WO2016160618A2 - Car t-cell therapy directed to lhr for the treatment of solid tumors - Google Patents
Car t-cell therapy directed to lhr for the treatment of solid tumors Download PDFInfo
- Publication number
- WO2016160618A2 WO2016160618A2 PCT/US2016/024354 US2016024354W WO2016160618A2 WO 2016160618 A2 WO2016160618 A2 WO 2016160618A2 US 2016024354 W US2016024354 W US 2016024354W WO 2016160618 A2 WO2016160618 A2 WO 2016160618A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- lhr
- seq
- antibody
- equivalent
- acid sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/57407—Specifically defined cancers
- G01N33/57415—Specifically defined cancers of breast
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/31—Chimeric antigen receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4254—Adhesion molecules, e.g. NRCAM, EpCAM or cadherins
- A61K40/4255—Mesothelin [MSLN]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4256—Tumor associated carbohydrates
- A61K40/4257—Mucins, e.g. MUC-1
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70517—CD8
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70521—CD28, CD152
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70578—NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/72—Receptors; Cell surface antigens; Cell surface determinants for hormones
- C07K14/723—G protein coupled receptor, e.g. TSHR-thyrotropin-receptor, LH/hCG receptor, FSH receptor
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2809—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2869—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against hormone receptors
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3007—Carcino-embryonic Antigens
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3069—Reproductive system, e.g. ovaria, uterus, testes, prostate
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/57407—Specifically defined cancers
- G01N33/57434—Specifically defined cancers of prostate
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/57407—Specifically defined cancers
- G01N33/57449—Specifically defined cancers of ovaries
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/74—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving hormones or other non-cytokine intercellular protein regulatory factors such as growth factors, including receptors to hormones and growth factors
- G01N33/76—Human chorionic gonadotropin including luteinising hormone, follicle stimulating hormone, thyroid stimulating hormone or their receptors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K2035/124—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells the cells being hematopoietic, bone marrow derived or blood cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/27—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by targeting or presenting multiple antigens
- A61K2239/29—Multispecific CARs
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/31—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/38—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
- A61K2239/59—Reproductive system, e.g. uterus, ovaries, cervix or testes
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/54—F(ab')2
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/52—Predicting or monitoring the response to treatment, e.g. for selection of therapy based on assay results in personalised medicine; Prognosis
Definitions
- This disclosure relates to novel luteinizing hormone receptor (LHR) chimeric antigen receptor (CAR), cells or compositions comprising the same, and methods for using the same for therapy including solid tumors. Also provided herein are isolated peptides and fusion proteins containing immunogenic determinants for the luteinizing hormone receptor chimeric antigen receptor.
- LHR luteinizing hormone receptor
- CAR chimeric antigen receptor
- Ovarian carcinoma represents the most common cause of cancer death from gynecologic tumors (Siegel, R. et al. (2012) CA Cancer J. Clin.62:10-29). Approximately 25,000 new cases and 14,000 deaths are expected to occur in the United States every year (Siegel, R. et al. (2012) CA Cancer J. Clin.62:10-29). Overall survival of ovarian carcinoma appears to have improved in the last 30 years as median survival during the 1960s was approximately 12 months compared to the current 38 months. However, the 5-year survival for stage III ovarian cancer has not changed significantly and remains at 25%. The improvement in median survival can be explained in part due to the improvement in front line chemotherapy.
- the standard initial chemotherapy for patients with ovarian cancer involves a platinum-paclitaxel based regimen (Marcus, C.S. et al. (2014) J. Cancer 5:25-30).
- CAR modified T-cells combine the HLA-independent targeting specificity of a monoclonal antibody with the cytolytic activity, proliferation, and homing properties of activated T-cells, but do not respond to checkpoint suppression. Because of their ability to kill antigen expressing targets directly, CAR T-cells are highly toxic to any antigen positive cells or tissues making it a requirement to construct CARs with highly tumor specific antibodies. To date, CAR modified T-cells to ovarian carcinomas have been constructed against the a-folate receptor, mesotheiin, and MUC-CD, but all of these have some off-target expression of antigen.
- This disclosure provides a new target for the treatment of solid tumors that include, but are not limited to, ovarian and prostate carcinomas.
- the target, LHR is highly expressed on the majority of these tumors but has restricted off-target positivity and therefore a desirable safety profile.
- the compositions are particularly useful in the treatment of tumors or cancerous cell that express or overexpress LHR.
- the present disclosure provides an isolated antibodies, the antibodies comprising a heavy chain (HC) immunoglobulin variable domain sequence and a light chain (LC) immunoglobulin variable domain sequence, wherein the antibody binds to an epitope of a luteinizing hormone receptor (LHR).
- this disclosure provides an isolated anti-LHR antibody or fragment thereof as disclosed herein and a detectable or purification label, alone or in combination with an LHR antigen or fragment thereof. Further provided herein is an ex vivo cell comprising this antigen/antibody complex.
- CAR chimeric antigen receptor
- a chimeric antigen receptor comprising: (a) an antigen binding domain of a LHR antibody; (b) a hinge domain, (c) a CD28 transmembrane domain; (d) one or more costimulatory regions selected from a CD28 costimulatory signaling region, a 4- IBB costimulatory signaling region, an ICOS costimulatory signaling region, and an OX40 costimulatory region, and (e) a CD3 zeta signaling domain and alternatives thereof.
- CAR chimeric antigen receptor
- the present disclosure provides a chimeric antigen receptor (CAE.) comprising: (a) an antigen binding domain of an anti-luteinizing hormone receptor (“LHR") antibody, (b) a CDS a hinge domain; (c) a CDS a transmembrane domain; (d) a CD28 and/or a 4- IBB costimulatorv'' signaling region; and (e) a CD 3 zeta signaling domain and alternatives thereof.
- LHR anti-luteinizing hormone receptor
- the present disclosure provides an isolated nucleic acid sequence encoding the anti-LHR antibody, or the anti-LHR CAR.
- the present disclosure provides a vector comprising the isolated nucleic acid sequence encoding the anti-LHR antibody, or the anti-LHR CAR.
- the present disclosure provides a vector comprising the isolated nucleic acid sequence encoding the anti-LHR antibody, or the anti-LHR CAR.
- the present disclosure provides a composition comprising a carrier and one or more of: the anti-LHR antibody; and/or the anti-LHR CAR; and/or the isolated nucleic acid encoding the anti-LHR antibody or the anti-LHR CAR; and/or the vector comprising the isolated nucleic acid sequence encoding the anti-LHR antibody, or the anti- LHR. CAR; and/or an isolated cell comprising the anti-LHR CAR.
- the disclosure provides a composition comprising, or alternatively consisting essentially of, or yet further consisting of a carrier and one or more of: an antibody or fragment thereof, a nucleic acid encoding the antibody or fragment thereof, an isolated cell comprising an anti-LHR CAR; and/or the isolated nucleic acid encoding the CAR; and/or the vector comprising the nucleic acid encoding the CAR; and/or the isolated cell expressing an anti-LHR CAR; and/or the anti-LHR antibody.
- a composition comprising, or alternatively consisting essentially of, or yet further consisting of a carrier and one or more of: an antibody or fragment thereof, a nucleic acid encoding the antibody or fragment thereof, an isolated cell comprising an anti-LHR CAR; and/or the isolated nucleic acid encoding the CAR; and/or the vector comprising the nucleic acid encoding the CAR; and/or the isolated cell expressing an anti-LHR CAR; and/or the anti-LHR antibody
- FIGS.1A-1C show flow cytometry profiles of (FIG.1A) LHR on TOV21G, (FIG. 1B) mesothelin on SKOV3, and (FIG.1C) MUC16 on CAOV3 cell lines.
- FIGS.2A-2C show positive immunohistochemistry staining patterns of (FIG.2A) LHR antibody on a Stage 2 serous papillary adenocarcinoma; (FIG.2B) MUC16 antibody on a Stage IIIC endometrioid adenocarcinoma; and (FIG.2C) mesothelin antibody on a Stage 1C serous papillary adenocarcinoma.
- FIG.3 shows the sequence used to generate LHR-Fc.
- Amino acid structure of LHR G-protein showing sequence (outlined area) used to generate a LHR-Fc used in immunization and screening methods to identify potential LHR binding antibodies useful for the generation of LHR CARs.
- FIG.4 shows typical flow cytometry screen of LHR-Fc ELISA positive antibodies on the ES-2 ovarian carcinoma cell line demonstrating strong reactivity by hybridoma 8B7 only.
- FIG.5 shows flow cytometry of 5 candidate LHR antibody subclones with highest MFI values on ES-2 human ovarian carcinoma cells.
- FIG.6 shows a schematic diagram of the DNA sequence for, and the theoretical structure of an anti-LHR CAR in the plasma membrane.
- FIG.7 shows the alignments of the heavy chain and light chain sequences of LHR antibody subclones.
- FIGS.8A-D shows a distribution of LHR positive cancers(FIG.8A); the distribution of LHR intensity with multiple tumor histology groups (FIG.8B); LHR staining intensity in patients with ovarian, peritoneal, or fallopian tube cancer (FIG.8C); and LHR staining intensity by tumor pathologic stage group (FIG.8D).
- FIGS.9A-D LHR expression in prostate cancer, in histology (FIG.9A), relative mRNA levels in (AD) prostate cancer and castration resistant (CR) prostate cancer (FIG.9B) and Western blot (FIG.9C-D).
- FIG.10 shows the backbone of the gene transfer vector is an HIV-based, bicistronic lentiviral vector, pLVX-IRES-ZsGreen containing HIV-15’ and 3’ long terminal repeats (LTRs), packaging signal ( ⁇ ), EFla promoter, internal ribosome entry site (IRES), ZsGreen, a green fluorescent protein, woodchuck hepatitis virus post-transcriptional regulatory element (WPRE), and simian virus 40 origin (SV40).
- Constitutive expression of the transgene comprising of a scFV specific to LHR, a CD 8 hinge and transmembrane region and CD28, 4- 1BB and ⁇ )3 ⁇ signaling domain, is insured by the presence of the EF-la promoter.
- ZsGreen is carried out by the IRES region. Integration of the vector was assayed by the presence of ZsGreen in the cells, via fluorescent microscopy.
- FIG. 11 depicts the results of the cytotoxicity assay of LHR CAR T-cells.
- Cytotoxicity of the LHR CAR expressing T-cells was determined using an LDH cytotoxicity kit as described in the Methods. Prior to the assay, T-cells were activated using aCD3/CD8 beads (Stem Cell Technologies, 30 ui to 2 ml of media). The activated T-cells were transduced with LHR Ientiviral particles, following which the T cells were activated for using the aCD3/CD8 beds. Un-transduced, activated T-cells were used as a control. 3,000 SKOV3 cells were plated per well. LHR. transduced T cells were added in ratios of 20: 1, 10: 1, 5: 1 and 1 : 1 (60,000 - 3000) to the wells. Each data point represents the average of triplicate measurements,
- FIG, 12 depicts mRNA expression of the LHR CAR in primary T-cells.
- Primary T- ceils transduced with the LHR CAR show expression of the LHR mRNA.
- Primers used spanned the area between the CD8 hinge and the 4- IBB signaling domain (300 bp)
- a cell includes a plurality of cells, including mixtures thereof.
- animal refers to living multi-cellular vertebrate organisms, a category that includes, for example, mammals and birds.
- mammal includes both human and non-human mammals.
- subject refers to human and veterinary subjects, for example, humans, animals, non-human primates, dogs, cats, sheep, mice, horses, and cows. In some embodiments, the subject is a human.
- antibody collectively refers to immunoglobulins or immunoglobulin-like molecules including by way of example and without limitation, IgA, IgD, IgE, IgG and IgM, combinations thereof, and similar molecules produced during an immune response in any vertebrate, for example, in mammals such as humans, goats, rabbits and mice, as well as non-mammalian species, such as shark immunoglobulins.
- the term “antibody” includes intact immunoglobulins and "antibody fragments” or "antigen binding fragments” that specifically bind to a molecule of interest (or a group of highly similar molecules of interest) to the substantial exclusion of binding to other molecules (for example, antibodies and antibody fragments that have a binding constant for the molecule of interest that is at least 1() 3 M -1 greater, at least 10 4 M -1 greater or at least 10 5 M -1 greater than a binding constant for other molecules in a biological sample).
- the term “antibody” also includes genetically engineered forms such as chimeric antibodies (for example, humanized murine antibodies), heteroconjugate antibodies (such as, bispecific antibodies). See also, Pierce Catalog and Handbook, 1994-1995 (Pierce Chemical Co., Rockford, 111.); Kuby, J., Immunology, 3 rd Ed., IV . i I. Freeman & Co., New York, 1997.
- an immunoglobulin has heavy (H) chains and light (L) chains interconnected by disulfide bonds.
- Each heavy and light chain contains a constant region and a variable region, (the regions are also known as "domains").
- the heavy and the light chain variable regions specifically bind the antigen.
- Light and heavy chain variable regions contain a "framework" region interrupted by three hypervariable regions, also called “complementarity-determining regions" or "CDRs".
- framework region and CDRs have been defined (see, Kabat et al., Sequences of Proteins of Immunological Interest, U.S. Department of Health and Human Services, 1991, which is hereby incorporated by reference).
- the Kabat database is now maintained online.
- the sequences of the framework regions of different light or heavy chains are relatively conserved within a species.
- the framework region of an antibody that is the combined framework regions of the constituent light and heavy chains, largely adopts D ⁇ - sheet conformation and the CDRs form loops which connect, and in some cases form part of, WKH ⁇ -sheet structure.
- framework regions act to form a scaffold that provides for positioning the CDRs in correct orientation by inter-chain, non-covalent interactions.
- the CDRs are primarily responsible for binding to an epitope of an antigen.
- the CDRs of each chain are typically referred to as CDR1, CDR2, and CDR3, numbered sequentially starting from the N-terminus, and are also typically identified by the chain in which the particular CDR is located.
- a V H CDR3 is located in the variable domain of the heavy chain of the antibody in which it is found
- a V L CDR1 is the CDR1 from the variable domain of the light chain of the antibody in which it is found.
- An antibody that binds LHR will have a specific V H region and the V L region sequence, and thus specific CDR sequences.
- Antibodies with different specificities i.e.
- the term“antigen” refers to a compound, composition, or substance that may be specifically bound by the products of specific humoral or cellular immunity, such as an antibody molecule or T-cell receptor.
- Antigens can be any type of molecule including, for example, haptens, simple intermediary metabolites, sugars (e.g., oligosaccharides), lipids, and hormones as well as macromolecules such as complex carbohydrates (e.g.,
- antigens include, but are not limited to, viral antigens, bacterial antigens, fungal antigens, protozoa and other parasitic antigens, tumor antigens, antigens involved in autoimmune disease, allergy and graft rejection, toxins, and other miscellaneous antigens.
- antigen binding domain refers to any protein or polypeptide domain that can specifically bind to an antigen target.
- CAR chimeric antigen receptor
- transmembrane domain derived from a polypeptide different from a polypeptide from which the extracellular domain is derived, and at least one intracellular domain.
- The“chimeric antigen receptor (CAR)” is sometimes called a“chimeric receptor”, a“T-body”, or a “chimeric immune receptor (CIR).”
- The“extracellular domain capable of binding to an antigen” means any oligopeptide or polypeptide that can bind to a certain antigen.
- the “intracellular domain” means any oligopeptide or polypeptide known to function as a domain that transmits a signal to cause activation or inhibition of a biological process in a cell.
- transmembrane domain means any oligopeptide or polypeptide known to span the cell membrane and that can function to link the extracellular and signaling domains.
- a chimeric antigen receptor may optionally comprise a“hinge domain” which serves as a linker between the extracellular and transmembrane domains.
- Non-limiting exemplary polynucleotide sequences that encode for components of each domain are disclosed herein, e.g.:
- Hinge domain IgG1 heavy chain hinge sequence, SEQ. ID NO: 66:
- Transmembrane domain CD28 transmembran region SEQ. ID NO: 67:
- Intracellular domain 4-1BB co-stimulatory signaling region, SEQ. ID NO: 68:
- Intracellular domain CD28 co-stimulatory signaling region, SEQ. ID NO: 69: AGGAGTAAGAGGAGCAGGCTCCTGCACAGTGACTACATGAACATGACTCCCCGC CGCCCCGGGCCCACCCGCAAGCATTACCAGCCCTATGCCCCACCACGCGACTTCG CAGCCTATCGCTCC
- Intracellular domain CD3 zeta signaling region, SEQ. ID NO: 70:
- each exemplary domain component include other proteins that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with the proteins encoded by the above disclosed nucleic acid sequences. Further, non-limiting examples of such domains are provided herein.
- A“composition” typically intends a combination of the active agent, e.g., compound or composition, and a naturally-occurring or non-naturally-occurring carrier, inert (for example, a detectable agent or label) or active, such as an adjuvant, diluent, binder, stabilizer, buffers, salts, lipophilic solvents, preservative, adjuvant or the like and include
- Carriers also include pharmaceutical excipients and additives proteins, peptides, amino acids, lipids, and carbohydrates (e.g., sugars, including monosaccharides, di-, tri-, tetra-oligosaccharides, and oligosaccharides; derivatized sugars such as alditols, aldonic acids, esterified sugars and the like; and polysaccharides or sugar polymers), which can be present singly or in combination, comprising alone or in
- Exemplary protein excipients include serum albumin such as human serum albumin (HSA), recombinant human albumin (rHA), gelatin, casein, and the like.
- Representative amino acid/antibody components which can also function in a buffering capacity, include alanine, arginine, glycine, arginine, betaine, histidine, glutamic acid, aspartic acid, cysteine, lysine, leucine, isoleucine, valine, methionine, phenylalanine, aspartame, and the like.
- Carbohydrate excipients are also intended within the scope of this technology, examples of which include but are not limited to monosaccharides such as fructose, maltose, galactose, glucose, D-mannose, sorbose, and the like; disaccharides, such as lactose, sucrose, trehalose, cellobiose, and the like;
- polysaccharides such as raffinose, melezitose, maltodextrins, dextrans, starches, and the like
- alditols such as mannitol, xylitol, maltitol, lactitol, xylitol sorbitol (glucitol) and myoinositol.
- consensus sequence refers to an amino acid or nucleic acid sequence that is determined by aligning a series of multiple sequences and that defines an idealized sequence that represents the predominant choice of amino acid or base at each corresponding position of the multiple sequences.
- the consensus sequence for the series can differ from each of the sequences by zero, one, a few, or more substitutions. Also, depending on the sequences of the series of multiple sequences, more than one consensus sequence may be determined for the series. The generation of consensus sequences has been subjected to intensive mathematical analysis. Various software programs can be used to determine a consensus sequence.
- LHR luteinizing hormone receptor
- Luteinizing hormone receptor [Homo sapiens], SEQ. ID NO: 53:
- Luteinizing hormone receptor [Rattus norvegicus], SEQ. ID NO: 55:
- &' ⁇ KLQJH ⁇ GRPDLQ refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with the &' ⁇ KLQJH ⁇ GRPDLQ sequence as shown herein.
- the example sequences of &' ⁇ KLQJH ⁇ domain for human, mouse, and other species are provided in Pinto, R.D. et al. (2006) Vet. Immunol. Immunopathol.110:169-177. Non-limiting examples of such include:
- Mouse CD8 alpha hinge domain SEQ. ID NO: 57:
- &' ⁇ WUDQVPHPEUDQH ⁇ GRPDLQ refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with the &' ⁇ WUDQVPHPEUDQH ⁇ GRPDLQ sequence as shown herein.
- the fragment sequences associated with the amino acid positions 183 to 203 of the human T-cell surface glycoprotein CD8 alpha chain (NCBI Reference Sequence: NP_001759.3), or the amino acid positions 197 to 217 of the mouse T-cell surface glycoprotein CD8 alpha chain (NCBI Reference
- Rat CD8 alpha transmembrane domain SEQ. ID NO: 61:
- CD28 transmembrane domain refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, at least 90% sequence identity, or alternatively at least 95% sequence identity with the CD28 transmembrane domain sequence as shown herein.
- GenBank Accession Nos: XM_006712862.2 and XM_009444056.1 provide additional, non-limiting, example sequences of the CD28 transmembrane domain.
- the sequences associated with each of the listed accession numbers are provided as follows the sequence encoded by SEQ ID NO: 69.
- the term“4-1BB costimulatory signaling region” refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with the 4-1BB costimulatory signaling region sequence as shown herein.
- the example sequence of the 4-1BB costimulatory signaling region is provided in U.S. App. No. US 13/826,258.
- the sequence of the 4-1BB costimulatory signaling region associated disclosed in the U.S. App. No. US 13/826,258 is listed as follows:
- CD28 costimulatory signaling region refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with the CD28 costimulatory signaling region sequence shown herein.
- Exemplary CD28 costimulatory signaling domains are provided in U.S. Pat. No.5,686,281; Geiger, T. L. et al., Blood 98: 2364-2371 (2001); Hombach, A. et al., J Immunol 167: 6123-6131 (2001); Maher, J. et al.
- Non-limiting examples include residues 114-220 of the below CD28 Sequence: MLRLLLALNL FPSIQVTGNK
- ICOS costimulatory signaling region refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with the ICOS costimulatory signaling region sequence as shown herein.
- Non- limiting example sequences of the ICOS costimulatory signaling region are provided in U.S. Publication 2015/0017141A1 the exemplary polynucleotide sequence provided below.
- OX40 costimulatory signaling region refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, or duley 90% sequence identity, or alternatively at least 95% sequence identity with the OX40 costimulatory signaling region sequence as shown herein.
- Non-limiting example sequences of the OX40 costimulatory signaling region are disclosed in U.S. Publication 2012/20148552A1, and include the exemplary sequence provided below.
- SEQ ID NO:72 AGGGACCAG AGGCTGCCCC CCGATGCCCA CAAGCCCCCT GGGGGAGGCA GTTTCCGGAC CCCCATCCAA GAGGAGCAGG CCGACGCCCA CTCCACCCTG GCCAAGATC
- CD3 zeta signaling domain refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with the CD3 zeta signaling domain sequence as shown herein.
- the example sequences of the CD3 zeta signaling domain are provided in U.S. App. No. US 13/826,258.
- the sequence associated with the CD3 zeta signaling domain is listed as follows:
- CD3 zeta signaling domain SEQ. ID NO: 63:
- B cell refers to a type of lymphocyte in the humoral immunity of the adaptive immune system. B cells principally function to make antibodies, serve as antigen presenting cells, release cytokines, and develop memory B cells after activation by antigen interaction. B cells are distinguished from other lymphocytes, such as T cells, by the presence of a B-cell receptor on the cell surface. B cells may either be isolated or obtained from a commercially available source.
