WO2016109872A1 - Cxcr4 binding molecules - Google Patents

Cxcr4 binding molecules Download PDF

Info

Publication number
WO2016109872A1
WO2016109872A1 PCT/AU2016/050005 AU2016050005W WO2016109872A1 WO 2016109872 A1 WO2016109872 A1 WO 2016109872A1 AU 2016050005 W AU2016050005 W AU 2016050005W WO 2016109872 A1 WO2016109872 A1 WO 2016109872A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
cxcr4
polypeptide
sequence
amino acid
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/AU2016/050005
Other languages
English (en)
French (fr)
Inventor
Michael Foley
Andrew POW
Katherine Griffiths
Samantha COBB
Katerina VIDUKA
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Adalta Ltd
Original Assignee
Adalta Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from AU2015900054A external-priority patent/AU2015900054A0/en
Priority to HRP20220860TT priority Critical patent/HRP20220860T1/hr
Priority to SG11201705583XA priority patent/SG11201705583XA/en
Priority to EP16734863.0A priority patent/EP3242685B1/en
Priority to CA2973317A priority patent/CA2973317C/en
Priority to CN202210051480.9A priority patent/CN114478773A/zh
Priority to EP22171019.7A priority patent/EP4112077A1/en
Priority to AU2016206191A priority patent/AU2016206191B2/en
Priority to JP2017536271A priority patent/JP6863897B2/ja
Application filed by Adalta Ltd filed Critical Adalta Ltd
Priority to LTEPPCT/AU2016/050005T priority patent/LT3242685T/lt
Priority to CN201680010938.9A priority patent/CN107427574B/zh
Priority to ES16734863T priority patent/ES2924394T3/es
Priority to DK16734863.0T priority patent/DK3242685T3/da
Priority to US15/542,060 priority patent/US10538596B2/en
Publication of WO2016109872A1 publication Critical patent/WO2016109872A1/en
Anticipated expiration legal-status Critical
Priority to AU2017254863A priority patent/AU2017254863A1/en
Priority to AU2019203511A priority patent/AU2019203511B2/en
Priority to US16/719,125 priority patent/US11142588B2/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K17/00Carrier-bound or immobilised peptides; Preparation thereof
    • C07K17/02Peptides being immobilised on, or in, an organic carrier
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22Hormones
    • A61K38/2228Corticotropin releasing factor [CRF] (Urotensin)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/04Drugs for skeletal disorders for non-specific disorders of the connective tissue
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/10Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2866Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/569Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
    • G01N33/56983Viruses
    • G01N33/56988HIV or HTLV
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/575Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/567Framework region [FR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/569Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2318/00Antibody mimetics or scaffolds
    • C07K2318/20Antigen-binding scaffold molecules wherein the scaffold is not an immunoglobulin variable region or antibody mimetics
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/52Assays involving cytokines
    • G01N2333/521Chemokines
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/28Neurological disorders
    • G01N2800/285Demyelinating diseases; Multipel sclerosis
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/32Cardiovascular disorders
    • G01N2800/323Arteriosclerosis, Stenosis

