKEL; R. VACHENAUER; T. SANDNER; S. BELLER; M. ANDREES; C. KUPATT; G. SCHULER; P. BOEKSTEGERS: "Myocardial gene transfer by selective pressure-regulated retroinfusion of coronary veins: comparison with surgical and percutaneous intramyocardial gene delivery", J AM COLL CARDIOL, vol. 44, no. 5, 2004, pages 1124 - 1129, XP004908790, DOI: doi:10.1016/j.jacc.2004.05.074
P. W. MUSIALEK; A. B. TRACZ; K. SKOTNICKI; P. ZMUDKA; Z. PIENIAZEK; W. M. SZOSTEK: "Transcoronary stem cell delivery using physiological endothelium-targeting perfusion technique: the rationale and a pilot study involving a comparison with conventional over-the-wire balloon coronary occlusions in patients after recent myocardial infarcti", KARDIOL POL, vol. 64, no. 5, 2006, pages 489 - 498
P. W. RAAKE; R. HINKEL; S. MIILLER; S. DELKER; R. KREUZPOINTNER; C. KUPATT; H. A. KATUS; J. A. KLEINSCHMIDT; P. BOEKSTEGERS; O. J.: "Cardio-specific long-term gene expression in a porcine model after selective pressure-regulated retroinfusion of adeno-associated viral (AAV) vectors", GENE THER, vol. 15, no. 1, 2008, pages 12 - 17
PENN ET AL., CIRC RES, vol. 112, no. 5, 2013, pages 816 - 825
PENN ET AL., GENE THER, vol. 19, no. 6, 2012, pages 583 - 587
PLEGER ET AL., CIRCULATION, vol. 115, no. 19, 2007, pages 2506 - 2515
R. DONATO: "Functional roles of S 1 00 proteins, calcium-binding proteins of the EF-hand type", BIOCHIM BIOPHYS ACTA, vol. 1450, no. 3, 1999, pages 191 - 231, XP004277993, DOI: doi:10.1016/S0167-4889(99)00058-0
R. E. HENSCHLER; E. DEAK; E. SEIFRIED: "Homing of Mesenchymal Stem Cells", INFUSIONSTHER TRANSFUSIONSMED, vol. 35, no. 4, 2008, pages 306 - 312
R. INCORVATI; S. G. TAUBERG; M. J. PECORA; R. S. MACHEREY; S. B. DIANZUMBA; B. C. DONOHUE; M. W. KRUCOFF: "Clinical applications of coronary sinus retroperfusion during high risk percutaneous transluminal coronary angioplasty", J AM COLL CARDIOL, vol. 22, no. 1, 1993, pages 127 - 134
R. J. LEE; M. L. SPRINGER; W. E. BLANCO-BOSE; R. SHAW; P. C. URSELL; H. M. BLAU: "VEGF Gene Delivery to Myocardium: Deleterious Effects of Unregulated Expression", CIRCULATION, vol. 102, 2000, pages 898 - 901
REMPPIS ET AL., BIOCHIM BIOPHYS ACTA, vol. 1313, no. 3, 1996, pages 253 - 257
ROHDE ET AL., J CARDIOVASC TRANSL RES, vol. 3, no. 5, 2010, pages 525 - 537
ROHDE ET AL., JMOL CELL CARDIOL, vol. 50, no. 5, 2011, pages 777 - 784
S. ALINO; M. JOSE HERRERO; V. BODI; I. NOGUERA; L. MAINAR; F. DASI; A. SEMPERE; M. SANCHEZ; A. DIAZ; L. SABATER: "Naked DNA delivery to whole pig cardiac tissue by coronary sinus retrograde injection employing non-invasive catheterization", J GENE MED, vol. 12, no. 11, 2010, pages 920 - 926
S. ANDERSON; R. SHINER; M. D. BROWN; O. HUDLICKA: "ICAM-1 expression and leukocyte behavior in the microcirculation of chronically ischemic rat skeletal muscles", MICROVASC RES, vol. 71, no. 3, 2006, pages 205 - 211, XP024919608, DOI: doi:10.1016/j.mvr.2006.03.003
S. CHEN ET AL: "Myocardial regeneration in adriamycin cardiomyopathy by nuclear expression of GLP 1 using ultrasound targeted microbubble destruction", BIOCHEM BIOPHYS RES COMMUN, vol. 458, no. 4, pages 823 - 829, XP029144575, DOI: doi:10.1016/j.bbrc.2015.02.038
S. ROBINSON; P. W. CHO; H. I. LEVITSKY; J. L. OLSON; R. H. HRUBAN; M. A. ACKER; P. D. KESSLER: "Arterial delivery of genetically labelled skeletal myoblasts to the murine heart: long-term survival and phenotypic modification of implanted myoblasts", CELL TRANSPLANT, vol. 5, no. 1, 1996, pages 77 - 91, XP002064606, DOI: doi:10.1016/0963-6897(95)02016-0
S. T. PLEGER; C. SHAN; J. KSIENZYK; R. BEKEREDJIAN; P. BOEKSTEGERS; R. HINKEL; S. SCHINKEL; B. LEUCHS; J. LUDWIG; G. QIU: "Cardiac AAV9-S100A1 gene therapy rescues post-ischemic heart failure in a preclinical large animal model", SCI TRANSL MED, vol. 3, no. 92, 2011, pages 92RA64
S. T. PLEGER; P. MOST; M. BOUCHER; S. SOLTYS: "Stable myocardial-specific AAV6-S 100A1 gene therapy results in chronic functional heart failure rescue", CIRCULATION, vol. 115, no. 19, 2007, pages 2506 - 2515, XP002493145, DOI: doi:10.1161/CIRCULATIONAHA.106.671701
T. NAGASAWA: "CXCL12/SDF-1 and CXCR4", FRONT. IMMUNOL, vol. 6, 2015, pages 301
T. POHL ET AL: "Retroinfusion-supported stenting in high-risk patients for percutaneous intervention and bypass surgery: results of the prospective randomized myoprotect I study", CATH CARDIOVASC INTERVENT, vol. 62, no. 3, 2004, pages 323 - 330
TAIMEH ET AL., NAT REV CARDIOL, vol. 10, no. 9, 2013, pages 519 - 530
TIAN XIAO-BIN SUN LI ZHANG YU-KUN GAO YONG FU DE-HAO YANG SHU-HUA: "Construction and expression of a bicistronic vector containing human bone morphogenetic protein 2 and vascular endothelial growth factor-165 genes in vitro", CHINESE MEDICAL JOURNAL, vol. 122, no. 4, 1 January 2009 (2009-01-01), China, pages 471 - 473, XP055338963, Retrieved from the Internet <URL:http://124.205.33.103:81/ch/reader/create_pdf.aspx?file_no=200921883107640&year_id=2009&quarter_id=4&falg=1> DOI: 10.3760/cma.j.issn.0366-6999.2009.04.0021 *
WEBER ET AL., GENE THER, vol. 21, 2014, pages 131 - 138
Y. WANG; F. WANG; R. WANG; P. ZHAO; Q. XIA: "2A self-cleaving peptide-based multi-gene expression system in the silkworm Bombyx mori", SCI REP, vol. 5, no. 16273, 2015, pages 1 - 10
YU ET AL., J VASC SURG, vol. 50, no. 3, 2009, pages 608 - 616
Z. A. G. M. LOKMIC: "Visualisation and stereological assessment of blood and lymphatic vessels", HISTOLOG HISTOPATHOL, vol. 26, no. 6, 2011, pages 781 - 796
Z. TAIMEH; J. LOUGHRAN; E. J. BIRKS; R. BOLLI: "Vascular endothelial growth factor in heart failure", NAT REV CARDIOL, vol. 10, no. 9, 2013, pages 519 - 530