- Non-limiting examples of commercially available B cell lines include lines AHH-1 (ATCC® CRL-8146TM), BC-1 (ATCC® CRL- 2230TM), BC-2 (ATCC® CRL-2231TM), BC-3 (ATCC® CRL-2277TM), CA46 (ATCC® CRL-1648TM), DG-75 [D.G.-75] (ATCC® CRL-2625TM), DS-1 (ATCC® CRL-11102TM), EB-3 [EB3] (ATCC® CCL-85TM), Z-138 (ATCC #CRL-3001), DB (ATCC CRL-2289), Toledo (ATCC CRL-2631), Pfiffer (ATCC CRL-2632), SR (ATCC CRL-2262), JM-1 (ATCC CRL-10421), NFS-5 C-1 (ATCC CRL-1693); NFS-70 C10 (ATCC CRL-1694), NFS-25 C-3 (ATCC CRL-1695), AND SUP-B15 (ATCC CRL-1929).
- cell lines derived from anaplastic and large cell lymphomas e.g., DEL, DL-40, FE-PD, JB6, Karpas 299, Ki-JK, Mac-2A Ply1, SR-786, SU-DHL-1, -2, - 4,-5,-6,-7,-8,-9,-10, and -16, DOHH-2, NU-DHL-1, U-937, Granda 519, USC-DHL-1, RL; Hodgkin’s lymphomas, e.g., DEV, HD-70, HDLM-2, HD-MyZ, HKB-1, KM-H2, L 428, L 540, L1236, SBH-1, SUP-HD1, SU/RH-HD-l.
- Non-limiting exemplary sources for such commercially available cell lines include the American Type Culture Collection, or ATCC, (www.atcc.org/) and the German Collection of Microorganisms and Cell Cultures
- T cell refers to a type of lymphocyte that matures in the thymus. T cells play an important role in cell-mediated immunity and are distinguished from other lymphocytes, such as B cells, by the presence of a T-cell receptor on the cell surface. T-cells may either be isolated or obtained from a commercially available source.“T cell” includes all types of immune cells expressing CD3 including T-helper cells (CD4+ cells), cytotoxic T-cells (CD8+ cells), natural killer T-cells, T-regulatory cells (Treg) and gamma- delta T cells.
- CD3 T-helper cells
- CD8+ cells cytotoxic T-cells
- Reg T-regulatory cells
- gamma- delta T cells gamma- delta T cells.
- A“cytotoxic cell” includes CD8+ T cells, natural-killer (NK) cells, and neutrophils, which cells are capable of mediating cytotoxicity responses.
- T-cell lines include lines BCL2 (AAA) Jurkat (ATCC® CRL-2902TM), BCL2 (S70A) Jurkat (ATCC® CRL-2900TM), BCL2 (S87A) Jurkat (ATCC® CRL-2901TM), BCL2 Jurkat (ATCC® CRL-2899TM), Neo Jurkat (ATCC® CRL-2898TM), TALL-104 cytotoxic human T cell line (ATCC # CRL-11386).
- T-cell lines e.g., such as Deglis, EBT-8, HPB-MLp-W, HUT 78, HUT 102, Karpas 384, Ki 225, My-La, Se-Ax, SKW-3, SMZ-1 and T34; and immature T- cell lines, e.g., ALL-SIL, Be13, CCRF-CEM, CML-T1, DND-41, DU.528, EU-9, HD- Mar, HPB-ALL, H-SB2, HT-1, JK-T1, Jurkat, Karpas 45, KE-37, KOPT-K1, K-T1, L-KAW, Loucy, MAT, MOLT-1, MOLT 3, MOLT-4, MOLT 13, MOLT-16, MT-1, MT-ALL, P12/Ichikawa, Peer, PER0117, PER-255, PF-382, PFI-285, RPMI-8402, ST-4, SUP-T1 to T
- mature T-cell lines e
- Null leukemia cell lines including but not limited to REH, NALL-1, KM-3, L92-221, are a another commercially available source of immune cells, as are cell lines derived from other leukemias and lymphomas, such as K562 erythroleukemia, THP-1 monocytic leukemia, U937 lymphoma, HEL erythroleukemia, HL60 leukemia, HMC-1 leukemia, KG-1 leukemia, U266 myeloma.
- Non-limiting exemplary sources for such commercially available cell lines include the American Type Culture Collection, or ATCC, (http://www.atcc.org/) and the German Collection of Microorganisms and Cell Cultures (https://www.dsmz.de/).
- NK cell also known as natural killer cell, refers to a type of lymphocyte that originates in the bone marrow and play a critical role in the innate immune system. NK cells provide rapid immune responses against viral-infected cells, tumor cells or other stressed cell, even in the absence of antibodies and major
- NK cells may either be isolated or obtained from a commercially available source.
- NK cell lines include lines NK-92 (ATCC® CRL-2407TM), NK-92MI (ATCC® CRL-2408TM). Further examples include but are not limited to NK lines HANK1, KHYG-1, NKL, NK-YS, NOI-90, and YT.
- Non-limiting exemplary sources for such commercially available cell lines include the American Type Culture Collection, or ATCC, (http://www.atcc.org/) and the German Collection of Microorganisms and Cell Cultures (https://www.dsmz.de/).
- nucleic acid sequence and“polynucleotide” are used interchangeably to refer to a polymeric form of nucleotides of any length, either ribonucleotides or deoxyribonucleotides.
- this term includes, but is not limited to, single-, double-, or multi-stranded DNA or RNA, genomic DNA, cDNA, DNA-RNA hybrids, or a polymer comprising purine and pyrimidine bases or other natural, chemically or biochemically modified, non-natural, or derivatized nucleotide bases.
- nucleic acid sequences refers to a polynucleotide which is said to“encode” a polypeptide if, in its native state or when manipulated by methods well known to those skilled in the art, can be transcribed and/or translated to produce the mRNA for the polypeptide and/or a fragment thereof.
- the antisense strand is the complement of such a nucleic acid, and the encoding sequence can be deduced therefrom.
- the term“vector” refers to a nucleic acid construct deigned for transfer between different hosts, including but not limited to a plasmid, a virus, a cosmid, a phage, a BAC, a YAC, etc.
- plasmid vectors may be prepared from commercially available vectors.
- viral vectors may be produced from baculoviruses, retroviruses, adenoviruses, AAVs, etc. according to techniques known in the art.
- the viral vector is a lentiviral vector.
- promoter refers to any sequence that regulates the expression of a coding sequence, such as a gene. Promoters may be constitutive, inducible, repressible, or tissue-specific, for example.
- A“promoter” is a control sequence that is a region of a polynucleotide sequence at which initiation and rate of transcription are controlled. It may contain genetic elements at which regulatory proteins and molecules may bind such as RNA polymerase and other transcription factors.
- the term“isolated cell” generally refers to a cell that is substantially separated from other cells of a tissue.
- “Immune cells” includes, e.g., white blood cells (leukocytes) which are derived from hematopoietic stem cells (HSC) produced in the bone marrow, lymphocytes (T cells, B cells, natural killer (NK) cells) and myeloid-derived cells (neutrophil, eosinophil, basophil, monocyte, macrophage, dendritic cells).
- “T cell” includes all types of immune cells expressing CD3 including T-helper cells (CD4+ cells), cytotoxic T- cells (CD8+ cells), natural killer T-cells, T-regulatory cells (Treg) and gamma-delta T cells.
- A“cytotoxic cell” includes CD8+ T cells, natural-killer (NK) cells, and neutrophils, which cells are capable of mediating cytotoxicity responses.
- transduce or“transduction” as it is applied to the production of chimeric antigen receptor cells refers to the process whereby a foreign nucleotide sequence is introduced into a cell. In some embodiments, this transduction is done via a vector.
- autologous in reference to cells refers to cells that are isolated and infused back into the same subject (recipient or host).“Allogeneic” refers to non-autologous cells.
- An“ effective amount” or“efficacious amount” refers to the amount of an agent, or combined amounts of two or more agents, that, when administered for the treatment of a mammal or other subject, is sufficient to effect such treatment for the disease.
- The“effective amount” will vary depending on the agent(s), the disease and its severity and the age, weight, etc., of the subject to be treated.
- A“solid tumor” is an abnormal mass of tissue that usually does not contain cysts or liquid areas. Solid tumors can be benign or malignant. Different types of solid tumors are named for the type of cells that form them. Examples of solid tumors include sarcomas, carcinomas, and lymphomas.
- ovarian cancer refers to a type of cancer that forms in issues of the ovary, and has undergone a malignant transformation that makes the cells within the cancer pathological to the host organism with the ability to invade or spread to other parts of the body.
- the ovarian cancer herein comprises type I cancers of low histological grade and type II cancer of higher histological grade.
- the ovarian cancer includes but is not limited to epithelial carcinoma, serous carcinoma, clear-cell carcinoma, sex cord stromal tumor, germ ceil tumor, dysgerminoma, mixed tumors, secondary ovarian cancer, low malignant potential tumors,
- prostate cancer refers to a type of cancer that develops in the prostate, a gland in the male reproductive system.
- the prostate cancer herein includes but is not limited to adenocarcinoma, sarcomas, small cell carcinomas, neuroendocrine tumors, transitional cell carcinomas.
- compositions and methods include the recited elements, but do not exclude others.
- Consisting essentially of when used to define compositions and methods shall mean excluding other elements of any essential significance to the combination for the intended use.
- a composition consisting essentially of the elements as defined herein would not exclude trace contaminants from the isolation and purification method and pharmaceutically acceptable carriers, such as phosphate buffered saline, preservatives and the like.
- Consisting of shall mean excluding more than trace elements of other ingredients and substantial method steps for administering the compositions disclosed herein. Aspects defined by each of these transition terms are within the scope of the present disclosure.
- the term "detectable marker” refers to at least one marker capable of directly or indirectly, producing a detectable signal.
- a non-exhaustive list of this marker includes enzymes which produce a detectable signal, for example by colorimetry, fluorescence, luminescence, such as horseradish peroxidase, alkaline phosphatase, ⁇ - galactosidase, giucose-6-phosphate dehydrogenase, chromophores such as fluorescent, luminescent dyes, groups with electron density detected by electron microscopy or by their electrical property such as conductivity, amperometry, voltammetry, impedance, detectable groups, for example whose molecules are of sufficient size to induce detectable modifications in their physical and/or chemical properties, such detection may be accomplished by optical methods such as diffraction, surface plasmon resonance, surface variation , the contact angle change or physical methods such as atomic force spectroscopy, tunnel effect, or radioactive molecules such as 32 P, 35 S or 125
- the term“purification marker” refers to at least one marker useful for purification or identification.
- a non-exhaustive list of this marker includes His, lacZ, GST, maltose-binding protein, NusA, BCCP, c-myc, CaM, FLAG, GFP, YFP, cherry, thioredoxin, poly(NANP), V5, Snap, HA, chitin-binding protein, Softag 1, Softag 3,
- Suitable direct or indirect fluorescence marker comprise FLAG, GFP, YFP, RFP, dTomato, cherry, Cy3, Cy 5, Cy 5.5, Cy 7, DNP, AMCA, Biotin, Digoxigenin, Tamra, Texas Red, rhodamine, Alexa fluors, FITC, TRITC or any other fluorescent dye or hapten.
- polynucleotides are transcribed into mRNA and/or the process by which the transcribed mRNA is subsequently being translated into peptides, polypeptides, or proteins.
- expression may include splicing of the mRNA in a eukaryotic cell.
- the expression level of a gene may be determined by measuring the amount of mRNA or protein in a cell or tissue sample.
- the expression level of a gene from one sample may be directly compared to the expression level of that gene from a control or reference sample.
- the expression level of a gene from one sample may be directly compared to the expression level of that gene from the same sample following administration of a compound.
- Homology can be determined by comparing a position in each sequence which may be aligned for purposes of comparison. When a position in the compared sequence is occupied by the same base or amino acid, then the molecules are homologous at that position. A degree of homology between sequences is a function of the number of matching or homologous positions shared by the sequences.
- the alignment and the percent homology or sequence identity can be determined using software programs known in the art, for example those described in Current Protocols in Molecular Biology (Ausubel et al., eds.1987) Supplement 30, section 7.7.18, Table 7.7.1.
- default parameters are used for alignment.
- a preferred alignment program is BLAST, using default parameters.
- the terms also include sequences that have deletions and/or additions, as well as those that have substitutions.
- the preferred algorithms can account for gaps and the like.
- identity exists over a region that is at least about 25 amino acids or nucleotides in length, or more preferably over a region that is at least 50-100 amino acids or nucleotides in length.
- An“unrelated” or“non-homologous” sequence shares less than 40% identity, or alternatively less than 25% identity, with one of the sequences disclosed herein.
- first line or“second line” or“third line” refers to the order of treatment received by a patient.
- First line therapy regimens are treatments given first, whereas second or third line therapy are given after the first line therapy or after the second line therapy, respectively.
- the National Cancer Institute defines first line therapy as“the first treatment for a disease or condition.
- primary treatment can be surgery, chemotherapy, radiation therapy, or a combination of these therapies.
- First line therapy is also referred to those skilled in the art as“primary therapy and primary treatment.” See National Cancer Institute website at www.cancer.gov, last visited on May 1, 2008.
- a patient is given a subsequent chemotherapy regimen because the patient did not show a positive clinical or sub-clinical response to the first line therapy or the first line therapy has stopped.
- the term“equivalent” or“biological equivalent” of an antibody means the ability of the antibody to selectively bind its epitope protein or fragment thereof as measured by ELISA or other suitable methods.
- Biologically equivalent antibodies include, but are not limited to, those antibodies, peptides, antibody fragments, antibody variant, antibody derivative and antibody mimetics that bind to the same epitope as the reference antibody.
- an equivalent intends at least about 70% homology or identity, or at least 80 % homology or identity and alternatively, or at least about 85 %, or alternatively at least about 90 %, or alternatively at least about 95 %, or alternatively 98 % percent homology or identity and exhibits substantially equivalent biological activity to the reference protein, polypeptide or nucleic acid.
- an equivalent thereof is a polynucleotide that hybridizes under stringent conditions to the reference polynucleotide or its complement.
- a polynucleotide or polynucleotide region (or a polypeptide or polypeptide region) having a certain percentage (for example, 80%, 85%, 90%, or 95%) of“sequence identity” to another sequence means that, when aligned, that percentage of bases (or amino acids) are the same in comparing the two sequences.
- the alignment and the percent homology or sequence identity can be determined using software programs known in the art, for example those described in Current Protocols in Molecular Biology (Ausubel et al., eds.1987) Supplement 30, section 7.7.18, Table 7.7.1.
- default parameters are used for alignment.
- a preferred alignment program is BLAST, using default parameters.
- Hybridization refers to a reaction in which one or more polynucleotides react to form a complex that is stabilized via hydrogen bonding between the bases of the nucleotide residues.
- the hydrogen bonding may occur by Watson-Crick base pairing, Hoogstein binding, or in any other sequence-specific manner.
- the complex may comprise two strands forming a duplex structure, three or more strands forming a multi-stranded complex, a single self-hybridizing strand, or any combination of these.
- a hybridization reaction may constitute a step in a more extensive process, such as the initiation of a PCR reaction, or the enzymatic cleavage of a polynucleotide by a ribozyme.
- Examples of stringent hybridization conditions include: incubation temperatures of about 25°C to about 37°C; hybridization buffer concentrations of about 6x SSC to about 10x SSC; formamide concentrations of about 0% to about 25%; and wash solutions from about 4x SSC to about 8x SSC.
- Examples of moderate hybridization conditions include: incubation temperatures of about 40°C to about 50°C; buffer concentrations of about 9x SSC to about 2x SSC; formamide concentrations of about 30% to about 50%; and wash solutions of about 5x SSC to about 2x SSC.
- high stringency conditions include: incubation temperatures of about 55°C to about 68°C; buffer concentrations of about 1x SSC to about 0.1x SSC; formamide concentrations of about 55% to about 75%; and wash solutions of about 1x SSC, 0.1x SSC, or deionized water.
- hybridization incubation times are from 5 minutes to 24 hours, with 1, 2, or more washing steps, and wash incubation times are about 1, 2, or 15 minutes.
- SSC is 0.15 M NaCl and 15 mM citrate buffer. It is understood that equivalents of SSC using other buffer systems can be employed.
- A“normal cell corresponding to the tumor tissue type” refers to a normal cell from a same tissue type as the tumor tissue.
- a non-limiting example is a normal lung cell from a patient having lung tumor, or a normal colon cell from a patient having colon tumor.
- isolated refers to molecules or biologicals or cellular materials being substantially free from other materials.
- the term“isolated” refers to nucleic acid, such as DNA or RNA, or protein or polypeptide (e.g., an antibody or derivative thereof), or cell or cellular organelle, or tissue or organ, separated from other DNAs or RNAs, or proteins or polypeptides, or cells or cellular organelles, or tissues or organs, respectively, that are present in the natural source.
- the term“isolated” also refers to a nucleic acid or peptide that is substantially free of cellular material, viral material, or culture medium when produced by recombinant DNA techniques, or chemical precursors or other chemicals when chemically synthesized.
- an“isolated nucleic acid” is meant to include nucleic acid fragments which are not naturally occurring as fragments and would not be found in the natural state.
- isolated is also used herein to refer to polypeptides which are isolated from other cellular proteins and is meant to encompass both purified and recombinant polypeptides.
- isolated is also used herein to refer to cells or tissues that are isolated from other cells or tissues and is meant to encompass both cultured and engineered cells or tissues.
- the term“monoclonal antibody” refers to an antibody produced by a single clone of B-lymphocytes or by a cell into which the light and heavy chain genes of a single antibody have been transfected.
- Monoclonal antibodies are produced by methods known to those of skill in the art, for instance by making hybrid antibody-forming cells from a fusion of myeloma cells with immune spleen cells.
- Monoclonal antibodies include humanized monoclonal antibodies.
- amino acid refers to either natural and/or unnatural or synthetic amino acids, including glycine and both the D and L optical isomers, amino acid analogs and peptidomimetics.
- polynucleotide and“oligonucleotide” are used interchangeably and refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides or analogs thereof. Polynucleotides can have any three-dimensional structure and may perform any function, known or unknown.
- polynucleotides a gene or gene fragment (for example, a probe, primer, EST or SAGE tag), exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, RNAi, ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes and primers.
- a polynucleotide can comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs.
- modifications to the nucleotide structure can be imparted before or after assembly of the polynucleotide.
- the sequence of nucleotides can be interrupted by non-nucleotide components.
- a polynucleotide can be further modified after polymerization, such as by conjugation with a labeling component.
- the term also refers to both double- and single-stranded molecules. Unless otherwise specified or required, any aspect of this technology that is a polynucleotide encompasses both the double-stranded form and each of two complementary single-stranded forms known or predicted to make up the double-stranded form.
- a purified nucleic acid, peptide, protein, biological complexes or other active compound is one that is isolated in whole or in part from proteins or other contaminants.
- substantially purified peptides, proteins, biological complexes, or other active compounds for use within the disclosure comprise more than 80% of all macromolecular species present in a preparation prior to admixture or formulation of the peptide, protein, biological complex or other active compound with a pharmaceutical carrier, excipient, buffer, absorption enhancing agent, stabilizer, preservative, adjuvant or other co-ingredient in a complete pharmaceutical formulation for therapeutic administration. More typically, the peptide, protein, biological complex or other active compound is purified to represent greater than 90%, often greater than 95% of all
- the term“specific binding” means the contact between an antibody and an antigen with a binding affinity of at least 10 -6 M. In certain aspects, antibodies bind with affinities of at least about 10 -7 M, and preferably 10 -8 M, 10 -9 M, 10 -10 M, 10 -11 M, or 10 -12 M.
- recombinant protein refers to a polypeptide which is produced by recombinant DNA techniques, wherein generally, DNA encoding the polypeptide is inserted into a suitable expression vector which is in turn used to transform a host cell to produce the heterologous protein.
- “treating” or“treatment” of a disease in a subject refers to (1) preventing the symptoms or disease from occurring in a subject that is predisposed or does not yet display symptoms of the disease; (2) inhibiting the disease or arresting its development; or (3) ameliorating or causing regression of the disease or the symptoms of the disease.
- “treatment” is an approach for obtaining beneficial or desired results, including clinical results.
- beneficial or desired results can include one or more, but are not limited to, alleviation or amelioration of one or more symptoms, diminishment of extent of a condition (including a disease), stabilized (i.e., not worsening) state of a condition (including disease), delay or slowing of condition (including disease), progression, amelioration or palliation of the condition (including disease), states and remission (whether partial or total), whether detectable or undetectable.
- the term "overexpress" with respect to a cell, a tissue, or an organ expresses a protein to an amount that is greater than the amount that is produced in a control cell, a control issue, or an organ.
- a protein that is overexpressed may be endogenous to the host cell or exogenous to the host cell.
- linker sequence relates to any amino acid sequence comprising from 1 to 10, or alternatively, 8 amino acids, or alternatively 6 amino acids, or alternatively 5 amino acids that may be repeated from 1 to 10, or alternatively to about 8, or alternatively to about 6, or alternatively about 5, or 4 or alternatively 3, or alternatively 2 times.
- the linker may comprise up to 15 amino acid residues consisting of a pentapeptide repeated three times.
- the linker sequence is a (Glycine4Serine)3 flexible polypeptide linker comprising three copies of gly-gly-gly-gly-ser.
- the term“enhancer”, as used herein, denotes sequence elements that augment, improve or ameliorate transcription of a nucleic acid sequence irrespective of its location and orientation in relation to the nucleic acid sequence to be expressed.
- An enhancer may enhance transcription from a single promoter or simultaneously from more than one promoter. As long as this functionality of improving transcription is retained or substantially retained (e.g., at least 70%, at least 80%, at least 90% or at least 95% of wild- type activity, that is, activity of a full-length sequence), any truncated, mutated or otherwise modified variants of a wild-type enhancer sequence are also within the above definition.
- WPRE Woodchuck Hepatitis Virus
- HTP Woodchuck Hepatitis Virus
- CAR chimeric antigen receptor
- HLA histocompatibility lymphocyte antigen
- Ip intraperitoneal IRES: internal ribosomal entry site
- PBMC peripheral blood mononuclear cells
- PBS phosphate buffered saline
- WPRE woodchuck hepatitis virus post-transcriptional regulatory element
- CAR T-cells are genetically engineered autologous T-cells in which single chain antibody fragments (scFv) or ligands are attached to the T-cell signaling domain capable of facilitating T-cell activation (Maher, J. (2012) ISRN Oncol.2012:278093; Curran, K.J. et al. (2012) J. Gene Med.14:405-415; Fedorov, V.D. et al. (2014) Cancer J.20:160-165; Barrett, D.M. et al. (2014) Annu. Rev. Med.65:333-347).