Definitions

  • the present disclosure relates to polypeptides (also referred to herein as CXCR4 binding molecules or polypeptides) that are directed against the G-coupled protein receptor CXCR4, also known as Fusin or CD184.
  • the invention also relates to nucleic acids encoding such polypeptides; to methods for preparing such polypeptide; to compositions, and in particular to pharmaceutical compositions that comprise such polypeptides and to uses of such polypeptides for therapeutic or diagnostic purposes.
  • Chemokines are a family of structurally and functionally related small proteins that direct migration of cells (e.g., leukocytes and/or lymphocytes and/or stem cells and/or neurons) in addition to controlling other biological processes, such as angiogenesis, morphogenesis, autoimmunity, tumor growth and metastasis. Chemokines are grouped into families based on the presence and relative position of amino terminal cysteine residues (e.g. CC, CXC, CX 3 C and C chemokines). Generally, the biological activity of a chemokine is mediated by a cell surface receptor, in particular a 7-transmembrane-domain G protein-coupled receptor (GPCR). The chemokine receptors are grouped and named according to the family of chemokine(s) to which they bind.
  • GPCR 7-transmembrane-domain G protein-coupled receptor
  • CXCR4 One member of the CXCR family is CXCR4 that is predominantly expressed on lymphocytes and that activates chemotaxis.
  • CXCR4 also called fusin, is an alpha-chemokine receptor specific for stromal-derived-factor-1 (SDF-1 , also called CXCL12), a molecule endowed with potent chemotactic activity for lymphocytes.
  • SDF-1 stromal-derived-factor-1
  • CXCR4 plays a role in embryogenesis, homeostasis, fibrosis and inflammation.
  • CXCR4/SDF-1 pathway has been implicated in organ vascularisation, as well as in the immune and hematopoietic systems (Tachibana K et al. (1998) Nature 393:591 -594). Drugs that block the CXCR4 receptor appear to be capable of "mobilising" hematopoietic stem cells into the blood stream as peripheral blood stem cells. CXCR4 has also been shown to function as a co- receptor for T lymphorophic HIV-1 isolates (Geng Y et al. (1996) Science 272:872-877). CXCR4 has also been shown to be expressed on a wide variety of cancer cell types and to be involved in stimulating the metastatic process in many different neoplasms (Murphy PM (20001 ) N. Eng. J. Med. 345:833-835).
  • G-protein coupled receptors are currently the most important class of therapeutic targets, and antibodies directed against them are highly sought for therapeutic, diagnostic and research purposes. Despite substantial interest in these targets, high-quality antibodies or binding agents against membrane proteins have been challenging to generate using conventional means.
  • binding agents to CXCR4 have previously been described, including whole antibodies (e.g. Medarex), antibody fragments and single-domain antibodies (Ablynx), however the present binding agents provide an alternative construct which alleviates some of the drawbacks of antibodies, for example, Fc-mediated effects as well as high production costs, low stability and their large size, which reduce their utility for tumor penetration.
  • the binding agents of the present invention provide an alternative to small molecule agents such as Plerixafor (Mozobil or AMD3100) which is currently indicated for peripheral blood stem cell mobilisation in combination with granulocyte colony stimulating factor (G-CSF) in patients with non-Hodgkins' lymphoma (NHL) and multiple myeloma (MM).
  • Plerixafor Mozobil or AMD3100
  • G-CSF granulocyte colony stimulating factor
  • the present disclosure relates to CXCR4 binding molecules or polypeptides, referred to as "i-bodies" in the examples described herein. These i-bodies bind to native human CXCR4 expressed on a cell surface.
  • the i-bodies of the present disclosure can be used to modulate, and in particular inhibit or prevent CXCR4 mediated signalling and/or to modulate the biological pathways in which CXCR4 is involved and/or to modulate the biological mechanisms, responses and effects associated with such signalling.
  • the i-bodies of the present disclosure can be used for the prevention and treatment of CXCR4-related diseases and disorders.
  • CXCR4 binding molecules or i-bodies of the present disclosure provide advantages over other binding agents such as traditional antibodies.
  • the i-bodies of the present disclosure are able to bind to their target with high affinity and high specificity but their smaller size and stability are advantageous when compared to traditional therapeutic antibodies, polypeptides or peptides.
  • I-bodies are also more stable molecules than conventional antibodies which leads to alternative routes of administration and to lower dose form, less frequent dosage, and less side effects
  • l-bodies are also smaller in size and therefore can penetrate tissues, organs and areas such as the bone matrix and micro-tumor environment that other large proteins may not be able to penetrate
  • l-bodies also have a long CDR3 binding loop that is able to penetrate grooves and clefts unlike traditional monoclonal antibodies.