Cited By (17)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11946054B2 (en) 2017-01-10 2024-04-02 Precigen, Inc. Modulating expression of polypeptides via new gene switch expression systems
US11692194B2 (en) 2017-01-10 2023-07-04 Precigen, Inc. Modulating expression of polypeptides via new gene switch expression systems
CN111465697A (zh) * 2017-09-29 2020-07-28 贝特基因 用于预防或治疗心力衰竭的药物组合物
CN111465697B (zh) * 2017-09-29 2023-10-13 贝特基因 用于预防或治疗心力衰竭的药物组合物
US12215362B2 (en) 2017-09-29 2025-02-04 Bethphagen Inc. Pharmaceutical composition for prevention or treatment of heart failure
US12404306B2 (en) 2018-03-06 2025-09-02 Precigen, Inc. Human papillomavirus vaccines and uses of the same
US11608362B2 (en) 2018-03-06 2023-03-21 Precigen, Inc. Hepatitis B vaccines and uses of the same
US12234261B2 (en) 2018-03-06 2025-02-25 Precigen, Inc. Hepatitis B vaccines and uses of the same
WO2019218091A1 (en) * 2018-05-18 2019-11-21 UNIVERSITé LAVAL Vectors for dna vaccination
WO2019227106A1 (en) * 2018-05-25 2019-11-28 The Wistar Institute Tumor-specific neoantigens and methods of using the same
WO2020232527A1 (en) * 2019-05-21 2020-11-26 UNIVERSITé LAVAL Crimean-congo hemorrhagic fever virus immunogenic compositions
WO2021053222A1 (en) * 2019-09-20 2021-03-25 Ucl Business Ltd Gene therapy composition and treatment of right ventricular arrythmogenic cardiomyopathy
US20220389452A1 (en) * 2019-09-20 2022-12-08 Ucl Business Ltd Gene therapy composition and treatment of right ventricular arrythmogenic cardiomyopathy
US12552838B2 (en) 2020-04-20 2026-02-17 Tenaya Therapeutics, Inc. Adeno-associated virus with engineered capsid
EP4192487A4 (en) * 2020-08-07 2024-10-02 Spacecraft Seven, LLC GENE THERAPY FOR PLAKOPHILIN-2 (PKP2) INVOLVING AAV VECTOR
US11883506B2 (en) 2020-08-07 2024-01-30 Spacecraft Seven, Llc Plakophilin-2 (PKP2) gene therapy using AAV vector
WO2023232984A1 (en) * 2022-06-02 2023-12-07 Patrick Most S100a1 protein for use in treating and preventing infarct extension