- CARs combine HLA-independent targeting specificity of a monoclonal antibody with the cytolytic activity and homing properties of activated T-cells.
- LHR is a potent target for CAR T-cell therapy.
- flow cytometric studies utilizing 9 well established human ovarian cell lines showed LHR to be an excellent target compared to mesothelin and MUC16, which were only positive on half or less of the cell lines tested.
- These targets were also tested on a multi-block slide of human ovarian cancers by immunohistochemistry as shown in Table 2. Consistent with the flow cytometric results, LHR positivity was more consistently seen than mesothelin and MUC16 positivity by these methods regardless of the stage or grade of tumor tested. As shown in FIG.2, the immunohistochemical staining patterns were somewhat different with each antibody.
- An immunoglobulin monomer comprises two heavy chains and two light chains connected by disulfide bonds. Each heavy chain is paired with one of the light chains to which it is directly bound via a disulfide bond. Each heavy chain comprises a constant region (which varies depending on the isotype of the antibody) and a variable region.
- the variable region comprises three hypervariable regions (or complementarity determining regions) which are designated CDRH1, CDRH2 and CDRH3 and which are supported within framework regions.
- Each light chain comprises a constant region and a variable region, with the variable region comprising three hypervariable regions (designated CDRL1, CDRL2 and CDRL3) supported by framework regions in an analogous manner to the variable region of the heavy chain.
- the hypervariable regions of each pair of heavy and light chains mutually cooperate to provide an antigen binding site that is capable of binding a target antigen.
- the binding specificity of a pair of heavy and light chains is defined by the sequence of CDR1, CDR2 and CDR3 of the heavy and light chains.
- the disclosure provides an isolated antibody comprising a heavy chain (HC) immunoglobulin variable domain sequence and a light chain (LC)
- LHR luteinizing hormone receptor
- the HC of the antibody comprises or alternatively consists essentially of, or yet further consists of one or more of a CDR1 comprising the amino acid sequence of GYSITSGYG (SEQ ID NO.: 16) or an equivalent of each thereof; and/or a CDR2 comprising the amino acid sequence of IHYSGST (SEQ ID NO.: 19) or an equivalent of each thereof; and/or a CDR3 comprising the amino acid sequence of ARSLRY (SEQ ID NO.: 22) or an equivalent of each thereof; and/or the LC comprises the antibody of comprises or
- CDR1 comprising the amino acid sequence of SSVNY (SEQ ID NO.:25) or an equivalent of each thereof; and/or a CDR2 comprising the amino acid sequence of DTS (SEQ ID NO:28) or an equivalent of each thereof; and/or a CDR3 comprising the amino acid sequence of HQWSSYPYT (SEQ ID NO:31) or an equivalent of each thereof.
- the antibody comprises a HC that comprises, or alternatively consists essentially of, or yet further consists of a one or more of: a CDR1 comprising the amino acid sequence of GFSLTTYG (SEQ ID NO.: 17) or an equivalent of each thereof; and/or a CDR2 comprising the amino acid sequence of IWGDGST (SEQ ID NO.: 20) or an equivalent of each thereof; and/or a CDR3 comprising the amino acid sequence of AEGSSLFAY (SEQ ID NO.: 23) or an equivalent of each thereof; and/or the LC of the antibody comprises, or alternatively consists essentially of, or yet further consists of a CDR1 comprising the amino acid sequence of QSLLNSGNQKNY (SEQ ID NO.:26) or an equivalent of each thereof; and/or a CDR2 comprising the amino acid sequence of WAS (SEQ ID NO:29) or an equivalent of each thereof; and/or a CDR3 comprising the amino acid sequence of
- the HC of the antibody comprises, or alternatively consists essentially of, or yet further consists of one or more of: a CDR1 comprising the amino acid sequence of GYSFTGYY (SEQ ID NO.: 18) or an equivalent of each thereof; and/or a CDR2 comprising the amino acid sequence of IYPYNGVS (SEQ ID NO.: 21) or an equivalent of each thereof; and/or a CDR3 comprising the amino acid sequence of ARERGLYQLRAMDY (SEQ ID NO.: 24) or an equivalent of each thereof; and/or the LC of the antibody comprises, or alternatively consists essentially of, or yet further consists of a CDR1 comprising the amino acid sequence of QSISNN (SEQ ID NO.:27) or an equivalent of each thereof; and/or a CDR2 comprising the amino acid sequence of NAS (SEQ ID NO:30) or an equivalent of each thereof; and/or a CDR3 comprising the amino acid sequence of QQSNSWP
- the disclosure provides an isolated anti-LHR antibody which is generated against a LHR fragment.
- the LHR fragment is part of LHR G protein with the following amino acid sequence (SEQ ID NO: 42):
- the LHR fragment is the N-terminal of LHR protein with the following amino acid sequence (SEQ ID NO: 43): RALREALCPEPCNCVPDGALRCPGPTAGLTRLSLAYLPVKVIPSQAFRGLNEVIKIEIS QIDSLERIEANAFDNLLNLSEILIQNTKNLRYIEPGAFINLPRLKYLSICNTGIRKFPDVT KVFSSESNFILEICDNLHITTIPGNAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLTS LELKENVHLEKMHNGAFRGATGPKTLDISSTKLQALPSYGLESIQRLIATSSYSLKKL PSRETFVNLLEATLTYPS.
- the antibody is a monoclonal antibody comprising an anti- LHR heavy chain variable region comprising, or alternatively consisting essentially of, or yet further consisting of a polypeptide selected from SEQ ID NOs.:1-4 or an equivalent of each thereof, and an anti-LHR light chain variable region comprising, or alternatively consisting essentially of, or yet further consisting of a polypeptide selected from SEQ ID NOs.:5-8 or an equivalent of each thereof.
- the antibody is a chimeric antibody or a humanized antibody.
- the heavy chain variable region comprises, or alternatively consists essentially of, or yet further consists of a polypeptide with a consensus sequence selected from SEQ ID NOs: 9-11
- an anti-LHR light chain variable region comprises, or alternatively consists essentially of, or yet further consists of a polypeptide with a consensus sequence selected from SEQ ID NOs.:12-15.
- the disclosure provides an isolated nucleic acid encoding the isolated anti-LHR antibody.
- the isolated nucleic acid comprising, or alternatively consisting essentially of, or yet further consisting of a nucleic acid sequence selected from SEQ ID NOs.:16-23 of an equivalent of each therefore.
- the HC of the antibody comprises or alternatively consists essentially of, or yet further consists of one or more of: a CDR1 comprising the amino acid sequence of GYSITSGYG (SEQ ID NO.: 16) or an equivalent of each thereof; and/or a CDR2 comprising the amino acid sequence of IHYSGST (SEQ ID NO.: 19) or an equivalent of each thereof; and/or a CDR3 comprising the amino acid sequence of ARSLRY (SEQ ID NO.: 22) or an equivalent of each thereof, followed by an additional 50 amino acids, or alternatively about 40 amino acids, or alternatively about 30 amino acids, or alternatively about 20 amino acids, or alternatively about 10 amino acids, or alternatively about 5 amino acids, or alternatively about 4, or 3, or 2 or 1 amino acids at the carboxy-terminus.
- a CDR1 comprising the amino acid sequence of GYSITSGYG (SEQ ID NO.: 16) or an equivalent of each thereof
- a CDR2 comprising the amino acid sequence of IHYSGST
- the light chain variable regions of the antibodies comprises or alternatively consists essentially of, or yet further consists of one or more of: a CDR1 comprising the amino acid sequence of SSVNY (SEQ ID NO.:25) or an equivalent of each thereof; and/or a CDR2 comprising the amino acid sequence of DTS (SEQ ID NO:28) or an equivalent of each thereof; and/or a CDR3 comprising the amino acid sequence of
- HQWSSYPYT (SEQ ID NO:31) or an equivalent of each thereof, followed by an additional 50 amino acids, or alternatively about 40 amino acids, or alternatively about 30 amino acids, or alternatively about 20 amino acids, or alternatively about 10 amino acids, or alternatively about 5 amino acids, or alternatively about 4, or 3, or 2 or 1 amino acids at the carboxy- terminus.
- the HC of the antibody comprises, or alternatively consists essentially of, or yet further consists of one or more of a CDR1 comprising the amino acid sequence of GFSLTTYG (SEQ ID NO.: 17) or an equivalent of each thereof; and/or a CDR2 comprising the amino acid sequence of IWGDGST (SEQ ID NO.: 20) or an equivalent of each thereof; and/or a CDR3 comprising the amino acid sequence of AEGSSLFAY (SEQ ID NO.: 23) or an equivalent of each thereof; and/or the LC of the antibody comprises, or alternatively consists essentially of, or yet further consists of a CDR1 comprising the amino acid sequence of QSLLNSGNQKNY (SEQ ID NO.:26) or an equivalent of each thereof; and/or a CDR2 comprising the amino acid sequence of WAS (SEQ ID NO:29) or an equivalent of each thereof; and/or a CDR3 comprising the amino acid sequence of QNDYSYPLT
- the HC of the antibody comprises, or alternatively consists essentially of, or yet further consists of one or more of: a CDR1 comprising the amino acid sequence of GYSFTGYY (SEQ ID NO.: 18) or an equivalent of each thereof; and/or a CDR2 comprising the amino acid sequence of IYPYNGVS (SEQ ID NO.: 21) or an equivalent of each thereof; and/or a CDR3 comprising the amino acid sequence of ARERGLYQLRAMDY (SEQ ID NO.: 24) or an equivalent of each thereof; and/or the LC of the antibody comprises, or alternatively consists essentially of, or yet further consists of a CDR1 comprising the amino acid sequence of QSISNN (SEQ ID NO.:27) or an equivalent of each thereof; and/or a CDR2 comprising the amino acid sequence of NAS (SEQ ID NO:30) or an equivalent of each thereof; and/or a CDR3 comprising the amino acid sequence of QQSNSWP
- the disclosure provides an isolated anti-LHR antibody which is generated against a LHR fragment.
- the LHR fragment against which the antibody is raised is part of LHR protein with the following amino acid sequence (SEQ ID NO: 42):
- the LHR fragment is the N-terminal of LHR protein with the following amino acid sequence (SEQ ID NO: 43):
- the antibody is a monoclonal antibody comprising an anti- LHR heavy chain variable region comprising, or alternatively consisting essentially of, or yet further consisting of a polypeptide selected from SEQ ID NOs.:1-4 or an equivalent of each thereof.
- the antibody is a monoclonal antibody comprising an anti- LHR light chain variable region comprising, or alternatively consisting essentially of, or yet further consisting of a polypeptide selected from SEQ ID NOs.:5-8 or an equivalent of each thereof.
- the anti-LHR antibody is a chimeric antibody, human or a humanized antibody.
- the heavy chain variable region comprises, or alternatively consists essentially of, or yet further consists of a polypeptide with a consensus sequence selected from SEQ ID NOs: 9-11
- an anti-LHR light chain variable region comprises, or alternatively consists essentially of, or yet further consists of a polypeptide with a consensus sequence selected from SEQ ID NOs.:12-15, or equivalents of each thereof.
- the isolated antibody includes one or more of the following characteristics:
- the light chain immunoglobulin variable domain sequence comprises one or more CDRs that are at least 85% identical to a CDR of a light chain variable domain of any of the disclosed light chain sequences;
- the heavy chain immunoglobulin variable domain sequence comprises one or more CDRs that are at least 85% identical to a CDR of a heavy chain variable domain of any of the disclosed heavy chain sequences;
- the light chain immunoglobulin variable domain sequence is at least 85% identical to a light chain variable domain of any of the disclosed light chain sequences;
- the HC immunoglobulin variable domain sequence is at least 85% identical to a heavy chain variable domain of any of the disclosed light chain sequences;
- the antibody binds an epitope that overlaps with an epitope bound by any of the disclosed sequences.
- the present disclosure provides an isolated antibody that is at least 85% identical to the anti-LHR antibodies, e.g., 5F4-21, 4A7-4, 8B7-3 or 138-2, as disclosed herein.
- the antibody binds human LHR with a dissociation constant (K D ) of less than 10 -4 M, 10 -5 M, 10 -6 M, 10 -7 M, 10 -8 M, 10 -9 M, 10 -10 M, 10 -11 M, or 10 -12 M.
- K D dissociation constant
- the antigen binding site specifically binds to human LHR.
- the antibody is soluble Fab.
- the HC and LC variable domain sequences are components of the same polypeptide chain. In some of the aspects of the antibodies provided herein, the HC and LC variable domain sequences are components of different polypeptide chains. [0135] In some of the aspects of the antibodies provided herein, the antibody is a full-length antibody. In other aspect, antigen binding fragments of the antibodies are provided.
- the antibody is a monoclonal antibody.
- the antibody is chimeric or humanized.
- the antibody fragment is selected from the group consisting of Fab, F(ab)'2, Fab’, scF v , and F v .
- one or more amino acid residues in a CDR of the antibodies provided herein are substituted with another amino acid.
- the substitution may be
- “conservative” in the sense of being a substitution within the same family of amino acids.
- the naturally occurring amino acids may be divided into the following four families and conservative substitutions will take place within those families:
- Amino acids with basic side chains lysine, arginine, histidine;
- Amino acids with acidic side chains aspartic acid, glutamic acid;
- Amino acids with nonpolar side chains glycine, alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan, cysteine.
- one or more amino acid residues are added to or deleted from one or more CDRs of an antibody. Such additions or deletions occur at the N or C termini of the CDR or at a position within the CDR.
- antibodies of the present disclosure comprising such varied CDR sequences still bind LHR with similar specificity and sensitivity profiles as the disclosed antibodies. This may be tested by way of the binding assays.
- the constant regions of antibodies may also be varied.
- antibodies may be provided with Fc regions of any isotype: IgA (IgA1, IgA2), IgD, IgE, IgG (IgG1, IgG2, IgG3, IgG4) or IgM.
- constant region sequences include:
- the antibody contains structural modifications to facilitate rapid binding and cell uptake and/or slow release.
- the LHR antibody contains a deletion in the CH2 constant heavy chain region of the antibody to facilitate rapid binding and cell uptake and/or slow release.
- a Fab fragment is used to facilitate rapid binding and cell uptake and/or slow release.
- a F(ab)'2 fragment is used to facilitate rapid binding and cell uptake and/or slow release.
- the antibodies, fragments, and equivalents thereof can be combined with a carrier, e.g., a pharmaceutically acceptable carrier or other agents to provide a formulation for use and/or storage.
- a carrier e.g., a pharmaceutically acceptable carrier or other agents to provide a formulation for use and/or storage.
- isolated polypeptide comprising, or alternatively consisting essentially of, or yet further consisting of, the amino acid sequence of LHR or a fragment thereof, that are useful to generate antibodies that bind to LHR, as well as isolated
- the isolated polypeptides or polynucleotides further comprise a label and/or contiguous polypeptide sequences (e.g., keyhole limpet haemocyanin (KLH) carrier protein) or in the case of polynucleotides, polynucleotides encoding the sequence, operatively coupled to polypeptide or polynucleotide.
- KLH keyhole limpet haemocyanin
- the polypeptides or polynucleotides can be combined with various carriers, e.g., phosphate buffered saline.
- host cells e.g., prokaryotic or eukaryotic cells, e.g., bacteria, yeast, mammalian (rat, simian, hamster, or human), comprising the isolated polypeptides or polynucleotides.
- the host cells can be combined with a carrier.
- nucleic acids encoding the antibodies and fragments thereof as disclosed herein. They can be combined with a vector or appropriate host cell, and /or a suitable carrier for diagnostic or therapeutic use.
- the nucleic acids are contained with a host cell for recombinant production of polypeptides and proteins.
- the host cells can be eukaryotic or prokaryotic.
- Antibodies their manufacture and uses are well known and disclosed in, for example, Harlow, E. and Lane, D., Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1999.
- the antibodies may be generated using standard methods known in the art. Examples of antibodies include (but are not limited to) monoclonal, single chain, and functional fragments of antibodies.
- Antibodies may be produced in a range of hosts, for example goats, rabbits, rats, mice, humans, and others. They may be immunized by injection with a target antigen or a fragment or oligopeptide thereof which has immunogenic properties, such as a C-terminal fragment of LHR or an isolated polypeptide.
- a target antigen or a fragment or oligopeptide thereof which has immunogenic properties such as a C-terminal fragment of LHR or an isolated polypeptide.
- various adjuvants may be added and used to increase an immunological response.
- adjuvants include, but are not limited to, Freund's, mineral gels such as aluminum hydroxide, and surface active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanin, and dinitrophenol.
- BCG Bacille Calmette-Guerin
- Corynebacterium parvum are particularly useful. This this disclosure also provides
- the antibodies of the present disclosure are polyclonal, i.e., a mixture of plural types of anti-LHR antibodies having different amino acid sequences.
- the polyclonal antibody comprises a mixture of plural types of anti-LHR antibodies having different CDRs.
- Monoclonal antibodies to LHR may be prepared using any technique which provides for the production of antibody molecules by continuous cell lines in culture. Such techniques include, but are not limited to, the hybridoma technique (see, e.g., Kohler & Milstein, Nature 256: 495-497 (1975)); the trioma technique; the human B-cell hybridoma technique (see, e.g., Kozbor, et al., Immunol. Today 4: 72 (1983)) and the EBV hybridoma technique to produce human monoclonal antibodies (see, e.g., Cole, et al., in: MONOCLONAL ANTIBODIES AND CANCER THERAPY, Alan R.
- Human monoclonal antibodies can be utilized in the practice of the present technology and can be produced by using human hybridomas (see, e.g., Cote, et al., Proc. Natl. Acad. Sci.80: 2026-2030 (1983)) or by transforming human B-cells with Epstein Barr Virus in vitro (see, e.g., Cole, et al., in: MONOCLONAL ANTIBODIES AND CANCER THERAPY, Alan R. Liss, Inc., pp.77-96 (1985)). For example, a population of nucleic acids that encode regions of antibodies can be isolated.
- PCR utilizing primers derived from sequences encoding conserved regions of antibodies is used to amplify sequences encoding portions of antibodies from the population and then reconstruct DNAs encoding antibodies or fragments thereof, such as variable domains, from the amplified sequences.
- Such amplified sequences also can be fused to DNAs encoding other proteins—e.g., a bacteriophage coat, or a bacterial cell surface protein—for expression and display of the fusion polypeptides on phage or bacteria.
- Amplified sequences can then be expressed and further selected or isolated based, e.g., on the affinity of the expressed antibody or fragment thereof for an antigen or epitope present on the LHR polypeptide.
- hybridomas expressing anti- LHR monoclonal antibodies can be prepared by immunizing a subject, e.g., with an isolated polypeptide comprising, or alternatively consisting essentially of, or yet further consisting of, the amino acid sequence of LHR or a fragment thereof, and then isolating hybridomas from the subject's spleen using routine methods. See, e.g., Milstein et al., (Galfre and Milstein, Methods Enzymol 73: 3-46 (1981)). Screening the hybridomas using standard methods will produce monoclonal antibodies of varying specificity (i.e., for different epitopes) and affinity.
- a selected monoclonal antibody with the desired properties can be (i) used as expressed by the hybridoma, (ii) bound to a molecule such as polyethylene glycol (PEG) to alter its properties, or (iii) a cDNA encoding the monoclonal antibody can be isolated, sequenced and manipulated in various ways.
- the anti- LHR monoclonal antibody is produced by a hybridoma which includes a B cell obtained from a transgenic non-human animal, e.g., a transgenic mouse, having a genome comprising a human heavy chain transgene and a light chain transgene fused to an immortalized cell.
- Hybridoma techniques include those known in the art and taught in Harlow et al., Antibodies: A Laboratory Manual Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y., 349 (1988); Hammerling et al Monoclonal Antibodies And T-Cell Hybridomas 563-681 (1981) [0161] Phage Display Technique.
- the antibodies of the present disclosure can be produced through the application of recombinant DNA and phage display technology.
- anti-LHR antibodies can be prepared using various phage display methods known in the art. In phage display methods, functional antibody domains are displayed on the surface of a phage particle which carries polynucleotide sequences encoding them.
- Phage with a desired binding property are selected from a repertoire or combinatorial antibody library (e.g., human or murine) by selecting directly with an antigen, typically an antigen bound or captured to a solid surface or bead. Phage used in these methods are typically filamentous phage including fd and M13 with Fab, F v or disulfide stabilized F v antibody domains are recombinantly fused to either the phage gene III or gene VIII protein.
- a repertoire or combinatorial antibody library e.g., human or murine
- Fab expression libraries see, e.g., Huse, et al., Science 246: 1275-1281, 1989
- methods can be adapted for the construction of Fab expression libraries (see, e.g., Huse, et al., Science 246: 1275-1281, 1989) to allow rapid and effective identification of monoclonal Fab fragments with the desired specificity for a LHR polypeptide, e.g., a polypeptide or derivatives, fragments, analogs or homologs thereof.
- Other examples of phage display methods that can be used to make the isolated antibodies of the present disclosure include those disclosed in Huston et al., Proc. Natl. Acad. Sci. U.S.A., 85: 5879- 5883 (1988); Chaudhary et al., Proc. Natl. Acad. Sci. U.S.A., 87: 1066-1070 (1990);
- hybrid antibodies or hybrid antibody fragments that are cloned into a display vector can be selected against the appropriate antigen in order to identify variants that maintained good binding activity, because the antibody or antibody fragment will be present on the surface of the phage or phagemid particle.
- a display vector can be selected against the appropriate antigen in order to identify variants that maintained good binding activity, because the antibody or antibody fragment will be present on the surface of the phage or phagemid particle.
- Other vector formats could be used for this process, such as cloning the antibody fragment library into a lytic phage vector (modified T7 or Lambda Zap systems) for selection and/or screening.
- Antibodies may also be produced by inducing in vivo production in the lymphocyte population or by screening recombinant immunoglobulin libraries or panels of highly specific binding reagents (Orlandi et al., PNAS 86: 3833-3837 (1989); Winter, G. et al. Nature, 349: 293-299 (1991)).
- Single chain antibodies comprise a heavy chain variable region and a light chain variable region connected with a linker peptide (typically around 5 to 25 amino acids in length).
- linker peptide typically around 5 to 25 amino acids in length.
- the variable regions of the heavy chain and the light chain may be derived from the same antibody or different antibodies.
- scF v s may be synthesized using recombinant techniques, for example by expression of a vector encoding the scF v in a host organism such as E. coli.
- DNA encoding scF v can be obtained by performing amplification using a partial DNA encoding the entire or a desired amino acid sequence of a DNA selected from a DNA encoding the heavy chain or the variable region of the heavy chain of the above- mentioned antibody and a DNA encoding the light chain or the variable region of the light chain thereof as a template, by PGR using a primer pair that defines both ends thereof, and further performing amplification combining a DNA encoding a polypeptide linker portion and a primer pair that defines both ends thereof, so as to ligate both ends of the linker to the heavy chain and the light chain, respectively.
- An expression vector containing the DNA encoding scF v and a host transformed by the expression vector can be obtained according to conventional methods known in the art.
- Antigen binding fragments may also be generated, for example the F(ab') 2 fragments which can be produced by pepsin digestion of the antibody molecule and the Fab fragments which can be generated by reducing the disulfide bridges of the F(ab') 2 fragments.
- Fab expression libraries may be constructed to allow rapid and easy
- the antibodies of the present disclosure may be any antibodies of the present disclosure.
- the antibody to be multimerized may be one type of antibody or a plurality of antibodies which recognize a plurality of epitopes of the same antigen.
- binding of the IgG CH3 domain to two scF v molecules, binding to streptavidin, introduction of a helix-turn-helix motif and the like can be exemplified.
- the antibody compositions disclosed herein may be in the form of a conjugate formed between any of these antibodies and another agent (immunoconjugate).
- the antibodies disclosed herein are conjugated to radioactive material.
- the antibodies disclosed herein can be bound to various types of molecules such as polyethylene glycol (PEG).
- V arious immunoassays may be used for screening to identify antibodies having the desired specificity. Numerous protocols for competitive binding or immunoradiometric assays using either polyclonal or monoclonal antibodies with established specificities are well known in the art. Such immunoassays typically involve the following steps:
- LHR complex formation between LHR, or any fragment or oligopeptide thereof and its specifi c antibody.
- a two-site, monoclonal -based immunoassay utilizing monoclonal antibodies specific to two non-interfering LHR epitopes may be used, but a competitive binding assay may also be employed (Maddox et at, J. Exp. Med., 158: 121 1-1216 (1983)).
- IHC immunohistochemistry screening of potential anti-LHR antibodies
- VMSI Ventana Medical Systems, Inc
- VMSI Ventana Medical Systems, Inc
- Stained slides are manually screened under a microscope. Samples having a correct primary antibody staining pattern are selected as potential anti-LHR candidates.
- Antibody Purification The antibodies disclosed herein can be purified to homogeneity. The separation and purification of the antibodies can be performed by employing conventional protein separation and purification methods.
- the antibody can be separated and purified by
- chromatography examples include affinity chromatography, ion exchange chromatography, hydrophobic chromatography, gel filtration chromatography, reverse phase chromatography, and adsorption chromatography.
- chromatography can be performed by employing liquid chromatography such as HPLC or FPLC.
- a Protein A column or a Protein G column may be used in affinity chromatography.
- Other exemplary columns include a Protein A column, Hyper D, POROS, Sepharose F. F. (Pharmacia) and the like.
- the antibodies disclosed herein are useful in methods known in the art relating to the localization and/or quantitation of a LHR polypeptide (e.g., for use in measuring levels of the LHR polypeptide within appropriate physiological samples, for use in diagnostic methods, for use in imaging the polypeptide, and the like).
- the antibodies disclosed herein are useful in isolating a LHR polypeptide by standard techniques, such as affinity chromatography or immunoprecipitation.
- a LHR antibody disclosed herein can facilitate the purification of natural LHR polypeptides from biological samples, e.g., mammalian sera or cells as well as recombinantly-produced LHR polypeptides expressed in a host system.
- LHR antibody can be used to detect a LHR polypeptide (e.g., in plasma, a cellular lysate or cell supernatant) in order to evaluate the abundance and pattern of expression of the polypeptide.
- LHR antibodies disclosed herein can be used
- LHR levels in tissue as part of a clinical testing procedure, e.g., to determine the efficacy of a given treatment regimen.
- the detection can be facilitated by coupling (i.e., physically linking) the LHR antibodies disclosed herein to a detectable substance.
- compositions comprising an antibody or antigen binding fragment as disclosed herein bound to a peptide comprising, for example, a human LHR protein or a fragment thereof.
- the peptide is associated with a cell.
- the composition may comprise a disaggregated cell sample labeled with an antibody or antibody fragment as disclosed herein, which composition is useful in, for example, affinity chromatography methods for isolating cells or for flow cytometry-based cellular analysis or cell sorting.
- the composition may comprise a fixed tissue sample or cell smear labeled with an antibody or antibody fragment as disclosed herein, which composition is useful in, for example, immunohistochemistry or cytology analysis.
- the antibody or the antibody fragment is bound to a solid support, which is useful in, for example: ELISAs; affinity chromatography or immunoprecipitation methods for isolating LHR proteins or fragments thereof, LHR-positive cells, or complexes containing LHR and other cellular components.
- the peptide is bound to a solid support.
- the peptide may be bound to the solid support via a secondary antibody specific for the peptide, which is useful in, for example, sandwich ELISAs.
- the peptide may be bound to a chromatography column, which is useful in, for example, isolation or purification of antibodies according to the present technology.
- the peptide is disposed in a solution, such as a lysis solution or a solution containing a sub-cellular fraction of a fractionated cell, which is useful in, for example, ELISAs and affinity chromatography or immunoprecipitation methods of isolating LHR proteins or fragments thereof or complexes containing LHR and other cellular components.
- a solution such as a lysis solution or a solution containing a sub-cellular fraction of a fractionated cell
- the peptide is associated with a matrix, such as, for example, a gel electrophoresis gel or a matrix commonly used for western blotting (such as membranes made of nitrocellulose or polyvinylidene difluoride), which compositions are useful for electrophoretic and/or immunoblotting techniques, such as Western blotting.
- An exemplary method for detecting the level of LHR polypeptides in a biological sample involves obtaining a biological sample from a subject and contacting the biological sample with a LHR antibody disclosed herein which is capable of detecting the LHR polypeptides.
- the LHR antibodies 5F4-21, 4A7-4, 8B7-3 ,or 138-2, or fragments thereof are detectably labeled.
- the term“labeled”, with regard to the antibody is intended to encompass direct labeling of the antibody by coupling (i.e., physically linking) a detectable substance to the antibody, as well as indirect labeling of the antibody by reactivity with another compound that is directly labeled.
- Non-limiting examples of indirect labeling include detection of a primary antibody using a fluorescently-labeled secondary antibody and end-labeling of a DNA probe with biotin such that it can be detected with fluorescently- labeled streptavidin.
- the detection method of the present disclosure can be used to detect expression levels of LHR polypeptides in a biological sample in vitro as well as in vivo.
- In vitro techniques for detection of LHR polypeptides include enzyme linked immunosorbent assays (ELISAs), Western blots, flow cytometry, immunoprecipitations, radioimmunoassay, and immunofluorescence (e.g., IHC).
- ELISAs enzyme linked immunosorbent assays
- Western blots e.g., Western blots
- flow cytometry e.g., flow cytometry
- immunoprecipitations e.g., radioimmunoassay
- immunofluorescence e.g., IHC
- in vivo techniques for detection of LHR polypeptides include introducing into a subject a labeled anti-LHR antibody.
- the antibody can be labeled with a radioactive marker whose presence and location in a subject can be detected by standard imaging techniques
- a LHR antibody disclosed herein can be used to assay LHR polypeptide levels in a biological sample (e.g. human plasma) using antibody-based techniques.
- protein expression in tissues can be studied with classical immunohistochemical (IHC) staining methods.
- IHC immunohistochemical
- Other antibody-based methods useful for detecting protein gene expression include immunoassays, such as the enzyme linked immunosorbent assay (ELISA) and the radioimmunoassay (RIA).
- ELISA enzyme linked immunosorbent assay
- RIA radioimmunoassay
- Suitable antibody assay labels are known in the art and include enzyme labels, such as, glucose oxidase, and radioisotopes or other radioactive agents, such as iodine ( 125 I, 121 I, 131 I), carbon ( 14 C), sulfur ( 35 S), tritium ( 3 H), indium ( 112 In), and technetium ( 99 mTc), and fluorescent labels, such as fluorescein and rhodamine, and biotin.
- enzyme labels such as, glucose oxidase, and radioisotopes or other radioactive agents, such as iodine ( 125 I, 121 I, 131 I), carbon ( 14 C), sulfur ( 35 S), tritium ( 3 H), indium ( 112 In), and technetium ( 99 mTc)
- fluorescent labels such as fluorescein and rhodamine, and biotin.
- LHR polypeptide levels can also be detected in vivo by imaging.
- Labels that can be incorporated with anti- LHR antibodies for in vivo imaging of LHR polypeptide levels include those detectable by X-radiography, NMR or ESR.
- suitable labels include radioisotopes such as barium or cesium, which emit detectable radiation but are not overtly harmful to the subject.
- Suitable markers for NMR and ESR include those with a detectable characteristic spin, such as deuterium, which can be incorporated into the LHR antibody by labeling of nutrients for the relevant scF v clone.
- a LHR antibody which has been labeled with an appropriate detectable imaging moiety such as a radioisotope (e.g., 131 I, 112 In, 99 mTc), a radio-opaque substance, or a material detectable by nuclear magnetic resonance, is introduced (e.g., parenterally, subcutaneously, or intraperitoneally) into the subject.
- a radioisotope e.g., 131 I, 112 In, 99 mTc
- a radio-opaque substance e.g., a radio-opaque substance, or a material detectable by nuclear magnetic resonance
- the quantity of imaging moiety needed to produce diagnostic images.
- the quantity of radioactivity injected will normally range from about 5 to 20 millicuries of 99 mTc.
- the labeled LHR antibody will then preferentially accumulate at the location of cells which contain the specific target polypeptide.
- tumor imaging is described in S. W. Burchiel et al., Tumor Imaging: The Radiochemical Detection of Cancer 13 (1982).
- LHR antibodies containing structural modifications that facilitate rapid binding and cell uptake and/or slow release are useful in in vivo imaging detection methods.
- the LHR antibody contains a deletion in the CH2 constant heavy chain region of the antibody to facilitate rapid binding and cell uptake and/or slow release.
- a Fab fragment is used to facilitate rapid binding and cell uptake and/or slow release.
- a F(ab)'2 fragment is used to facilitate rapid binding and cell uptake and/or slow release.
- the present disclosure provides methods for using the antibodies disclosed herein in the diagnosis of LHR-related medical conditions in a subject.
- Antibodies disclosed herein may be selected such that they have a high level of epitope binding specificity and high binding affinity to the LHR polypeptide.
- the higher the binding affinity of an antibody the more stringent wash conditions can be performed in an immunoassay to remove nonspecifically bound material without removing the target polypeptide.
- LHR antibodies of the present technology useful in diagnostic assays usually have binding affinities of at least 10 -6 , 10 -7 , 10 -8 , 10 -9 , 10 -10 , 10 -11 , or 10 -12 M.
- LHR antibodies used as diagnostic reagents have a sufficient kinetic on-rate to reach equilibrium under standard conditions in at least 12 hours, at least 5 hours, at least 1 hour, or at least 30 minutes.
- Some methods of the present technology employ polyclonal preparations of anti- LHR antibodies and polyclonal anti-LHR antibody compositions as diagnostic reagents, and other methods employ monoclonal isolates.
- the preparation typically contains an assortment of LHR antibodies, e.g., antibodies, with different epitope specificities to the target polypeptide.
- the monoclonal anti-LHR antibodies of the present disclosure are useful for detecting a single antigen in the presence or potential presence of closely related antigens.
- the LHR antibodies of the present disclosure can be used as diagnostic reagents for any kind of biological sample.
- the LHR antibodies disclosed herein are useful as diagnostic reagents for human biological samples.
- LHR antibodies can be used to detect LHR polypeptides in a variety of standard assay formats. Such formats include
- Biological samples can be obtained from any tissue (including biopsies), cell or body fluid of a subject.
- Prognostic Uses of LHR antibodies The present disclosure also provides for prognostic (or predictive) assays for determining whether a subject is at risk of developing a medical disease or condition associated with increased LHR polypeptide expression or activity (e.g., detection of a precancerous cell). Such assays can be used for prognostic or predictive purpose to thereby prophylactically treat an individual prior to the onset of a medical disease or condition characterized by or associated with LHR polypeptide expression.
- Another aspect of the present disclosure provides methods for determining LHR expression in a subject to thereby select appropriate therapeutic or prophylactic compounds for that subject.
- the prognostic assays can be utilized to identify a subject having or at risk for developing prostate cancer and ovary cancer.
- the present disclosure provides a method for identifying a disease or condition associated with increased LHR polypeptide expression levels in which a test sample is obtained from a subject and the LHR polypeptide detected, wherein the presence of increased levels of LHR polypeptides compared to a control sample is predictive for a subject having or at risk of developing a disease or condition associated with increased LHR polypeptide expression levels.
- the disease or condition associated with increased LHR polypeptide expression levels is selected from the group consisting of prostate cancer and ovary cancer.
- the present disclosure provides methods for determining whether a subject can be effectively treated with a compound for a disorder or condition associated with increased LHR polypeptide expression wherein a biological sample is obtained from the subject and the LHR polypeptide is detected using the LHR antibody.
- the expression level of the LHR polypeptide in the biological sample obtained from the subject is determined and compared with the LHR expression levels found in a biological sample obtained from a subject who is free of the disease. Elevated levels of the LHR polypeptide in the sample obtained from the subject suspected of having the disease or condition compared with the sample obtained from the healthy subject is indicative of the LHR-associated disease or condition in the subject being tested.
- the method of detecting a LHR polypeptide in a biological sample can be used as a method of prognosis, e.g., to evaluate the likelihood that the subject will respond to the therapy or treatment.
- the level of the LHR polypeptide in a suitable tissue or body fluid sample from the subject is determined and compared with a suitable control, e.g., the level in subjects with the same disease but who have responded favorably to the treatment.
- the present disclosure provides for methods of monitoring the influence of agents (e.g., drugs, compounds, or small molecules) on the expression of LHR polypeptides.
- agents e.g., drugs, compounds, or small molecules
- Such assays can be applied in basic drug screening and in clinical trials.
- the effectiveness of an agent to decrease LHR polypeptide levels can be monitored in clinical trials of subjects exhibiting elevated expression of LHR, e.g., patients diagnosed with cancer.
- An agent that affects the expression of LHR polypeptides can be identified by administering the agent and observing a response.
- the expression pattern of the LHR polypeptide can serve as a marker, indicative of the physiological response of the subject to the agent. Accordingly, this response state may be determined before, and at various points during, treatment of the subject with the agent.
- this method comprises contacting a tumor sample isolated from the patient with an effective amount of an LHR antibody and detecting the presence of any antibody bound to the tumor sample.
- the presence of antibody bound to the tumor sample indicates that the patient is likely to respond to the LHR CAR therapy and the absence of antibody bound to the tumor sample indicates that the patient is not likely to respond to the LHR therapy.
- the method comprises the additional step of administering an effective amount of the LHR CAR therapy to a patient that is determined likely to respond to the LHR CAR therapy.
- the present disclosure provides diagnostic methods for determining the expression level of LHR.
- the present disclosure provides kits for performing these methods as well as instructions for carrying out the methods of the present disclosure such as collecting tissue and/or performing the screen, and/or analyzing the results.
- the kit comprises, or alternatively consists essentially of, or yet further consists of, a LHR antibody composition (e.g., monoclonal antibodies) disclosed herein, and instructions for use.
- the kits are useful for detecting the presence of LHR polypeptides in a biological sample e.g., any body fluid including, but not limited to, e.g., sputum, serum, plasma, lymph, cystic fluid, urine, stool, cerebrospinal fluid, acitic fluid or blood and including biopsy samples of body tissue.
- the test samples may also be a tumor cell, a normal cell adjacent to a tumor, a normal cell corresponding to the tumor tissue type, a blood cell, a peripheral blood lymphocyte, or combinations thereof.
- test sample used in the above-described method will vary based on the assay format, nature of the detection method and the tissues, cells or extracts used as the sample to be assayed.
- Methods for preparing protein extracts or membrane extracts of cells are known in the art and can be readily adapted in order to obtain a sample which is compatible with the system utilized.
- the kit can comprise: one or more LHR antibodies capable of binding a LHR polypeptide in a biological sample (e.g., an antibody or antigen-binding fragment thereof having the same antigen-binding specificity of LHR antibody B7H45F6, B7H4 # 33-14, or B7H4 #36-1); means for determining the amount of the LHR polypeptide in the sample; and means for comparing the amount of the LHR polypeptide in the sample with a standard.
- One or more of the LHR antibodies may be labeled.
- the kit components, e.g., reagents
- the kit can further comprise instructions for using the kit to detect the LHR polypeptides.
- the kit comprises a first antibody, e.g., attached to a solid support, which binds to a LHR polypeptide; and, optionally; 2) a second, different antibody which binds to either the LHR polypeptide or the first antibody and is conjugated to a detectable label.
- the kit can also comprise, e.g., a buffering agent, a preservative or a protein- stabilizing agent.
- the kit can further comprise components necessary for detecting the detectable-label, e.g., an enzyme or a substrate.
- the kit can also contain a control sample or a series of control samples, which can be assayed and compared to the test sample.
- Each component of the kit can be enclosed within an individual container and all of the various containers can be within a single package, along with instructions for interpreting the results of the assays performed using the kit.
- the kits of the present disclosure may contain a written product on or in the kit container. The written product describes how to use the reagents contained in the kit.
- these suggested kit components may be packaged in a manner customary for use by those of skill in the art.
- these suggested kit components may be provided in solution or as a liquid dispersion or the like.
- the antibodies or LHR CARs also can be bound to many different carriers.
- this disclosure also provides compositions containing the antibodies and another substance, active or inert.
- examples of well-known carriers include glass, polystyrene, polypropylene, polyethylene, dextran, nylon, amylases, natural and modified celluloses, polyacrylamides, agaroses and magnetite.
- the nature of the carrier can be either soluble or insoluble for purposes of the disclosure. Those skilled in the art will know of other suitable carriers for binding antibodies, or will be able to ascertain such, using routine experimentation.
- the present disclosure provides chimeric antigen receptors (CAR) that bind to LHR comprising, or consisting essentially of, an extracellular and intracellular domain.
- the extracellular domain comprises a target-specific binding element otherwise referred to as the antigen binding domain.
- the intracellular domain or cytoplasmic domain comprises a costimulatory signaling region and a zeta chain portion.
- the CAR may optionally further comprise a spacer domain of up to 300 amino acids, preferably 10 to 100 amino acids, more preferably 25 to 50 amino acids.
- the present disclosure provides a CAR that comprises, or alternatively consists essentially thereof, or yet consists of an antigen binding domain specific to LHR.
- the antigen binding domain comprises, or alternatively consists essentially thereof, or yet consists of the antigen binding domain of an anti-LHR antibody.
- the heavy chain variable region and light chain variable region of an anti-LHR antibody comprises, or alternatively consists essentially thereof, or yet consists of the antigen binding domain the anti-LHR antibody.
- the heavy chain variable region of the antibody comprises, or consists essentially thereof, or consists of the sequences disclosed herein, including an equivalent of each thereof and/or comprises one or more CDR regions as disclosed herein or an equivalent of each thereof.
- the HC of the antibody comprises or
- LC comprises the antibody of comprises or alternatively consists essentially of, or yet further consists of a CDR1 comprising the amino acid sequence of SSVNY (SEQ ID NO.:25) or an equivalent of each thereof; and/or a CDR2 comprising the amino acid sequence of DTS (SEQ ID NO:28) or an equivalent of each thereof; and/or a CDR3 comprising the amino acid sequence of HQWSSYPYT (SEQ ID NO:31) or an equivalent of each thereof.
- the HC comprises, or alternatively consists essentially of, or yet further consists of one or more of: a CDR1 comprising the amino acid sequence of
- the LC of the antibody comprises, or alternatively consists essentially of, or yet further consists of a CDR1 comprising the amino acid sequence of QSLLNSGNQKNY (SEQ ID NO.:26) or an equivalent of each thereof; and/or a CDR2 comprising the amino acid sequence of WAS (SEQ ID NO:29) or an equivalent of each thereof; and/or a CDR3 comprising the amino acid sequence of QNDYSYPLT (SEQ ID NO:32) or an equivalent of each thereof.
- the HC of the antibody comprises, or alternatively consists essentially of, or yet further consists of one or more of: a CDR1 comprising the amino acid sequence of GYSFTGYY (SEQ ID NO.: 18) or an equivalent of each thereof; and/or a CDR2 comprising the amino acid sequence of IYPYNGVS (SEQ ID NO.: 21) or an equivalent of each thereof; and/or a CDR3 comprising the amino acid sequence of ARERGLYQLRAMDY (SEQ ID NO.: 24) or an equivalent of each thereof; and/or the LC of the antibody comprises, or alternatively consists essentially of, or yet further consists of a CDR1 comprising the amino acid sequence of QSISNN (SEQ ID NO.:27) or an equivalent of each thereof; and/or a CDR2 comprising the amino acid sequence of NAS (SEQ ID NO:30) or an equivalent of each thereof; and/or a CDR3 comprising the amino acid sequence of QQSNSWP
- the transmembrane domain may be derived either from a natural or from a synthetic source. Where the source is natural, the domain may be derived from any membrane-bound or transmembrane protein. Transmembrane regions of particular use in this invention may be derived from CD8, CD28, CD3, CD45, CD4, CD5, CDS, CD9, CD 16, CD22, CD33, CD37, CD64, CD80, CD86, CD 134, CD137, CD 154, TCR.
- the transmembrane domain may be synthetic, in which case it will comprise predominantly hydrophobic residues such as leucine and valine.
- a triplet of phenylalanine, tryptophan and valine will be found at each end of a synthetic transmembrane domain.
- a short oligo- or polypeptide linker preferably between 2 and 10 amino acids in length may form the linkage between the transmembrane domain and the
- a glycine-serine doublet provides a particularly suitable linker.
- Cytoplasmic Domain The cytoplasmic domain or intracellular signaling domain of the CAR is responsible for activation of at least one of the traditional effector functions of an immune ceil in which a CAR has been placed.
- the intracellular signaling domain refers to a portion of a protein which transduces the eftector function signal and directs the immune cell to perform its specific function. An entire signaling domain or a truncated portion thereof may be used so long as the truncated portion is sufficient to transduce the effector function signal.
- Cytoplasmic sequences of the TCR and co-receptors as well as derivatives or variants thereof can function as intracellular signaling domains for use in a CAR.