Also Published As

Publication number Publication date
KR20180069081A (ko) 2018-06-22
MX2018005886A (es) 2018-08-15
RU2758489C2 (ru) 2021-10-28
JP6976244B2 (ja) 2021-12-08
US11154622B2 (en) 2021-10-26
US20240148908A1 (en) 2024-05-09
JP2018536405A (ja) 2018-12-13
MA43404A (fr) 2018-10-17
US20220072159A1 (en) 2022-03-10
CN108713025A (zh) 2018-10-26
EP3387010A1 (en) 2018-10-17
RU2018117674A (ru) 2019-12-13
US20180360992A1 (en) 2018-12-20
SG11201803934YA (en) 2018-06-28
AU2016353342A1 (en) 2018-05-24
RU2018117674A3 (https=) 2020-04-20
HK1259137A1 (zh) 2019-11-29
AU2016353342B2 (en) 2021-04-01
CA3004742A1 (en) 2017-05-18
BR112018009645A2 (pt) 2018-11-13

Similar Documents

Publication Publication Date Title
US20240148908A1 (en) Compositions and methods for expression of multiple biologically active polypeptides from a single vector for treatment of cardiac conditions and other pathologies
ES2967616T3 (es) Tratamiento de AMD mediante el uso de AAV sFLT-1
US9353164B2 (en) Cardiac-specific nucleic acid regulatory elements and methods and use thereof
US20230340528A1 (en) Methods of treating cardiac disorders and congestive heart failure and administering aav vectors
AU2014274902B2 (en) Cycle adenosine monophosphate-incompetent adenylyl cyclase and compositions and methods for treating heart failure and increasing cardiac function
US20160166651A1 (en) Systemic delivery of virus vectors encoding urocortin-2 and related genes to treat diabetes-related cardiac dysfunctions and congestive heart failure
JP7651562B2 (ja) Fkrpの心毒性を軽減する遺伝子治療発現系
US20240002462A1 (en) Treatment of neuropathy with igf-1-encoding dna constructs and hgf-encoding dna constructs
WO2001032220A1 (en) Gene therapy for diabetic ischemic disease
ES2791415T3 (es) Método para diagnosticar miocardiopatías
ES2975422T3 (es) Proteínas con actividad cardioprotectora
US20250143624A1 (en) Ventricular Arrhythmias and Related Methods
CN106029107A (zh) 使用疾病特异性启动子治疗心血管疾病的组合物和方法
JP2025534425A (ja) 局所遺伝子治療のための腎臓の局所領域灌流
EP3689896A1 (en) Grk2 modulating mirnas
WO2024097602A2 (en) Gene therapy for lemd2 cardiomyopathy
JP2025519230A (ja) 梗塞進展の処置および予防に使用するs100a1タンパク質
HK40090887A (zh) 治疗心贜疾患和充血性心力衰竭以及施用aav载体的方法
Sasipong Targeted overexpression of relaxin receptor 1 (RXFP1) with chronic administration of relaxin as a novel inotropic approach for heart failure treatment
EP3546578A1 (en) Ap-1 binding polynucleotides
HK40093025A (zh) 用於治疗同种异体移植物血管病、烟雾病、烟雾病综合征和内膜增殖的组合物和方法

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16810130

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3004742

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 11201803934Y

Country of ref document: SG

Ref document number: MX/A/2018/005886

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: 2018524443

Country of ref document: JP

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112018009645

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2016353342

Country of ref document: AU

Date of ref document: 20161111

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20187016185

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2016810130

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2018117674

Country of ref document: RU

ENP Entry into the national phase

Ref document number: 112018009645

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20180511