- Intracellular signaling domains of particular use in this invention may be derived from FcR, TCR, CD3, CDS, CD22, CD79a, CD79b, CD66d. Since signals generated through the TCR are alone insufficient for full activation of a T cell, a secondary or co-stimulatory signal may also be required.
- the intracellular region of a co-stimulatory signaling molecule including but not limited CD27, CD28, 4- IBB (CD 137), OX40, CD30, CD40, PD- 1 , ICOS, lymphocyte function-associated antigen- 1 (LFA-1 ), CD2, CD 7, LIGHT, NKG2C, B7-H3, or a ligand that specifically binds with CD83, to may also be included in the cytoplasmic domain of the CAR.
- a co-stimulatory signaling molecule including but not limited CD27, CD28, 4- IBB (CD 137), OX40, CD30, CD40, PD- 1 , ICOS, lymphocyte function-associated antigen- 1 (LFA-1 ), CD2, CD 7, LIGHT, NKG2C, B7-H3, or a ligand that specifically binds with CD83, to may also be included in the cytoplasmic domain of the CAR.
- the ceil activation moiety of the chimeric antigen receptor is a T-cell signaling domain comprising, or alternatively consisting essentially of, or yet further consisting of, one or more proteins or fragments thereof selected from the group consisting of CDS protein, CD28 protein, 4-1BB protein, and CD3-zeta protein.
- the CAR comprises, or alternatively consists essentially thereof, or yet consists of an antigen binding domain of an anti-LHR antibody, a CD 8 a hinge domain, a CDS a transmembrane domain, a costimulatory signaling region, and a CD3 zeta signaling domain.
- the costimulatory signaling region comprises either or both a CD28 costimulatory signaling region and a 4- IBB costimulatory signaling region.
- the CAR can further comprise a detectable marker or purification marker.
- the ceil is a prokaryotic or a eukaryotic ceil.
- the cell is a T cell or an NK cell.
- the eukaryotic cell can be from any preferred species, e.g., an animal cell, a mammalian cell such as a human, a feline or a canine cell.
- the isolated cell comprises, or alternatively consists essentially of, or yet further consists of an exogenous CAR comprising, or alternatively consisting essentially of, or yet further consisting of, an antigen binding domain of an anti- LHR antibody, a CD8 a hinge domain, a CDS a transmembrane domain, a CD28
- the isolated cell is a T-cell, e.g., an animal T- cell, a mammalian T-cell, a feline T-cell, a canine T-cell or a human T-cell.
- the isolated cell is an NK-cell, e.g., an animal NK-cell, a mammalian NK-cell, a feline NK-cell, a canine NK-cell or a human NK-cell.
- methods of producing LHR CAR expressing cells comprising, or alternatively consisting essentially of: (i) transducing a population of isolated cells with a nucleic acid sequence encoding a LHR CAR and (ii) selecting a subpopulation of cells that have been successfully transduced with said nucleic acid sequence of step (i).
- the isolated cells are T-cells, an animal T-cell, a mammalian T-cell, a feline T-cell, a canine T-cell or a human T-cell, thereby producing LHR CAR T-cells.
- the isolated cell is an NK-cell, e.g., an animal NK- cell, a mammalian NK-cell, a feline NK-cell, a canine NK-cell or a human NK-cell, thereby producing LHR CAR NK-cells.
- an NK-cell e.g., an animal NK- cell, a mammalian NK-cell, a feline NK-cell, a canine NK-cell or a human NK-cell, thereby producing LHR CAR NK-cells.
- a source of T or NK cells Prior to expansion and genetic modification of the T cells of the invention, a source of T or NK cells is obtained may be obtain from a subject or a culture. T or NK cells can be obtained from a number of sources in a subject, including peripheral blood mononuclear cells, bone marrow, lymph node tissue, cord blood, thymus tissue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumors.
- Isolation methods for use in relation to this disclosure include, but are not limited to Life Technologies Dynabeads® system; STEMcell Technologies EasySepTM, RoboSepTM, RosetteSepTM, SepMateTM; Miltenyi Biotec MACSTM cell separation kits, and other commercially available cell separation and isolation kits.
- Particular subpopulations of immune cells may be isolated through the use of beads or other binding agents available in such kits specific to unique cell surface markers.
- MACSTM CD4+ and CD8+ MicroBeads may be used to isolate CD4+ and CD8+ T-cells.
- cells may be obtained through commercially available cell cultures, including but not limited to, for T-cells, lines BCL2 (AAA) Jurkat (ATCC® CRL-2902TM), BCL2 (S70A) Jurkat (ATCC® CRL-2900TM), BCL2 (S87A) Jurkat (ATCC® CRL-2901TM), BCL2 Jurkat (ATCC® CRL-2899TM), Neo Jurkat (ATCC® CRL-2898TM); and, for NK cells, lines NK-92 (ATCC® CRL-2407TM), NK-92MI (ATCC® CRL-2408TM).
- CARs may be prepared using vectors.
- the preparation of exemplary vectors and the generation of CAR expressing cells using said vectors is discussed in detail in the examples below.
- the expression of natural or synthetic nucleic acids encoding CARs is typically achieved by operably linking a nucleic acid encoding the CAR polypeptide or portions thereof to a promoter, and incorporating the construct into an expression vector.
- the vectors can be suitable for replication and integration eukaryotes.
- Such assays include, for example, "molecular biological” assays well known to those of skill in the art, such as Southern and Northern blotting, RT-PCR and PGR; "biochemical” assays, such as detecting the presence or absence of a particular peptide, e.g., by immunological means (ELI S As and Western blots) or by assays described herein to identify agents falling within the scope of the invention.
- “molecular biological” assays well known to those of skill in the art, such as Southern and Northern blotting, RT-PCR and PGR
- biochemical assays, such as detecting the presence or absence of a particular peptide, e.g., by immunological means (ELI S As and Western blots) or by assays described herein to identify agents falling within the scope of the invention.
- the isolated nucleic acid sequence encodes for a CAR comprising, or alternatively consisting essentially of, or yet further consisting of an antigen binding domain of an anti-LHR antibody, a CDS a hinge domain, a CD8 a transmembrane domain, a CD28 costimulatory signaling region and/or a 4-1 BB costimulatory signaling region, and a CD3 zeta signaling domain.
- the isolated nucleic acid sequence comprises, or alternatively consisting essentially thereof, or yet further consisting of, sequences encoding (a) an antigen binding domain of an anti-LHR antibody followed by (b) a CDS ⁇ hinge domain, (c) a CDS ⁇ transmembrane domain followed by (d) a CD28 costimulatory signaling region and/or a 4- IBB costimulatory signaling region followed by (e) a CDS zeta signaling domain.
- the isolated nucleic acid sequence comprises, or alternatively consists essentially thereof, or yet further consists of, a Kozak consensus sequence upstream of the sequence encoding the antigen binding domain of the anti-LHR antibody.
- the isolated nucleic acid comprises a polynucleotide conferring antibiotic resistance.
- the isolated nucleic acid sequence is comprised in a vector.
- the vector is a plasmid.
- the vector is a viral vector.
- the vector is a lentiviral vector.
- nucleic acid encoding CARs is typically achieved by operably linking a nucleic acid encoding the CAR polypeptide or portions thereof to a promoter, and incorporating the construct into an expression vector.
- the vectors can be suitable for replication and integration eukaryotes. Methods for producing cells comprising vectors and/or exogenous nucleic acids are well-known in the art. See, for example, Sambrook et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York).
- the term "vector” intends a recombinant vector that retains the ability to infect and transduce non-dividing and/or slowly-dividing cells and integrate into the target cell's genome.
- the vector is derived from or based on a wild-type virus.
- the vector is derived from or based on a wild-type lentivirus. Examples of such, include without limitation, human immunodeficiency virus (HIV), equine infectious anemia virus (EIAV), simian immunodeficiency virus (SIV) and feline immunodeficiency virus (FIV).
- retrovirus can be used as a basis for a vector backbone such murine leukemia virus (MLV).
- MLV murine leukemia virus
- a viral vector according to the disclosure need not be confined to the components of a particular virus.
- the viral vector may comprise components derived from two or more different viruses, and may also comprise synthetic components. Vector components can be manipulated to obtain desired characteristics, such as target cell specificity.
- the recombinant vectors of this disclosure are derived from primates and non- primates.
- primate lentiviruses include the human immunodeficiency virus (HIV), the causative agent of human acquired immunodeficiency syndrome (AIDS), and the simian immunodeficiency virus (SIV).
- the non-primate lentiviral group includes the prototype "slow virus” visna/maedi virus (VMV), as well as the related caprine arthritis- encephalitis virus (CAEV), equine infectious anemia virus (EIAV) and the more recently described feline immunodeficiency virus (FIV) and bovine immunodeficiency virus (BIV).
- VMV visna/maedi virus
- CAEV caprine arthritis- encephalitis virus
- EIAV equine infectious anemia virus
- FV feline immunodeficiency virus
- BIV bovine immunodeficiency virus
- U.S. Patent No.6,924,123 discloses that certain retroviral sequence facilitate integration into the target cell genome.
- each retroviral genome comprises genes called gag, pol and env which code for virion proteins and enzymes. These genes are flanked at both ends by regions called long terminal repeats (LTRs).
- LTRs are responsible for proviral integration, and transcription. They also serve as enhancer-promoter sequences. In other words, the LTRs can control the expression of the viral genes.
- Encapsidation of the retroviral RNAs occurs by virtue of a psi sequence located at the 5' end of the viral genome.
- the LTRs themselves are identical sequences that can be divided into three elements, which are called U3, R and U5.
- U3 is derived from the sequence unique to the 3' end of the RNA.
- R is derived from a sequence repeated at both ends of the RNA, and
- U5 is derived from the sequence unique to the 5'end of the RNA.
- the sizes of the three elements can vary considerably among different retroviruses.
- the site of poly (A) addition (termination) is at the boundary between R and U5 in the right hand side LTR.
- U3 contains most of the transcriptional control elements of the provirus, which include the promoter and multiple enhancer sequences responsive to cellular and in some cases, viral transcriptional activator proteins.
- gag encodes the internal structural protein of the virus. Gag protein is proteolytically processed into the mature proteins MA (matrix), CA (capsid) and NC (nucleocapsid).
- the pol gene encodes the reverse transcriptase (RT), which contains DNA polymerase, associated RNase H and integrase (IN), which mediate replication of the genome.
- the vector RNA genome is expressed from a DNA construct encoding it, in a host cell.
- the components of the particles not encoded by the vector genome are provided in trans by additional nucleic acid sequences (the "packaging system", which usually includes either or both of the gag/pol and env genes) expressed in the host cell.
- the set of sequences required for the production of the viral vector particles may be introduced into the host cell by transient transfection, or they may be integrated into the host cell genome, or they may be provided in a mixture of ways. The techniques involved are known to those skilled in the art.
- Retroviral vectors for use in this disclosure include, but are not limited to
- Invitrogen s pLenti series versions 4, 6, and 6.2“ViraPower” system. Manufactured by Lentigen Corp.; pHIV-7-GFP, lab generated and used by the City of Hope Research Institute; “Lenti-X” lentiviral vector, pLVX, manufactured by Clontech; pLKO.1-puro, manufactured by Sigma-Aldrich; pLemiR, manufactured by Open Biosystems; and pLV, lab generated and used by Charotti Medical School, Institute of Virology (CBF), Berlin, Germany.
- assays include, for example, "molecular biological” assays well known to those of skill in the art, such as Southern and Northern blotting, RT-PCR and PCR;
- biochemical assays such as detecting the presence or absence of a particular peptide, e.g., by immunological means (ELlSAs and Western blots) or by assays described herein to identify agents falling within the scope of the disclosure.
- Packaging vector and cell lines CARs can be packaged into a retroviral packaging system by using a packaging vector and cell lines.
- the packaging plasmid includes, but is not limited to retroviral vector, lentiviral vector, adenoviral vector, and adeno-associated viral vector.
- the packaging vector contains elements and sequences that facilitate the delivery of genetic materials into cells.
- the retroviral constructs are packaging plasmids comprising at least one retroviral helper DNA sequence derived from a replication- incompetent retroviral genome encoding in trans all virion proteins required to package a replication incompetent retroviral vector, and for producing virion proteins capable of packaging the replication-incompetent retroviral vector at high titer, without the production of replication-competent helper virus.
- the retroviral DNA sequence lacks the region encoding the native enhancer and/or promoter of the viral 5' LTR of the virus, and lacks both the psi function sequence responsible for packaging helper genome and the 3 ' LTR, but encodes a foreign polyadenylation site, for example the SV40 polyadenylation site, and a foreign enhancer and/or promoter which directs efficient transcription in a cell type where virus production is desired.
- the retrovirus is a leukemia virus such as a Moloney Murine Leukemia Virus (MMLV), the Human Immunodeficiency Vims (HIV), or the Gibbon Ape Leukemia virus (GALV).
- the foreign enhancer and promoter may be the human cytomegalovirus (HCMV) immediate early (IE) enhancer and promoter, the enhancer and promoter (U3 region ) of the Moloney Murine Sarcoma Virus (MMSV), the U3 region of Rous Sarcoma Virus (RSV), the U3 region of Spleen Focus Forming Vims (SFFV), or the HCMV IE enhancer joined to the native Moloney Murine Leukemia Vims (MMLV) promoter.
- HCMV human cytomegalovirus
- IE immediate early
- IE Enhancr and promoter
- U3 region of the Moloney Murine Sarcoma Virus
- RSV Rous Sarcoma Virus
- SFFV Spleen Focus Forming Vims
- HCMV IE enhancer joined to the native Moloney Murine Leukemia Vims (MMLV) promoter.
- the retroviral packaging plasmid may consist of two retroviral helper DNA sequences encoded by plasmid based expression vectors, for example where a first helper sequence contains a cDNA encoding the gag and pol proteins of ecotropic MMLV or GALV and a second helper sequence contains a cDNA encoding the env protein.
- the Env gene which determines the host range, may be derived from the genes encoding xenotropic, amphotropic, ecotropic, polytropic (mink focus forming) or 10A1 murine leukemia virus env proteins, or the Gibbon Ape Leukemia Vims (GALV env protein, the Human
- VSV Vesicular Stomatitus Vims
- HTLV Human T cell leukemia
- the packaging plasmids and retroviral vectors expressing the LHR are transiently cotransfected into a first population of mammalian cells that are capable of producing virus, such as human embryonic kidney cells, for example 293 cells (ATCC No. CRL1573, ATCC, Rockville, Md.) to produce high titer recombinant retrovirus- containing supernatants.
- this transiently transfected first population of cells is then cocultivated with mammalian target cells, for example human lymphocytes, to transduce the target cells with the foreign gene at high efficiencies.
- the supernatants from the above described transiently transfected first population of cells are incubated with mammalian target cells, for example human lymphocytes or hematopoietic stem cells, to transduce the target cells with the foreign gene at high efficiencies.
- mammalian target cells for example human lymphocytes or hematopoietic stem cells
- the packaging plasmids are stably expressed in a first population of mammalian cells that are capable of producing virus, such as human embryonic kidney cells, for example 293 cells.
- Retroviral or lentiviral vectors are introduced into cells by either cotransfection with a selectable marker or infection with pseudotyped virus. In both cases, the vectors integrate.
- vectors can be introduced in an episomally
- T cells can be activated and expanded generally using generally known methods such as those described in U.S. Patent Nos.6,352,694; 6,534,055; 6,905,680; 6,692,964; 5,858,358; 6,887,466;
- Stimulation with the B7-4 antigen ex vivo can activate and expand the selected CAR expressing T-cell subpopulation.
- the T-cells may be activated in vivo by interaction with LHR antigen.
- ⁇ -CD3/ ⁇ -CD28 Dynabeads® may be used to activate and expand a population of isolated T-cells
- chimeric antigen receptors comprise an antigen recognition moiety and a cell activation moiety. Aspects of the present disclosure related to a chimeric antigen receptor (CAR) comprising an antigen binding domain specific to LHR.
- CAR chimeric antigen receptor
- the CAR of the present disclosure is characterized in that it comprises, or alternatively consists essentially of, or yet further consists an antigen binding domain of an anti-luteinizing hormone receptor ("LHR") antibody, a CDS a hinge domain, a CDS a transmembrane domain, a CD28 and/or a 4- I BB co stimulatory signaling region; and a CD3 zeta signaling domain.
- LHR anti-luteinizing hormone receptor
- the antigen binding domain of the anti-LHR antibody comprises an anti-LHR heavy chain variable region and an anti-LHR light chain variable region.
- the heavy chain variable region comprises, or alternatively consists essentially of, or yet further consists of an heavy chain amino acid sequence from any LHR antibody subclones of 5F4-21, 4A7-4, 138-2, and 8B7-3
- the light chain variable region comprises, or alternatively consists essentially of, or yet further consists of the light chain amino acid sequence from any LHR.
- LHR Antibody #4A7-4 Heavy Chain Amino Acid Sequence SEQ ID NO. : 2 QVQLKESGPGLVAPSQSLSrrCTVSGFSLTTYGVSWVRQPPGKGLEWLGVIWGDGST YYHSALISRLSISKDNSKSQVFLKLNSLQTDDTATYYCAEGSSLFAYWGQGTLVTVS A [0241] LHR Antibody #138-2 Heavy Chain Amino Acid Sequence, SEQ ID NO.: 3 EVQLEQSGGGLVQPGGSRKLSCAASGFTFSSFGMHWVRQAPEKGLEWVAYISSGSS TLHYADTVKGRFTISRDNPKNTLFLQMKLPSLCYGLLGSRNLSHRLL
- LHR Antibody #8B7-3 Heavy Chain Amino Acid Sequence SEQ ID NO.: 4 QVKLQQSGPELVKPGASVKISCKASGYSFTGYYMHWVKQSHGNILDWIGYIYPYNG VSSYNQKFKGKATLTVDKSSSTAYMELRSLTSEDSAVYYCARERGLYQLRAMDYW GQGTSVTVSS
- the heavy chain and light chain amino acid sequences of antibody subclones of 5F4-21, 4A7-4, 138-2, and 8B7-3 are aligned with ClustalW2
- the heavy chain variable region comprises, or alternatively consists essentially of, or yet further consists of a polypeptide with a consensus sequence selected from SEQ ID NOs: 9-11
- an anti-LHR light chain variable region comprises, or alternatively consists essentially of, or yet further consists of a polypeptide with a consensus sequence selected from SEQ ID NOs.:12-15 (or an equivalent thereof) as follows:
- the heavy chain variable region comprises or alternatively consists essentially of, or yet further consists of a CDR1 comprising the amino acid sequence of GYSITSGYG (SEQ ID NO.: 16) or an equivalent of each thereof; and/or a CDR2 comprising the amino acid sequence of IHYSGST (SEQ ID NO.: 19) or an equivalent of each thereof; and/or a CDR3 comprising the amino acid sequence of ARSLRY (SEQ ID NO.: 22) or an equivalent of each thereof; and/or the light chain variable region comprises or alternatively consists essentially of, or yet further consists of a CDR1 comprising the amino acid sequence of SSVNY (SEQ ID NO.:25) or an equivalent of each thereof; and/or a CDR2 comprising the amino acid sequence of DTS (SEQ ID NO:28) or an equivalent of each thereof; and/or a CDR3 comprising the amino acid sequence of HQWSSYPYT (SEQ ID NO:31) or an equivalent of
- the heavy chain variable region comprises, or alternatively consists essentially of, or yet further consists of a CDR1 comprising the amino acid sequence of GFSLTTYG (SEQ ID NO.: 17) or an equivalent of each thereof; and/or a CDR2 comprising the amino acid sequence of IWGDGST (SEQ ID NO.: 20) or an equivalent of each thereof; and/or a CDR3 comprising the amino acid sequence of AEGSSLFAY (SEQ ID NO.: 23) or an equivalent of each thereof; and/or the light chain variable region comprises, or alternatively consists essentially of, or yet further consists of a CDR1 comprising the amino acid sequence of QSLLNSGNQKNY (SEQ ID NO.:26) or an equivalent of each thereof; and/or a CDR2 comprising the amino acid sequence of WAS (SEQ ID NO:29) or an equivalent of each thereof; and/or a CDR3 compris
- QNDYSYPLT (SEQ ID NO:32) or an equivalent of each thereof. Additional amino acids, as disclosed herein, can be added to the carboxy terminus.
- the heavy chain variable region comprises, or alternatively consists essentially of, or yet further consists of a CDR1 comprising the amino acid sequence of GYSFTGYY (SEQ ID NO.: 18) or an equivalent of each thereof; and/or a CDR2 comprising the amino acid sequence of IYPYNGVS (SEQ ID NO.: 21) or an equivalent of each thereof; and/or a CDR3 comprising the amino acid sequence of ARERGLYQLRAMDY (SEQ ID NO.: 24) or an equivalent of each thereof; and/or the light chain variable region comprises, or alternatively consists essentially of, or yet further consists of a CDR1 comprising the amino acid sequence of QSISNN (SEQ ID NO.:27) or an equivalent of each thereof; and/or a CDR2 comprising the amino acid sequence of NAS (SEQ ID NO:30) or an equivalent of each thereof; and/or a CDR3 comprising the amino acid sequence of
- QQSNSWPYT (SEQ ID NO:33) or an equivalent of each thereof. Additional amino acids, as disclosed herein, can be added to the carboxy terminus.
- the CAR comprises, or alternatively consists essentially of, or yet further consists of a linker polypeptide located between the anti-LHR heavy chain variable region and the anti-LHR light chain variable region.
- the LHR CAR further comprises, or alternatively consists essentially of, or yet further consists of a detectable marker or a purification marker.
- the LHR CAR further comprises, or alternatively consists essentially of, or yet further consists of antigen binding domain derived from an antibody against MUC-16 or mesothelin.
- the disclosure provides an isolated nucleic acid sequence comprising, or alternatively consisting essentially of, or yet further consisting of a nucleic acid sequence, or an equivalent thereof, of one or more than one of a polynucleotide selected from LHR antibody #5F4-21 heavy chain DNA sequence, LHR antibody #5F4-21 light chain DNA sequence, LHR antibody #4A7-4 heavy chain DNA sequence, LHR antibody #4A7-4 light chain DNA sequence, LHR antibody #138-2 heavy chain DNA sequence, LHR antibody #138-2 light chain DNA sequence, LHR antibody #8B7-3 heavy chain DNA sequence, LHR Antibody #8B7-3 light chain DNA sequence as follow:
- the isolated nucleic acid further comprises, or alternatively consists essentially of, or yet further consists of a Kozak consenus sequence located upstream of the antigen binding domain of the anti-LHR antibody.
- the isolated nucleic sequence further comprises, or alternatively consists essentially of, or yet further consists of polynucleotide encoding an antibiotic resistance marker.
- the disclosure provides a vector comprising, or alternatively consisting essentially of, or yet further consisting of the isolated nucleic acid sequence encoding the anti-LHR CAR polypeptide as disclosed above or a complement thereof.
- the polynucleotide can be incorporated into a vector.
- Non-limiting examples of such include a retroviral vector, a plasmid, a lentiviral vector, an adenoviral vector, and an adeno-associated viral vector.
- the disclosure is an isolated cell comprising, or alternatively consisting essentially of, or yet further consisting of an exogenously added polynucleotide encoding the anti-LHR CAR as described above alone or in combination with a vector as described above; and/or the exogenously added the anti-LHR CAR; as describe above.
- the isolated cell can be a T-cell or a natural killer (NK) cell.
- the CAR T-cells of the present invention may be used to treat tumors and cancers.
- the CAR-T cells of the present invention may be administered either alone or in combination with diluents, known anti-cancer therapeutics, and/or with other components such as cytokines or other cell populations that are immunostimulatory.
- Method aspects of the present disclosure relate to methods for inhibiting the growth of a tumor in a subject in need thereof and/or for treating a cancer patient in need thereof.
- the tumor is a solid tumor.
- the tumors/cancer is thyroid, breast, ovarian or prostate tumors/cancer.
- the tumor or cancer expresses or overexpresses LHR.
- these methods comprise, or alternatively consist essentially of, or yet further consist of, administering to the subject or patient an effective amount of the isolated cell.
- this isolated cell comprises a LHR CAR.
- the isolated cell is a T-cell or an NK cell.
- the isolated cell is autologous to the subject or patient being treated.
- the tumor expresses LHR antigen and the subject has been selected for the therapy by a diagnostic, such as the one described herein.
- the CAR cells as disclosed herein may be administered either alone or in combination with diluents, known anti-cancer therapeutics, and/or with other components such as cytokines or other cell populations that are immunostimulatory. They may be first line, second line, third line, fourth line, or further therapy. The can be combined with other therapies. Non-limiting examples of such include chemotherapies or biologics. Appropriate treatment regimes will be determined by the treating physician or veterinarian.
- compositions comprising the LHR CAR of the present invention may be administered in a manner appropriate to the disease to be treated or prevented.
- the quantity and frequency of administration will be determined by such factors as the condition of the patient, and the type and severity of the patient's disease, although appropriate dosages may be determined by clinical trials.
- the disclosure provides a method of inhibiting the growth of a solid tumor in a subject in need thereof, comprising administering to the subject an effective amount of the isolated cell of anti-LHR CAR T-cell.
- the isolated T-cells are autologous to the subject being treated.
- the tumor is ovarian tumor or a prostate cancer tumor.
- the method of inhibiting the growth of a tumor can be applied to a subject including but not limited to human, dog, cat, horse, and other species.
- the disclosure provides a method of treating a cancer patient in need thereof, comprising, or alternatively consisting essentially of, or yet further consisting of administering to the subject an effective amount of the isolated cell of anti-LHR T-cell.
- the isolated T-cells can be autologous to the subject being treated.
- the tumor is ovarian cancer or a prostate cancer.
- the subject treated for cancer is a human patient.
- the disclosure provides a method for determining if a patient is likely to respond or is not likely to anti-LHR CAR therapy, comprising, or alternatively consisting essentially of, or yet further consisting of contacting a tumor sample isolated from the patient with an effective amount of an anti-LHR antibody and detecting the presence of any antibody bound to the tumor sample, wherein the presence of antibody bound to the tumor sample indicates that the patient is likely to respond to the anti-LHR CAR therapy and the absence of antibody bound to the tumor sample indicates that the patient is not likely to respond to the anti-CAR therapy.
- the method further comprises administering an effective amount of the anti-LHR CAR therapy to the patient that is determined likely to respond to the anti-LHR CAR therapy.
- the patient can suffer from ovarian cancer or prostate cancer.
- the present disclosure also provides diagnostic methods for determining the expression level of LHR.
- the present disclosure provides kits for performing these methods as well as instructions for carrying out the methods of the present disclosure such as collecting tissue and/or performing the screen, and/or analyzing the results.
- the disclosure provides a method of detecting LHR in a biological sample comprising, or alternatively consisting essentially of, or yet further consisting of contacting the sample with an anti-LHR antibody or an antigen binding fragment capable of binding a peptide comprising SEQ ID NOs: 42 and 43, and detecting a complex formed by the binding of the antibody or antigen binding fragment to LHR.
- the sample comprises a cell sample or a tissue sample.
- the sample is obtained from a subject that is diagnosed as having, suspected as having, or at risk of having cancer.
- the cancer is prostate cancer or ovarian cancer.
- the cancer cell or tumor cell expresses or overexpresses LHR.
- the detection comprises, or alternatively consists essentially of, or yet further consists of one or more of immunohistochemistry (IHC), Western blotting, Flow cytometry or ELISA.
- IHC immunohistochemistry
- Western blotting Western blotting
- Flow cytometry ELISA
- the method comprises, or alternatively consists essentially of, or yet further consists of isolating the biological sample from the subject.
- the subject is a mammal.
- the mammal is selected from the group of: a human, an animal, a non-human primate, a dog, cat, a sheep, a mouse, a horse, or a cow.
- the disclosure provides a method of detecting a pathological cell in a sample isolated from a subject, comprising, or alternatively consisting essentially of, or yet further consisting of (a) detecting the level of LHR in a biological sample from the subject by detecting a complex formed by an anti-LHR antibody or an antigen binding fragment capable of binding a peptide comprising SEQ ID NOs: 42 and 43; and (b) comparing the levels of LHR observed in step (a) with the levels of LHR observed in a control biological sample; wherein the pathological cell is detected when the level of LHR is elevated compared to that observed in the control biological sample.
- the biological sample of the subject comprises, or alternatively consists essentially of, or yet further consists of one or more of a sample isolated from prostate and ovary.
- the detection comprises, or alternatively consists essentially of, or yet further consists of one or more of immunohistochemistry (IHC), Western Blotting, Flow cytometry or ELISA.
- IHC immunohistochemistry
- Western Blotting Western Blotting
- Flow cytometry ELISA
- the method comprises, or alternatively consists essentially of, or yet further consists of isolating the biological sample from the subject.
- the subject is a mammal.
- the mammal is selected from the group of: a human, an animal, a non-human primate, a dog, cat, a sheep, a mouse, a horse, or a cow.
- compositions comprising a carrier and one or more of the products– e.g., an isolated cell comprising a HLA-G CAR, an isolated nucleic acid, a vector, an isolated cell of any anti-HLA-G antibody or CAR cell, an anti- HLA-G– described in the embodiments disclosed herein.
- compositions of the present invention including but not limited to any one of the claimed compositions may comprise a target cell population as described herein, in combination with one or more pharmaceutically or physiologically acceptable carriers, diluents or excipients.
- Such compositions may comprise buffers such as neutral buffered saline, phosphate buffered saline and the like; carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide); and preservatives.
- Compositions of the present disclosure may be formulated for oral, intravenous, topical, enteral, and/or parenteral administration. In certain embodiments, the compositions of the present disclosure are formulated for intravenous administration.
- compositions of the present invention including but not limited to any one of the claimed compositions may comprise a target cell population as described herein, in combination with one or more pharmaceutically or physiologically acceptable carriers, diluents or excipients.
- Such compositions may comprise buffers such as neutral buffered saline, phosphate buffered saline and the like; carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol; proteins; polypeptides or amino acids such as glycine;antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide); and preservatives.
- Compositions of the present invention are preferably formulated for intravenous administration.
- compositions of the present invention may be administered in a manner appropriate to the disease to be treated or prevented.
- the quantity and frequency of administration will be determined by such factors as the condition of the patient, and the type and severity of the patient's disease, although appropriate dosages may be determined by clinical trials.
- Antibodies against the lysine rich extracellular hormone binding domain of LHR were generated by repeated immunization of 4 week-old-BALB/c and NIH Swiss mice with genetically engineered LHR-Fc. As shown below in FIG.3, the leader sequence and first part of the human LHR G-protein was used to generate the LHR-Fc used in the immunization and screening methods to generate and identify high binding antibodies. Since flow cytometry has previously been shown to be the best predictor of functional antibodies for CAR generation, this method was used to identify potential candidate antibodies from over 7 fusions performed in the laboratory.
- FIG.4 A typical flow cytometry screen of hybridomas positive by initial ELISA screen using LHR-Fc coated plates is shown below in FIG.4 using the ES-2 ovarian carcinoma cell line.
- hybridoma 8B7 only rare LHR hybridomas were shown to produce high MFI by flow cytometry. These few candidate hybridomas were then subcloned by dilution in 96 well plates and expanded for freezing in vials. After further screening by flow cytometry, specific subclones were selected for large scale production using 2L vessels (GRrex, 100L, Wolfson). Filtered supernatants were then subjected to antibody purification using tandon protein A or G and ion exchange
- LHR has significant advantages over other targets due to its common expression on ovarian cancers and its lack of expression on normal human tissues, LHR CAR T-cells are produced in vitro and in vivo to identify a potential clinical candidate for subsequent clinical trials or use with dual targeting CAR modified T-cells.
- Anti-LHR CAR genes can be synthesized within a pUC57 vector backbone containing a beta-lactamase ("bla") gene, which confers ampiciliin resi stance to the vector host.
- the pUC57 vector sequence is disclosed herein by referring to GeneBank accession No. Y14837 with the sequence of the beta-lactamase gene disclosed in the listed GeneBank accession No. The sequence associated with the listed GeneBank Accession number is herein incorporated by reference.
- NovaBlue SinglesTM chemically-competent E. coli cells were transformed with anti- LHR plasmid cDNA. Following growth of the transformed E. coli ceils, the C AR plasmids were purified and digested with the appropriate restriction enzymes inserted into an HTV-1- based lentiviral vector containing HIV-1 long terminal repeats (LTRs), packaging signal ( ⁇ ), EFla promoter, internal ribosome entry site (IRES), and woodchuck hepatitis virus post- transcriptional regulatory element (WPRE) via overnight T 4 DNA ligase reaction (New England Biosciences; Ipswich, MA). NovaBlue SinglesTM chemically-competent E. coli cells are then transformed with the resulting anti-LHR containing lentiviral plasmid. Production of lentiviral particles
- HEK293T cells Prior to transfection, HEK293T cells were seeded at 4.0 ⁇ 10 6 cells/100 mm tissue- culture-treated plate in 10 mL complete-Tet-DMEM and incubated overnight at 37 o C in a humidified 5% CO 2 incubator. Once 80-90% confluent, HEK293T cells were co-transfected with CAR-gene lentiviral plasmids and lentiviral packaging plasmids containing genes necessary to form lentiviral envelope and capsid components to facilitate the formation of plasmid-containing nanoparticles that bind HEK293T cells.
- transfection medium was replaced with 10 mL fresh complete Tet DMEM.
- HEK293T cells are then incubated for an additional 48 hours, after which cell supernatants are harvested and tested for lentiviral particles via sandwich ELISA against p24, the main lentiviral capsid protein. Lentivirus-containing supernatants were aliquoted and stored at–80oC until use for transduction of target CD4 + and CD8 + T cells.
- PBMCs Peripheral blood mononuclear cells enriched by density gradient centrifugation with Ficoll-Paque Plus (GE Healthcare; Little Chalfont, Buckinghamshire, UK) were recovered and washed by centrifugation with PBS containing 0.5% bovine serum albumin (BSA) and 2 mM EDTA.
- BSA bovine serum albumin
- MACS CD4 + and CD8 + MicroBeads (Miltenyi Biotec; San Diego, CA) kits can be used to isolate these human T-cell subsets using magnetically activated LS columns to positive select for CD4 + and CD8 + T-cells. Magnetically-bound T- cells were then removed from the magnetic MACS separator, flushed from the LS column, and washed in fresh complete medium.
- CD4 + and CD8 + T-cell populations were assessed by flow cytometry using Life Technologies Acoustic Attune® Cytometer, and were enriched by Fluorescence-Activated Cell Sorting performed at USC’s flow cytometry core facilities if needed.
- CD4 + and CD8 + T-cells were maintained at a density of 1.0 ⁇ 10 6 cells/mL in complete medium supplemented with 100 IU/mL IL-2 in a suitable cell culture YHVVHO ⁇ WR ⁇ ZKLFK ⁇ -&' ⁇ -CD28 Human T-cell Dynabeads (Life Technologies; Carlsbad, CA) were added to activate cultured T cells. T-cells were incubated at 37oC in a 5% CO 2 incubator for 2 days prior to transduction with CAR-lentiviral particles. Lentiviral transduction of CD4 + CD8 + T-cells
- Activated T-cells are collected and dead cells were removed by Ficoll-Hypaque density gradient centrifugation or the use of MACS Dead Cell Removal Kit (Miltenyi Biotec; San Diego, CA). In a 6-well plate, activated T-cells were plated at a concentration of 1.0 ⁇ 10 6 cells/ mL complete medium. To various wells, LHR CAR-containing lentiviral particles were added to cell suspensions at varying multiplicity of infections (MOIs), such as 1, 5, 10, and 50. Polybrene, a cationic polymer that aids transduction by facilitating interaction between lentiviral particles and the target cell surface, was added at a final concentration of 4 ⁇ g/mL.
- MOIs multiplicity of infections
- LHR CAR modified T-cells are assessed by flow cytometry and southern blot analysis to demonstrate successful transduction procedures. Prior to in vitro and in vivo assays, LHR CAR T-cells were enriched by FACS and mixed 1:1 for the in vivo studies.
- LHR antigen positive and negative target cells were collected, washed, and re- suspended in complete medium at a concentration of 1.0 x 10 6 cells/mL.
- Calcein- acetoxymethyl (AM) was added to target cell samples at 15 ⁇ M, which was then incubated at 37 o C in a 5% CO 2 humidified incubator for 30 minutes.
- Dyed positive and negative target cells were washed twice and re-suspended in complete medium by centrifugation and added to a 96-well plate at 1.0 ⁇ 10 4 cells/well.
- LHR CAR T-cells was added to the plate in complete medium at effector-to-target cell ratios of 50:1, 5:1, and 1:1.
- Dyed-target cells suspended in complete medium and complete medium with 2% triton X-100 serves as spontaneous and maximal release controls, respectively.
- the plates were centrifuged at 365 x g and 20oC for 2 minutes before being placed back in the incubator for 3 hours. The plates were then centrifuged for 10 minutes and cell supernatants were aliquoted to respective wells on a black polystyrene 96-well plate and assessed for fluorescence on a Bio-Tek® SynergyTM HT microplate reader at excitation and emissions of 485/20 nm and 528/20 nm, respectively. Quantification of human cytokines by Luminex Bioassay.
- LHR CAR T-cells are further evaluated in vivo using two different human ovarian cell xenograft tumor models.
- solid human ovarian tumors are established subcutaneously in nude mice by injection of 5 x 10 6 LHR positive ovarian cancer cell lines or LHR negative solid tumor cell lines.
- LHR CAR modified T-cells with either MUC-CD or mesothelin single chains are prepared.
- the principal of dual targeting CAR T-cells has successfully been tested in breast cancer using ERB/2 and MUC1 (Wilkie, S. et al. (2012) J. Clin. Immunol. 32: 1059-1070), mesothelin and ⁇ -folate receptor (Lanitis, E. et al. (2013) Cancer Immunol. Res.1:45-53), and PSMA and PSCA for the treatment of prostate cancer (Kloss, C.C. et al. (2013) Nat. Biotechnol.31:71–75).
- MUC16 a mucin family member is over expressed on most ovarian cancers and is an established surrogate serum marker (CA125) for the progression and detection of ovarian cancers.
- MUC16 is composed of CA125, a large domain that gets cleaved, and a retained domain (MUC-CD) which contains an extracellular fragment, a transmembrane domain and cytoplasmic tail (Rao, T.D. et al. (2010) Appl. Immunohistochem. Mol. Morphology 18:462- 472). MUC16 is also expressed at low levels in the uterus, endometrium, fallopian, tubes, ovaries and serosa of the abdominal and thoracic cavities.
- MUC-CD targeted T cells exhibited efficient MUC-CD specific cytolytic activity against human ovarian cancer cell lines in vitro as well as successful eradication of established peritoneal ovarian tumors in SCID-Beige mice (Chekmasova, A.A. et al. (2010) Clin. Cancer Res.16:3594–606).
- MUC-CD is a viable target for CAR therapy and an excellent choice for dual targeting CAR modified T-cells to reduce the potential on-target off-tumor effects.
- Both MUC-CD and mesothelin CAR modified T-cells have been shown to be effective, and in combination with LHR, may provide a safer alternative if required for optimal clinical use.
- the CAR consists of an extracellular antigen binding moiety or scFV which binds LHR.
- the scFV is connected via a CD8 hinge region to the cytoplasmic signaling domain, comprised of the CD8 transmembrane region, and the signaling domains from CD28, 4-1BB and CD3z.
- the entire CAR sequence including the signaling domains, were synthetically synthesized by Genewiz Gene Synthesis Services (Piscataway, NJ) (FIG.10).
- the plasmids are purified and digested with the appropriate restriction enzymes to be inserted into an HIV- 1-based, bicistronic lentiviral vector (pLVX-IRES-ZsGreen, Clontech, Signal Hill, CA) containing HIV- 1 5' and 3' long terminal repeats (LTRs), packaging signal ( ⁇ ), EFl ⁇ promoter, internal ribosome entry site (IRES), woodchuck hepatitis virus post-transcriptional regulatory element (WPRE), and simian virus 40 origin (SV40) via overnight T 4 DNA ligase reaction (New England Biosciences; Ipswich, MA). NovaBlue SinglesTM chemically- competent E. coli cells are then transformed with the resulting LHR-CAR-containing lentiviral plasmid.
- LTRs long terminal repeats
- IVS internal ribosome entry site
- WPRE woodchuck hepatitis virus post-transcriptional regulatory element
- SV40 simian virus 40 origin
- HEK 293T cells Prior to transfection, HEK 293T cells are seeded at 4.0 ⁇ 10 6 cells/150 cm 2 tissue- culture-treated flask in 20 mL DMEM supplemented with 10% dialyzed FCS and incubated overnight at 37 o C in a humidified 5% CO 2 incubator. Once 80-90% confluent, HEK 293T cells are incubated in 20 ml DMEM supplemented with 1-% dialyzed FCS without penicillin/streptamycin for two hours in a 37 o C humidified 5% CO 2 incubator.
- HEK293T cells are co-transfected with the specific pLVX-CAR plasmid and lentiviral packaging plasmids containing genes necessary to form the lentiviral envelope & capsid components.
- a proprietary reaction buffer and polymer to facilitate the formation of plasmid-containing nanoparticles that bind HEK 293T cells are also added. After incubating the transfected- HEK 293T cell cultures for 24 hours at 37oC, the transfection medium is replaced with 20 mL fresh complete DMEM.
- Lentivirus supernatants are collected every 24 hours for three days and the supernatants will be spun down at 1,250 rpm for 5 minutes at 4 o C, followed by filter sterilization and centrifugation in an ultracentrifuge at 20,000 g for 2 hrs at 4 o C.
- the concentrated lentivirus is re-suspended in PBS containing 7% trehalose and 1% BSA for long term storage.
- the lentivirus is aliquoted and stored at–80oC until use for transduction of target CD4 + and CD8 + T cells.
- the cell supernatants harvested after 24 hours are tested for lentiviral particles via sandwich ELISA against p24, the main lentiviral capsid protein.
- Transfection efficiency as determined by the expression of the protein marker ZsGreen was estimated between 20%-50%, by visualization under a fluorescent microscope.
- PBMCs Peripheral blood mononuclear cells
- Ficoll-Paque Plus GE Healthcare; Little Chalfont, Buckinghamshire, UK
- BSA bovine serum albumin
- T-cell enrichment kits Stetem Cell Technologies
- CD4 + and CD8 + T-cell populations are assessed by flow cytometry using Life Technologies Acoustic Attune® Cytometer, and are enriched by Fluorescence-Activated Cell Sorting.
- CD4 + and CD8 + T-cells mixed 1:1 are maintained at a density of 1.0 ⁇ 10 6 cells/mL in complete 50% Click's medium/50% RPMI-1640 medium supplemented with 100 lU/mL IL-2 in a suitable cell culture vessel, to which a-CD3/a-CD28 Human T-cell activator beads (Stem Cell Technologies) are added to activate cultured T cells.
- T-cells are incubated at 37oC in a 5% CO 2 incubator for 2 days prior to transduction with CAR lentiviral particles.
- Activated T-cells are collected and dead cells are removed by Ficoll-Hypaque density gradient centrifugation or the use of MACS Dead Cell Removal Kit (Miltenyi Biotec; San Diego, CA).
- MACS Dead Cell Removal Kit MACS Dead Cell Removal Kit
- a 6-well plate activated T-cells are plated at a concentration of 1.0 ⁇ 10 6 cells/mL in complete medium.
- Cells are transduced with the lentiviral particles supplemented with Lentiblast, a transfection aid (Oz Biosciences, San Diego, CA) to the cells.
- Transduced cells are incubated for 24 hours at 37°C in a humidified 5% C0 2 incubator. The cells are then pelleted by centrifugation and the media changed, followed by addition of the T-cell activator beads (Stem Cell Technologies, San Diego, CA),
- mRNA from transduced T-cells are isolated using the Nucleospin RNA kit
- RT-PCR is run using the OneTaq One Step RNA kit (New- England Biolabs, Boston, MA), using the following primers, 5'
- Cytotoxicity of the CAR T-cells are determined using the lactate dehydrogenase (LDH) cytotoxicity kit (Thermo Scientific, Carlsbad, CA). Activated T-cells are collected and 1 x 10 6 cells are transduced with the appropriate CAR 1 en ti viral construct as described above. Cells are activated used the T-ceil activator beads (Stem Cell Technologies, San Diego, CA) for two days prior to cytotoxicity assays. The optimal number of target cells is determined as per the manufacturer's protocol.
- LDH lactate dehydrogenase
- the appropriate target cells are plated in triplicate in a 96 well plate for 24 hours at 37°C in a 5% C0 2 incubator, followed by the addition of activated CAR T-cells in ratios of 20: 1 , 10: 1, 5: 1 and 1 : 1, and incubated for 24 hours at 37°C in a 5% C0 2 incubator.
- Cells are then lysed at 37°C for 45 mins and centrifuged at 1,250 rpm for 5 mins. The supernatant is transferred to a fresh 96 well plate, followed by the addition of the reaction mixture for 30 minutes.
- the reaction is the stopped using the stop solution and the plate read at 450nm with an absorbance correction at 650 nm.
- Foxnl null mice are injected with SKOV3, an ovarian tumor cell line which expresses LHR.
- Two x 106 cells in 200ul of phosphate buffered saline are injected into the left flank of the mice using a 0.2 mL inoculum.
- Naive T-cells are activated for 2 days using the aCD3/CD28 activator complex (Stem Cell Technologies, San Diego, C A).
- the activated T-cells are then transduced with the pLVX-LHR-CAR 1 en ti viral particles as described above, and activated for 2 days.
- 2.5 x 106 of the activated T-cells expressing the LHR CAR are injected intravenously into the mice on day 7 after tumor inoculation. Tumor sizes are assessed twice a week using Vernier calipers and the volume calculated.
- the cytolytic activity of the LHR CAR-T-cells was examined using the SKOV3 ovarian cancer cell line as target cells.
- SKOV3 was shown to express LHR by FACS analysis.
- CAR T-cells were added in ratios of 20:1, 10:1, 5:1 and 1:1 of effector cells to target cells. After 24 hours of incubation, the LHR CAR T-cells effectively lysed SKOV3 at a ratio of 10:1, showing a 30% lysis rate (FIG.11).
- uninduced T-cells did not show any cytotoxic activity at any of the ratios of effector cells to target cells used.
- RT-PCR using mRNA isolated from T-cells transduced with the LHR CAR show mRNA expression of the chimeric CAR (FIG.12).
- the RT-PCR was performed with primers that span the chimeric CAR between the CD8 hinge and the 4-1BB signaling domain, and is therefore highly specific to the expression of the CAR.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Molecular Biology (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Medicinal Chemistry (AREA)
- Biochemistry (AREA)
- Cell Biology (AREA)
- Biomedical Technology (AREA)
- Hematology (AREA)
- Urology & Nephrology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Epidemiology (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Toxicology (AREA)
- Biotechnology (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Oncology (AREA)
- Food Science & Technology (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- Microbiology (AREA)
- Endocrinology (AREA)
- Hospice & Palliative Care (AREA)
- Reproductive Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Neurology (AREA)
Priority Applications (10)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA2981142A CA2981142A1 (en) | 2015-03-27 | 2016-03-25 | Car t-cell therapy directed to lhr for the treatment of solid tumors |
| ES16773871T ES2904573T3 (es) | 2015-03-27 | 2016-03-25 | Terapia con células T dirigida a LHR para el tratamiento de tumores sólidos |
| EP16773871.5A EP3273994B1 (en) | 2015-03-27 | 2016-03-25 | Car t-cell therapy directed to lhr for the treatment of solid tumors |
| US15/561,967 US11136401B2 (en) | 2015-03-27 | 2016-03-25 | Car t-cell therapy directed to LHR for the treatment of solid tumors |
| CN201680024480.2A CN107530427A (zh) | 2015-03-27 | 2016-03-25 | 针对用于实体肿瘤的治疗的lhr的car t细胞疗法 |
| AU2016243124A AU2016243124A1 (en) | 2015-03-27 | 2016-03-25 | CAR T-cell therapy directed to LHR for the treatment of solid tumors |
| JP2017550493A JP2018518152A (ja) | 2015-03-27 | 2016-03-25 | 充実性腫瘍を処置するためのlhrに指向されたcar t細胞治療 |
| IL254701A IL254701A0 (en) | 2015-03-27 | 2017-09-26 | Car t-cell therapy directed to lhr for the treatment of solid tumors |
| US17/462,987 US20210403585A1 (en) | 2015-03-27 | 2021-08-31 | Car t-cell therapy directed to lhr for the treatment of solid tumors |
| US18/669,185 US20250129171A1 (en) | 2015-03-27 | 2024-05-20 | Car t-cell therapy directed to lhr for the treatment of solid tumors |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201562139623P | 2015-03-27 | 2015-03-27 | |
| US62/139,623 | 2015-03-27 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/561,967 A-371-Of-International US11136401B2 (en) | 2015-03-27 | 2016-03-25 | Car t-cell therapy directed to LHR for the treatment of solid tumors |
| US17/462,987 Continuation US20210403585A1 (en) | 2015-03-27 | 2021-08-31 | Car t-cell therapy directed to lhr for the treatment of solid tumors |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2016160618A2 true WO2016160618A2 (en) | 2016-10-06 |
| WO2016160618A3 WO2016160618A3 (en) | 2016-11-10 |
Family
ID=57007252
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2016/024354 Ceased WO2016160618A2 (en) | 2015-03-27 | 2016-03-25 | Car t-cell therapy directed to lhr for the treatment of solid tumors |
Country Status (9)
| Country | Link |
|---|---|
| US (3) | US11136401B2 (OSRAM) |
| EP (1) | EP3273994B1 (OSRAM) |
| JP (1) | JP2018518152A (OSRAM) |
| CN (1) | CN107530427A (OSRAM) |
| AU (1) | AU2016243124A1 (OSRAM) |
| CA (1) | CA2981142A1 (OSRAM) |
| ES (1) | ES2904573T3 (OSRAM) |
| IL (1) | IL254701A0 (OSRAM) |
| WO (1) | WO2016160618A2 (OSRAM) |
Cited By (15)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN107354199A (zh) * | 2017-07-04 | 2017-11-17 | 武汉波睿达生物科技有限公司 | 一种检测靶向cd30的cart细胞中car表达的荧光定量试剂盒 |
| WO2018057904A1 (en) * | 2016-09-23 | 2018-03-29 | University Of Southern California | Chimeric antigen receptors and compositions and methods of use thereof |
| WO2019060713A1 (en) * | 2017-09-22 | 2019-03-28 | Kite Pharma, Inc. | ANTIGEN-BINDING MOLECULES AND METHODS OF USE THEREOF |
| WO2019070740A3 (en) * | 2017-10-02 | 2019-05-09 | Fred Hutchinson Cancer Research Center | Luteinizing hormone receptor binding agents and luteinizing hormone agonists to identify, expand, ablate and modify stem cells |
| US10711064B2 (en) | 2015-06-04 | 2020-07-14 | University Of Southern California | Lym-1 and Lym-2 targeted CAR cell immunotherapy |
| US11136401B2 (en) | 2015-03-27 | 2021-10-05 | University Of Southern California | Car t-cell therapy directed to LHR for the treatment of solid tumors |
| WO2022081436A1 (en) * | 2020-10-15 | 2022-04-21 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Antibody specific for sars-cov-2 receptor binding domain and therapeutic methods |
| US11319380B2 (en) | 2018-06-04 | 2022-05-03 | Precigen, Inc. | MUC16 specific chimeric antigen receptors and uses thereof |
| JP2023026580A (ja) * | 2017-03-13 | 2023-02-24 | ポセイダ セラピューティクス,インコーポレイティド | 造血幹細胞の選択的除去と置換のための組成物と方法 |
| EP3864414A4 (en) * | 2018-10-13 | 2023-03-29 | Memorial Sloan-Kettering Cancer Center | METHODS AND COMPOSITIONS FOR THE IDENTIFICATION AND TREATMENT OF SUBJECTS AT RISK OF A POOR RESPONSE TO CAR T CELL THERAPY |
| US11667715B2 (en) | 2019-02-15 | 2023-06-06 | University Of Southern California | Lym-1 and Lym-2 antibody compositions and improved car constructs |
| US11883432B2 (en) | 2020-12-18 | 2024-01-30 | Century Therapeutics, Inc. | Chimeric antigen receptor system with adaptable receptor specificity |
| US12144827B2 (en) | 2021-02-25 | 2024-11-19 | Lyell Immunopharma, Inc. | ROR1 targeting chimeric antigen receptor |
| US12269859B2 (en) | 2016-12-02 | 2025-04-08 | Angeles Therapeutics, Inc. | Synthetic immune receptors and methods of use thereof |
| WO2025117530A3 (en) * | 2023-11-27 | 2025-08-14 | The Trustees Of Columbia University In The City Of New York | Tmem106b(120-254) aggregate-binding antibody |
Families Citing this family (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10501775B2 (en) | 2016-07-12 | 2019-12-10 | Kite Pharma, Inc. | Antigen binding molecules and methods of use thereof |
| AU2019327913A1 (en) * | 2018-08-29 | 2021-03-18 | Nanjing Legend Biotech Co., Ltd. | Anti-mesothelin chimeric antigen receptor (CAR) constructs and uses thereof |
| CA3125201A1 (en) * | 2019-01-06 | 2020-07-09 | Abintus Bio, Inc. | Car t cell methods and constructs |
| WO2020247837A1 (en) * | 2019-06-07 | 2020-12-10 | The Trustees Of The University Of Pennsylvania | Dual car expressing t cells individually linked to cd28 and 4-1bb |
| US20240288426A1 (en) * | 2020-01-12 | 2024-08-29 | Vanderbilt University | Human antibodies to crimean congo hemorrhagic fever virus |
| US20240173257A1 (en) * | 2020-07-07 | 2024-05-30 | THERMOSOME GmbH | Liposome formulations |
| CN113156142B (zh) * | 2021-04-16 | 2024-09-27 | 苏州才博医学科技有限公司 | 一种针对异体cart细胞特异性抗体的检测方法 |
Citations (53)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US707993A (en) | 1901-05-16 | 1902-08-26 | Clinton J Warren | Machine for corking bottles. |
| US3791932A (en) | 1971-02-10 | 1974-02-12 | Akzona Inc | Process for the demonstration and determination of reaction components having specific binding affinity for each other |
| US3817837A (en) | 1971-05-14 | 1974-06-18 | Syva Corp | Enzyme amplification assay |
| US3839153A (en) | 1970-12-28 | 1974-10-01 | Akzona Inc | Process for the detection and determination of specific binding proteins and their corresponding bindable substances |
| US3850578A (en) | 1973-03-12 | 1974-11-26 | H Mcconnell | Process for assaying for biologically active molecules |
| US3850752A (en) | 1970-11-10 | 1974-11-26 | Akzona Inc | Process for the demonstration and determination of low molecular compounds and of proteins capable of binding these compounds specifically |
| US3853987A (en) | 1971-09-01 | 1974-12-10 | W Dreyer | Immunological reagent and radioimmuno assay |
| US3867517A (en) | 1971-12-21 | 1975-02-18 | Abbott Lab | Direct radioimmunoassay for antigens and their antibodies |
| US3879262A (en) | 1972-05-11 | 1975-04-22 | Akzona Inc | Detection and determination of haptens |
| US3901654A (en) | 1971-06-21 | 1975-08-26 | Biological Developments | Receptor assays of biologically active compounds employing biologically specific receptors |
| US3935074A (en) | 1973-12-17 | 1976-01-27 | Syva Company | Antibody steric hindrance immunoassay with two antibodies |
| US3984533A (en) | 1975-11-13 | 1976-10-05 | General Electric Company | Electrophoretic method of detecting antigen-antibody reaction |
| US3996345A (en) | 1974-08-12 | 1976-12-07 | Syva Company | Fluorescence quenching with immunological pairs in immunoassays |
| US4034074A (en) | 1974-09-19 | 1977-07-05 | The Board Of Trustees Of Leland Stanford Junior University | Universal reagent 2-site immunoradiometric assay using labelled anti (IgG) |
| US4098876A (en) | 1976-10-26 | 1978-07-04 | Corning Glass Works | Reverse sandwich immunoassay |
| US4683195A (en) | 1986-01-30 | 1987-07-28 | Cetus Corporation | Process for amplifying, detecting, and/or-cloning nucleic acid sequences |
| WO1990002809A1 (en) | 1988-09-02 | 1990-03-22 | Protein Engineering Corporation | Generation and selection of recombinant varied binding proteins |
| WO1991010737A1 (en) | 1990-01-11 | 1991-07-25 | Molecular Affinities Corporation | Production of antibodies using gene libraries |
| WO1991017271A1 (en) | 1990-05-01 | 1991-11-14 | Affymax Technologies N.V. | Recombinant library screening methods |
| WO1992001047A1 (en) | 1990-07-10 | 1992-01-23 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| WO1992018619A1 (en) | 1991-04-10 | 1992-10-29 | The Scripps Research Institute | Heterodimeric receptor libraries using phagemids |
| WO1992022324A1 (en) | 1991-06-14 | 1992-12-23 | Xoma Corporation | Microbially-produced antibody fragments and their conjugates |
| WO1993011236A1 (en) | 1991-12-02 | 1993-06-10 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| WO1995015982A2 (en) | 1993-12-08 | 1995-06-15 | Genzyme Corporation | Process for generating specific antibodies |
| WO1995020401A1 (en) | 1994-01-31 | 1995-08-03 | Trustees Of Boston University | Polyclonal antibody libraries |
| WO1996006213A1 (en) | 1994-08-18 | 1996-02-29 | Short Brothers Plc | A bias yarn assembly forming device |
| US5516637A (en) | 1994-06-10 | 1996-05-14 | Dade International Inc. | Method involving display of protein binding pairs on the surface of bacterial pili and bacteriophage |
| WO1997008320A1 (en) | 1995-08-18 | 1997-03-06 | Morphosys Gesellschaft Für Proteinoptimierung Mbh | Protein/(poly)peptide libraries |
| US5686281A (en) | 1995-02-03 | 1997-11-11 | Cell Genesys, Inc. | Chimeric receptor molecules for delivery of co-stimulatory signals |
| US5698426A (en) | 1990-09-28 | 1997-12-16 | Ixsys, Incorporated | Surface expression libraries of heteromeric receptors |
| US5733743A (en) | 1992-03-24 | 1998-03-31 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| US5750753A (en) | 1996-01-24 | 1998-05-12 | Chisso Corporation | Method for manufacturing acryloxypropysilane |
| US5780225A (en) | 1990-01-12 | 1998-07-14 | Stratagene | Method for generating libaries of antibody genes comprising amplification of diverse antibody DNAs and methods for using these libraries for the production of diverse antigen combining molecules |
| US5821047A (en) | 1990-12-03 | 1998-10-13 | Genentech, Inc. | Monovalent phage display |
| US5858358A (en) | 1992-04-07 | 1999-01-12 | The United States Of America As Represented By The Secretary Of The Navy | Methods for selectively stimulating proliferation of T cells |
| US6352694B1 (en) | 1994-06-03 | 2002-03-05 | Genetics Institute, Inc. | Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells |
| US6534055B1 (en) | 1988-11-23 | 2003-03-18 | Genetics Institute, Inc. | Methods for selectively stimulating proliferation of T cells |
| US6692964B1 (en) | 1995-05-04 | 2004-02-17 | The United States Of America As Represented By The Secretary Of The Navy | Methods for transfecting T cells |
| US6753136B2 (en) | 1999-07-20 | 2004-06-22 | Morphosys Ag | Methods for displaying (poly) peptides/proteins on bacteriophage particles via disulfide bonds |
| WO2004061104A2 (en) | 2003-01-07 | 2004-07-22 | Symphogen A/S | Method for manufacturing recombinant polyclonal proteins |
| US6797514B2 (en) | 2000-02-24 | 2004-09-28 | Xcyte Therapies, Inc. | Simultaneous stimulation and concentration of cells |
| US6867041B2 (en) | 2000-02-24 | 2005-03-15 | Xcyte Therapies, Inc. | Simultaneous stimulation and concentration of cells |
| US6905680B2 (en) | 1988-11-23 | 2005-06-14 | Genetics Institute, Inc. | Methods of treating HIV infected subjects |
| US6905874B2 (en) | 2000-02-24 | 2005-06-14 | Xcyte Therapies, Inc. | Simultaneous stimulation and concentration of cells |
| US6924123B2 (en) | 1996-10-29 | 2005-08-02 | Oxford Biomedica (Uk) Limited | Lentiviral LTR-deleted vector |
| US7067318B2 (en) | 1995-06-07 | 2006-06-27 | The Regents Of The University Of Michigan | Methods for transfecting T cells |
| US7175843B2 (en) | 1994-06-03 | 2007-02-13 | Genetics Institute, Llc | Methods for selectively stimulating proliferation of T cells |
| US7419829B2 (en) | 2000-10-06 | 2008-09-02 | Oxford Biomedica (Uk) Limited | Vector system |
| US7442551B2 (en) | 2001-03-13 | 2008-10-28 | Novartis Ag | Lentiviral packaging constructs |
| US20120148552A1 (en) | 2008-08-26 | 2012-06-14 | City Of Hope | Method and compositions for enhanced anti-tumor effector functioning of t cells |
| US20130287748A1 (en) | 2010-12-09 | 2013-10-31 | The Trustees Of The University Of Pennsylvania | Use of Chimeric Antigen Receptor-Modified T-Cells to Treat Cancer |
| US20150017141A1 (en) | 2012-02-22 | 2015-01-15 | The Trustees Of The University Of Pennsylvania | Use of icos-based cars to enhance antitumor activity and car persistence |
Family Cites Families (27)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AT411997B (de) | 1999-09-14 | 2004-08-26 | Baxter Ag | Faktor ix/faktor ixa aktivierende antikörper und antikörper-derivate |
| DE60025022D1 (de) | 1999-09-27 | 2006-01-26 | Clifford L Librach | Nachweis von hla-g |
| KR20050083774A (ko) | 2002-10-16 | 2005-08-26 | 유로-셀티크 소시에떼 아노뉨 | 세포-연관된 ca 125/o772p에 결합하는 항체들 및그것의 용도의 방법들 |
| AU2004219603A1 (en) | 2003-03-11 | 2004-09-23 | Genentech, Inc. | Novel compositions and methods for the treatment of immune related disease |
| GB0408449D0 (en) | 2004-04-15 | 2004-05-19 | Banerjee Subhasis | Diagnostic and therapeutic applications of soluble lhcge protein |
| CN1331887C (zh) | 2004-08-20 | 2007-08-15 | 上海美恩生物技术有限公司 | 抗hla-dr10的淋巴瘤特异性嵌合单抗 |
| US20060063209A1 (en) | 2004-08-20 | 2006-03-23 | The Regents Of The University Of California | Engineered antibody fragment that irreversibly binds an antigen |
| WO2006055178A2 (en) | 2004-10-25 | 2006-05-26 | Merck & Co., Inc. | Anti-addl antibodies and uses thereof |
| WO2007058725A2 (en) | 2005-10-12 | 2007-05-24 | The Regents Of The University Of California | Engineered antibody fragment that irreversibly binds an antigen |
| US7858752B2 (en) | 2006-12-05 | 2010-12-28 | Abbott Laboratories | Recombinant antibodies against hepatitis C virus and methods of obtaining and using same |
| WO2010060186A1 (en) | 2008-11-03 | 2010-06-03 | Alethia Biotherapeutics Inc. | Antibodies that specifically block the biological activity of a tumor antigen |
| AU2010254136B2 (en) | 2009-05-26 | 2016-09-29 | Mount Sinai School Of Medicine | Monoclonal antibodies against influenza virus generated by cyclical administration and uses thereof |
| US8680055B2 (en) * | 2009-06-03 | 2014-03-25 | University Of Southern California | Methods for decreasing steroidogenesis in prostate cancer cells |
| JP5769316B2 (ja) * | 2009-08-06 | 2015-08-26 | イムナス・ファーマ株式会社 | Aβオリゴマーに特異的に結合する抗体およびその利用 |
| WO2012047427A2 (en) | 2010-08-31 | 2012-04-12 | The Regents Of The University Of California | Antibodies for botulinum neurotoxins |
| EP2651442B1 (en) * | 2010-12-14 | 2020-04-22 | University of Maryland, Baltimore | Universal anti-tag chimeric antigen receptor-expressing t cells and methods of treating cancer |
| WO2013154760A1 (en) | 2012-04-11 | 2013-10-17 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Chimeric antigen receptors targeting b-cell maturation antigen |
| US20130280220A1 (en) * | 2012-04-20 | 2013-10-24 | Nabil Ahmed | Chimeric antigen receptor for bispecific activation and targeting of t lymphocytes |
| EP2906598A1 (en) | 2012-10-09 | 2015-08-19 | Igenica Biotherapeutics, Inc. | Anti-c16orf54 antibodies and methods of use thereof |
| EP2730588A1 (en) | 2012-11-12 | 2014-05-14 | Intelectys | Antibodies and fragments thereof raised against the alpha-3 domain of HLA-G protein, methods and means for their preparation, and uses thereof |
| US9534044B2 (en) | 2013-02-28 | 2017-01-03 | United Arab Emirates University | Alpha-synuclein antibodies and uses thereof |
| US20140348744A1 (en) * | 2013-05-24 | 2014-11-27 | Jacek K. Pinski | Compositions and methods for regulating cancer-related signaling pathways |
| JP6288621B2 (ja) | 2013-08-23 | 2018-03-07 | 学校法人藤田学園 | インフルエンザウイルスに対する抵抗力の判定方法 |
| KR101605421B1 (ko) | 2014-03-05 | 2016-03-23 | 국립암센터 | B 세포 림프종 세포를 특이적으로 인지하는 단일클론항체 및 이의 용도 |
| EP3273994B1 (en) | 2015-03-27 | 2021-12-01 | University of Southern California | Car t-cell therapy directed to lhr for the treatment of solid tumors |
| US20190031759A1 (en) | 2015-04-30 | 2019-01-31 | Technion Research & Development Foundation Limited | Chimeric antigen receptors and methods of their use |
| KR102664453B1 (ko) | 2017-02-21 | 2024-05-10 | 주식회사 유틸렉스 | Hla-dr car-t 조성물 및 그를 제조하고 사용하는 방법 |
-
2016
- 2016-03-25 EP EP16773871.5A patent/EP3273994B1/en not_active Not-in-force
- 2016-03-25 ES ES16773871T patent/ES2904573T3/es active Active
- 2016-03-25 CA CA2981142A patent/CA2981142A1/en not_active Abandoned
- 2016-03-25 CN CN201680024480.2A patent/CN107530427A/zh active Pending
- 2016-03-25 WO PCT/US2016/024354 patent/WO2016160618A2/en not_active Ceased
- 2016-03-25 JP JP2017550493A patent/JP2018518152A/ja active Pending
- 2016-03-25 AU AU2016243124A patent/AU2016243124A1/en not_active Abandoned
- 2016-03-25 US US15/561,967 patent/US11136401B2/en active Active
-
2017
- 2017-09-26 IL IL254701A patent/IL254701A0/en unknown
-
2021
- 2021-08-31 US US17/462,987 patent/US20210403585A1/en not_active Abandoned
-
2024
- 2024-05-20 US US18/669,185 patent/US20250129171A1/en active Pending
Patent Citations (66)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US707993A (en) | 1901-05-16 | 1902-08-26 | Clinton J Warren | Machine for corking bottles. |
| US3850752A (en) | 1970-11-10 | 1974-11-26 | Akzona Inc | Process for the demonstration and determination of low molecular compounds and of proteins capable of binding these compounds specifically |
| US3839153A (en) | 1970-12-28 | 1974-10-01 | Akzona Inc | Process for the detection and determination of specific binding proteins and their corresponding bindable substances |
| US3791932A (en) | 1971-02-10 | 1974-02-12 | Akzona Inc | Process for the demonstration and determination of reaction components having specific binding affinity for each other |
| US3817837A (en) | 1971-05-14 | 1974-06-18 | Syva Corp | Enzyme amplification assay |
| US3901654A (en) | 1971-06-21 | 1975-08-26 | Biological Developments | Receptor assays of biologically active compounds employing biologically specific receptors |
| US3853987A (en) | 1971-09-01 | 1974-12-10 | W Dreyer | Immunological reagent and radioimmuno assay |
| US3867517A (en) | 1971-12-21 | 1975-02-18 | Abbott Lab | Direct radioimmunoassay for antigens and their antibodies |
| US3879262A (en) | 1972-05-11 | 1975-04-22 | Akzona Inc | Detection and determination of haptens |
| US3850578A (en) | 1973-03-12 | 1974-11-26 | H Mcconnell | Process for assaying for biologically active molecules |
| US3935074A (en) | 1973-12-17 | 1976-01-27 | Syva Company | Antibody steric hindrance immunoassay with two antibodies |
| US3996345A (en) | 1974-08-12 | 1976-12-07 | Syva Company | Fluorescence quenching with immunological pairs in immunoassays |
| US4034074A (en) | 1974-09-19 | 1977-07-05 | The Board Of Trustees Of Leland Stanford Junior University | Universal reagent 2-site immunoradiometric assay using labelled anti (IgG) |
| US3984533A (en) | 1975-11-13 | 1976-10-05 | General Electric Company | Electrophoretic method of detecting antigen-antibody reaction |
| US4098876A (en) | 1976-10-26 | 1978-07-04 | Corning Glass Works | Reverse sandwich immunoassay |
| US4683195A (en) | 1986-01-30 | 1987-07-28 | Cetus Corporation | Process for amplifying, detecting, and/or-cloning nucleic acid sequences |
| US4683195B1 (OSRAM) | 1986-01-30 | 1990-11-27 | Cetus Corp | |
| WO1990002809A1 (en) | 1988-09-02 | 1990-03-22 | Protein Engineering Corporation | Generation and selection of recombinant varied binding proteins |
| US5571698A (en) | 1988-09-02 | 1996-11-05 | Protein Engineering Corporation | Directed evolution of novel binding proteins |
| US5403484A (en) | 1988-09-02 | 1995-04-04 | Protein Engineering Corporation | Viruses expressing chimeric binding proteins |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US6905680B2 (en) | 1988-11-23 | 2005-06-14 | Genetics Institute, Inc. | Methods of treating HIV infected subjects |
| US6887466B2 (en) | 1988-11-23 | 2005-05-03 | Genetics Institute, Inc. | Methods for selectively stimulating proliferation of T cells |
| US6534055B1 (en) | 1988-11-23 | 2003-03-18 | Genetics Institute, Inc. | Methods for selectively stimulating proliferation of T cells |
| US7144575B2 (en) | 1988-11-23 | 2006-12-05 | The Regents Of The University Of Michigan | Methods for selectively stimulating proliferation of T cells |
| US7232566B2 (en) | 1988-11-23 | 2007-06-19 | The United States As Represented By The Secretary Of The Navy | Methods for treating HIV infected subjects |
| US5883223A (en) | 1988-11-23 | 1999-03-16 | Gray; Gary S. | CD9 antigen peptides and antibodies thereto |
| WO1991010737A1 (en) | 1990-01-11 | 1991-07-25 | Molecular Affinities Corporation | Production of antibodies using gene libraries |
| US5780225A (en) | 1990-01-12 | 1998-07-14 | Stratagene | Method for generating libaries of antibody genes comprising amplification of diverse antibody DNAs and methods for using these libraries for the production of diverse antigen combining molecules |
| US5580717A (en) | 1990-05-01 | 1996-12-03 | Affymax Technologies N.V. | Recombinant library screening methods |
| US5427908A (en) | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
| WO1991017271A1 (en) | 1990-05-01 | 1991-11-14 | Affymax Technologies N.V. | Recombinant library screening methods |
| WO1992001047A1 (en) | 1990-07-10 | 1992-01-23 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| US5698426A (en) | 1990-09-28 | 1997-12-16 | Ixsys, Incorporated | Surface expression libraries of heteromeric receptors |
| US5821047A (en) | 1990-12-03 | 1998-10-13 | Genentech, Inc. | Monovalent phage display |
| US5658727A (en) | 1991-04-10 | 1997-08-19 | The Scripps Research Institute | Heterodimeric receptor libraries using phagemids |
| WO1992018619A1 (en) | 1991-04-10 | 1992-10-29 | The Scripps Research Institute | Heterodimeric receptor libraries using phagemids |
| WO1992022324A1 (en) | 1991-06-14 | 1992-12-23 | Xoma Corporation | Microbially-produced antibody fragments and their conjugates |
| WO1993011236A1 (en) | 1991-12-02 | 1993-06-10 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US5733743A (en) | 1992-03-24 | 1998-03-31 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| US5858358A (en) | 1992-04-07 | 1999-01-12 | The United States Of America As Represented By The Secretary Of The Navy | Methods for selectively stimulating proliferation of T cells |
| WO1995015982A2 (en) | 1993-12-08 | 1995-06-15 | Genzyme Corporation | Process for generating specific antibodies |
| WO1995020401A1 (en) | 1994-01-31 | 1995-08-03 | Trustees Of Boston University | Polyclonal antibody libraries |
| US6905681B1 (en) | 1994-06-03 | 2005-06-14 | Genetics Institute, Inc. | Methods for selectively stimulating proliferation of T cells |
| US6352694B1 (en) | 1994-06-03 | 2002-03-05 | Genetics Institute, Inc. | Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells |
| US7175843B2 (en) | 1994-06-03 | 2007-02-13 | Genetics Institute, Llc | Methods for selectively stimulating proliferation of T cells |
| US5516637A (en) | 1994-06-10 | 1996-05-14 | Dade International Inc. | Method involving display of protein binding pairs on the surface of bacterial pili and bacteriophage |
| WO1996006213A1 (en) | 1994-08-18 | 1996-02-29 | Short Brothers Plc | A bias yarn assembly forming device |
| US5686281A (en) | 1995-02-03 | 1997-11-11 | Cell Genesys, Inc. | Chimeric receptor molecules for delivery of co-stimulatory signals |
| US6692964B1 (en) | 1995-05-04 | 2004-02-17 | The United States Of America As Represented By The Secretary Of The Navy | Methods for transfecting T cells |
| US7172869B2 (en) | 1995-05-04 | 2007-02-06 | The United States Of America As Represented By The Secretary Of The Navy | Methods for transfecting T cells |
| US7067318B2 (en) | 1995-06-07 | 2006-06-27 | The Regents Of The University Of Michigan | Methods for transfecting T cells |
| WO1997008320A1 (en) | 1995-08-18 | 1997-03-06 | Morphosys Gesellschaft Für Proteinoptimierung Mbh | Protein/(poly)peptide libraries |
| US5750753A (en) | 1996-01-24 | 1998-05-12 | Chisso Corporation | Method for manufacturing acryloxypropysilane |
| US6924123B2 (en) | 1996-10-29 | 2005-08-02 | Oxford Biomedica (Uk) Limited | Lentiviral LTR-deleted vector |
| US7056699B2 (en) | 1996-10-29 | 2006-06-06 | Oxford Biomedia (Uk) Limited | Lentiviral LTR-deleted vector |
| US6753136B2 (en) | 1999-07-20 | 2004-06-22 | Morphosys Ag | Methods for displaying (poly) peptides/proteins on bacteriophage particles via disulfide bonds |
| US6797514B2 (en) | 2000-02-24 | 2004-09-28 | Xcyte Therapies, Inc. | Simultaneous stimulation and concentration of cells |
| US6905874B2 (en) | 2000-02-24 | 2005-06-14 | Xcyte Therapies, Inc. | Simultaneous stimulation and concentration of cells |
| US6867041B2 (en) | 2000-02-24 | 2005-03-15 | Xcyte Therapies, Inc. | Simultaneous stimulation and concentration of cells |
| US7419829B2 (en) | 2000-10-06 | 2008-09-02 | Oxford Biomedica (Uk) Limited | Vector system |
| US7442551B2 (en) | 2001-03-13 | 2008-10-28 | Novartis Ag | Lentiviral packaging constructs |
| WO2004061104A2 (en) | 2003-01-07 | 2004-07-22 | Symphogen A/S | Method for manufacturing recombinant polyclonal proteins |
| US20120148552A1 (en) | 2008-08-26 | 2012-06-14 | City Of Hope | Method and compositions for enhanced anti-tumor effector functioning of t cells |
| US20130287748A1 (en) | 2010-12-09 | 2013-10-31 | The Trustees Of The University Of Pennsylvania | Use of Chimeric Antigen Receptor-Modified T-Cells to Treat Cancer |
| US20150017141A1 (en) | 2012-02-22 | 2015-01-15 | The Trustees Of The University Of Pennsylvania | Use of icos-based cars to enhance antitumor activity and car persistence |
Non-Patent Citations (63)
| Title |
|---|
| "GenBank", Database accession no. XM_009444056.1 |
| "Gene Transfer and Expression in Mammalian Cells", 2003 |
| "GeneBank", Database accession no. Y14837 |
| "Immunochemical Methods in Cell and Molecular Biology", 1987, COLD SPRING HARBOR LABORATORY |
| "Journal of Virology", vol. 72, 1998, pages: 5085 - 5092 |
| "Strategies for Protein Purification and Characterization: A Laboratory Course Manual", 1996, COLD SPRING HARBOR LABORATORY PRESS |
| "Uniprot", Database accession no. P01834 |
| ANDERSON, NUCLEIC ACID HYBRIDIZATION, 1999 |
| BARBAS III ET AL.: "Molecular Cloning: A Laboratory Manual", 2001, COLD SPRING HARBOR LABORATORY PRESS |
| BARRETT, D.M. ET AL., ANNU. REV. MED., vol. 65, 2014, pages 333 - 347 |
| BEATTY, G.L. ET AL., CANCER IMMUNOL. RES., vol. 2, 2014, pages 112 - 120 |
| BETTER ET AL., SCIENCE, vol. 240, 1988, pages 1041 - 1043 |
| BRINKMAN ET AL., J. IMMUNOL. METHODS, vol. 184, 1995, pages 177 - 186 |
| BURTON ET AL., ADVANCES IN IMMUNOLOGY, vol. 57, 1994, pages 191 - 280 |
| CHAUDHARY ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 87, 1990, pages 1066 - 1070 |
| CHEKMASOVA, A.A. ET AL., CLIN. CANCER RES., vol. 16, 2010, pages 3594 - 606 |
| CHEKMASOVA, A.A. ET AL., DISCOV. MED., vol. 9, 2010, pages 62 - 70 |
| CHU, C.S. ET AL., EXPERT REV. ANTICANCER THER., vol. 8, 2008, pages 243 - 257 |
| COTE ET AL., PROC. NATL. ACAD. SCI., vol. 80, 1983, pages 2026 - 2030 |
| FEDOROV, V.D. ET AL., CANCER J., vol. 20, 2014, pages 160 - 165 |
| FRESHNEY: "Culture of Animal Cells: A Manual of Basic Technique", 2005 |
| GALFREMILSTEIN, METHODS ENZYMOL, vol. 73, 1981, pages 3 - 46 |
| GEIGER, T. L. ET AL., BLOOD, vol. 98, 2001, pages 2364 - 2371 |
| HAMMERLING ET AL., MONOCLONAL ANTIBODIES AND T-CELL HYBRIDOMAS, 1981, pages 563 - 681 |
| HARLOWLANE: "Antibodies, A Laboratory Manual", 1988, COLD SPRING HARBOR PUBLICATIONS |
| HAYNES, N. M. ET AL., BLOOD, vol. 100, 2002, pages 3155 - 3163 |
| HAYNES, N. M. ET AL., J IMMUNOL, vol. 169, 2002, pages 5780 - 5786 |
| HOMBACH, A. ET AL., J IMMUNOL, vol. 167, 2001, pages 6123 - 6131 |
| HUSE ET AL., SCIENCE, vol. 256, 1989, pages 1275 - 1281 |
| HUSTON ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 349, 1988, pages 5879 - 5883 |
| J. GENE MED., vol. 14, 2012, pages 405 - 415 |
| JAKOBSEN, M.K. ET AL., J. IMMUNOTHER. EMPHASIS TUMOR IMMUNOL., vol. 17, 1995, pages 222 - 228 |
| JALKANEN, M. ET AL., J. CELL. BIOL., vol. 101, 1985, pages 976 - 985 |
| JALKANEN, M. ET AL., J. CELL. BIOL., vol. 105, 1987, pages 3087 - 3096 |
| JOURNAL OF VIROLOGY, vol. 73, 1999, pages 2886 - 2892 |
| KANDALAFT, L.E. ET AL., J. TRANSL. MED., vol. 10, 2012, pages 157 - 167 |
| KELLY, R.J. ET AL., MOL. CANCER THER., vol. 11, 2012, pages 517 - 525 |
| KETTLEBOROUGH ET AL., EUR. J. IMMUNOL., vol. 24, 1994, pages 952 - 958 |
| KLOSS, C.C. ET AL., NAT. BIOTECHNOL., vol. 31, 2013, pages 71 - 75 |
| KOHLERMILSTEIN, NATURE, vol. 256, 1975, pages 495 - 497 |
| KOZBOR ET AL., IMMUNOL. TODAY, vol. 4, 1983, pages 72 |
| LANITIS, E. ET AL., CANCER IMMUNOL. RES., vol. 1, 2013, pages 45 - 53 |
| LOU, Y. ET AL., CLIN. CANCER RES., vol. 14, 2008, pages 1494 - 1501 |
| MACPHERSON ET AL., PCR 2: A PRACTICAL APPROACH, 1995 |
| MACPHERSON ET AL.: "U.S. Department of Health and Human Services", 1991, OXFORD UNIVERSITY PRESS, article "Sequences of Proteins of Immunological Interest" |
| MADDOX ET AL., J. EXP. MED., vol. 158, 1983, pages 1211 - 1216 |
| MAHER, J. ET AL., NAT BIOTECHNOL, vol. 20, 2002, pages 70 - 75 |
| MAHER, J., ISRN ONCOL., vol. 2012, 2012, pages 278093 |
| MARCUS, C.S. ET AL., J. CANCER, vol. 5, 2014, pages 25 - 30 |
| MULLINAX ET AL., BIOTECHNIQUES, vol. 12, 1992, pages 864 - 869 |
| ORLANDI ET AL., PNAS, vol. 86, 1989, pages 3833 - 3837 |
| PERBAL, A PRACTICAL GUIDE TO MOLECULAR CLONING, 1984 |
| PERSIC ET AL., GENE, vol. 187, 1997, pages 9 - 18 |
| PINTO, R.D. ET AL., VET. IMMUNOL. IMMUNOPATHOL., vol. 110, 2006, pages 169 - 177 |
| PORTER, D.L. ET AL., NEJM, vol. 365, 2011, pages 725 - 733 |
| RAO, T.D. ET AL., APPL. IMMUNOHISTOCHEM. MOL. MORPHOLOGY, vol. 18, 2010, pages 462 - 472 |
| S. W. BURCHIEL ET AL., TUMOR IMAGING: THE RADIOCHEMICAL DETECTION OF CANCER, vol. 13, 1982 |
| SAWAI ET AL., AJRI, vol. 34, 1995, pages 26 - 34 |
| See also references of EP3273994A4 |
| SIEGEL, R. ET AL., CA CANCER J. CLIN., vol. 62, 2012, pages 10 - 29 |
| SINGH, R. ET AL., CANCER RES., vol. 67, 2007, pages 1887 - 1892 |
| WILKIE, S. ET AL., J. CLIN. IMMUNOL., vol. 32, 2012, pages 1059 - 1070 |
| WINTER, G. ET AL., NATURE, vol. 349, 1991, pages 293 - 299 |
Cited By (25)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11136401B2 (en) | 2015-03-27 | 2021-10-05 | University Of Southern California | Car t-cell therapy directed to LHR for the treatment of solid tumors |
| US10711064B2 (en) | 2015-06-04 | 2020-07-14 | University Of Southern California | Lym-1 and Lym-2 targeted CAR cell immunotherapy |
| WO2018057904A1 (en) * | 2016-09-23 | 2018-03-29 | University Of Southern California | Chimeric antigen receptors and compositions and methods of use thereof |
| IL265438B2 (en) * | 2016-09-23 | 2023-10-01 | Univ Southern California | Chimeric antigen receptors and compositions and methods of use thereof |
| EP3515493A4 (en) * | 2016-09-23 | 2020-08-19 | University of Southern California | CHEMERICAL ANTIGEN RECEPTORS, COORESPONDENT COMPOSITIONS AND METHODS OF USE |
| IL265438B1 (en) * | 2016-09-23 | 2023-06-01 | Univ Southern California | Chimeric antigen receptors and jewelry and methods for using them |
| US12269859B2 (en) | 2016-12-02 | 2025-04-08 | Angeles Therapeutics, Inc. | Synthetic immune receptors and methods of use thereof |
| JP2023026580A (ja) * | 2017-03-13 | 2023-02-24 | ポセイダ セラピューティクス,インコーポレイティド | 造血幹細胞の選択的除去と置換のための組成物と方法 |
| CN107354199A (zh) * | 2017-07-04 | 2017-11-17 | 武汉波睿达生物科技有限公司 | 一种检测靶向cd30的cart细胞中car表达的荧光定量试剂盒 |
| US10844371B2 (en) | 2017-09-22 | 2020-11-24 | Kite Pharma, Inc. | Antigen binding molecules and methods of use thereof |
| WO2019060713A1 (en) * | 2017-09-22 | 2019-03-28 | Kite Pharma, Inc. | ANTIGEN-BINDING MOLECULES AND METHODS OF USE THEREOF |
| US11834654B2 (en) | 2017-09-22 | 2023-12-05 | Kite Pharma, Inc. | Antigen binding molecules and methods of use thereof |
| US11786557B2 (en) | 2017-10-02 | 2023-10-17 | Fred Hutchinson Cancer Center | Luteinizing hormone receptor binding agents and luteinizing hormone agonists to identify, expand, ablate and modify stem cells |
| US12295973B2 (en) | 2017-10-02 | 2025-05-13 | Fred Hutchinson Cancer Center | Luteinizing hormone receptor binding agents and luteinizing hormone agonists to identify, expand, ablate and modify stem cells |
| WO2019070740A3 (en) * | 2017-10-02 | 2019-05-09 | Fred Hutchinson Cancer Research Center | Luteinizing hormone receptor binding agents and luteinizing hormone agonists to identify, expand, ablate and modify stem cells |
| US11976134B2 (en) | 2018-06-04 | 2024-05-07 | Precigen, Inc. | MUC16 specific chimeric antigen receptors and uses thereof |
| US11319380B2 (en) | 2018-06-04 | 2022-05-03 | Precigen, Inc. | MUC16 specific chimeric antigen receptors and uses thereof |
| US11981746B2 (en) | 2018-06-04 | 2024-05-14 | Precigen, Inc. | MUC16 specific chimeric antigen receptors and uses thereof |
| US11860163B2 (en) | 2018-10-13 | 2024-01-02 | Memorial Sloan-Kettering Cancer Center | Methods and compositions for identifying and treating subjects at risk for poor CAR T cell therapy response |
| EP3864414A4 (en) * | 2018-10-13 | 2023-03-29 | Memorial Sloan-Kettering Cancer Center | METHODS AND COMPOSITIONS FOR THE IDENTIFICATION AND TREATMENT OF SUBJECTS AT RISK OF A POOR RESPONSE TO CAR T CELL THERAPY |
| US11667715B2 (en) | 2019-02-15 | 2023-06-06 | University Of Southern California | Lym-1 and Lym-2 antibody compositions and improved car constructs |
| WO2022081436A1 (en) * | 2020-10-15 | 2022-04-21 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Antibody specific for sars-cov-2 receptor binding domain and therapeutic methods |
| US11883432B2 (en) | 2020-12-18 | 2024-01-30 | Century Therapeutics, Inc. | Chimeric antigen receptor system with adaptable receptor specificity |
| US12144827B2 (en) | 2021-02-25 | 2024-11-19 | Lyell Immunopharma, Inc. | ROR1 targeting chimeric antigen receptor |
| WO2025117530A3 (en) * | 2023-11-27 | 2025-08-14 | The Trustees Of Columbia University In The City Of New York | Tmem106b(120-254) aggregate-binding antibody |
Also Published As
| Publication number | Publication date |
|---|---|
| WO2016160618A3 (en) | 2016-11-10 |
| JP2018518152A (ja) | 2018-07-12 |
| EP3273994A2 (en) | 2018-01-31 |
| EP3273994B1 (en) | 2021-12-01 |
| US20250129171A1 (en) | 2025-04-24 |
| IL254701A0 (en) | 2017-11-30 |
| CA2981142A1 (en) | 2016-10-06 |
| US20180112003A1 (en) | 2018-04-26 |
| US20210403585A1 (en) | 2021-12-30 |
| EP3273994A4 (en) | 2018-09-05 |
| ES2904573T3 (es) | 2022-04-05 |
| CN107530427A (zh) | 2018-01-02 |
| US11136401B2 (en) | 2021-10-05 |
| AU2016243124A1 (en) | 2017-11-02 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20250129171A1 (en) | Car t-cell therapy directed to lhr for the treatment of solid tumors | |
| US20240392011A1 (en) | Hla-g as a novel target for car t-cell immunotherapy | |
| US20240336680A1 (en) | Novel cldn 18.2-specific monoclonal antibodies and methods of use thereof | |
| US20210147551A1 (en) | Lym-1 and lym-2 targeted car cell immunotherapy | |
| US20180118831A1 (en) | Car t-cells for the treatment of b7-h4 expressing solid tumors | |
| US20200016201A1 (en) | Chimeric antigen receptors and compositions and methods of use thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16773871 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 2017550493 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 15561967 Country of ref document: US Ref document number: 254701 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 2981142 Country of ref document: CA |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REEP | Request for entry into the european phase |
Ref document number: 2016773871 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2016243124 Country of ref document: AU Date of ref document: 20160325 Kind code of ref document: A |