  • the i-bodies of the present disclosure are able to bind deep into the pocket of the CXCR4 G-protein coupled receptor (GPCR).
  • GPCR G-protein coupled receptor
  • the i-body is ideally suited for tailoring half life which will have advantages when used as an imaging agent or in the delivery of a required dose for a set period of time.
  • the i-body also provides the delivery of a pay-load to the target through conjugation to the identified polypeptide.
  • the inventors have found that the CXCR4 binding polypeptides/i-bodies of the present disclosure have features that distinguish them over other inhibitor/antagonist CXCR4 binding molecules known in the art.
  • the CXCR4 binding polypeptides/i- bodies of the present disclosure do not cause stem cell mobilisation. Additionally, the CXCR4 binding polypeptides/i-bodies of the present disclosure do not inhibit calcium flux.
  • the present disclosure provides a polypeptide which comprises a scaffold region and complementarity determining regions (CDR1 and CDR3) contained therein, wherein the scaffold region comprises a sequence which has at least 75% identity to the scaffold region defined by amino acids 1 to 26, 33 to 79 and 88 to 97 of SEQ ID NO:1 and wherein the CDR1 and CDR3 region defined by amino acids 27 to 32 and 80-87 respectively of SEQ ID NO:1 are modified by amino acid addition or substitution therein and wherein the polypeptide binds to human CXCR4.
  • CDR1 and CDR3 complementarity determining regions
  • polypeptide comprises the sequence set forth in SEQ ID NO:2 ( Figure 1 B) or the sequence set forth in SEQ ID NO:2 or the sequence set forth in SEQ ID NO:2 comprising between 1 and 5 amino acid additions or substitution therein.
  • the CDR1 region consists of a random sequence of six consecutive amino acid residues (designed XXXXX in Figure 1 B) and the CDR3 region is represented by Y'n (in Figure 1 B), wherein Y is any amino acid residue and n is any number between 10 and 20 amino acids inclusive.
  • the CDR1 and/or CDR3 regions of SEQ ID NO:2 are modified by amino acid addition and/or substitution relative to the corresponding CDR1 and/or CDR3 regions in SEQ ID NO:1 .
  • amino acid A' at position 23 of SEQ ID NO:2 is the amino acid glutamine (Q) or lysine (K).
  • the amino acid B' at postion 24 of SEQ ID NO:2 is the amino acid valine (V) or alanine (A).
  • A' is Q and B' is V in SEQ ID NO:2.
  • the polypeptide may further comprise between 1 and 4 consecutive N-terminal amino acids selected from the group consisting of M, EAEA, MA or MP.
  • polypeptide binds to human CXCR4. In a further example, the polypeptide is an antagonist of human CXCR4.
  • the polypeptide binds to human CXCR4 with an affinity of less than 50uM, less than 20uM, less than 10uM, less than 1 ⁇ , less than 850 nM, less than 700 nM, less than 600 nM, less than 500 nM, less than 300 nM, less than 1 00 nM, less than 50 nM, less than 25 nM, less than 20 nM, less than 15 nM, less than 10 nM, or less than 5 nM.
  • the polypeptide binds to human CXCR4 with an affinity of about 700 nM.
  • the polypeptide binds to human CXCR4 with an affinity of less than 700nM.
  • the scaffold region comprises a sequence which has at least 80%, or at least 85%, or at least 90%, or at least 95%, or at least 97%, or at least 98%, at least 99% identity, or 100% identity to SEQ ID NO:1 at positions 1 to 26, 33-79 and 88-97.
  • the scaffold region comprises a sequence which has at least 80%, or at least 85%, or at least 90%, or at least 95%, or at least 97%, or at least 98%, at least 99% homology, or 100% homology to SEQ ID NO:1 at positions 1 to 26, 33-79 and 88-97.
  • polypeptide according to SEQ ID NO:1 or SEQ ID NO:2 is modified by one or more amino acid substitutions.
  • the CDR1 and CDR3 region is modified by one or more amino acid substitutions. In another embodiment the CDR1 and/or CDR3 region is modified by replacement with a random loop sequence.
  • the CDR3 region comprises or consists of a sequence having at least 70% identity, or at least 80% identity, or at least 90% identity, or at least 95% identity, or at least 97% identity, or at least 98% identity, or at least 99% identity, or 100% identity to SEQ ID NO: 13, SEQ ID NO: 16, SEQ ID NO: 19, SEQ ID NO: 22, SEQ ID NO: 25, SEQ ID NO: 28, or SEQ ID NO: 31 .
  • the CDR3 region comprises or consists of a sequence having at least 70% homology, or at least 80% homology, or at least 90% homology, or at least 95% homology, or at least 97% homology, or at least 98% homology, or at least 99% homology, or 100% homology to SEQ ID NO: 13, SEQ ID NO: 16, SEQ ID NO: 1 9, SEQ ID NO: 22, SEQ ID NO: 25, SEQ ID NO: 28, or SEQ ID NO: 31 .
  • CDR3 region comprises or conists of a sequence having at least one, two, three, four, five or six substitutions within a sequence selected from SEQ ID NO: 13, SEQ ID NO: 16, SEQ ID NO: 19, SEQ ID NO: 22, SEQ ID NO: 25, SEQ ID NO: 28, or SEQ ID NO: 31 .
  • CDR3 region comprises or consists of SEQ ID NO: 13.
  • the CDR1 region comprises or conists of a sequence having at least 50% identity, or at least 65% identity, or at least 80% identity, or 100% identity to SEQ ID NO: 12, SEQ ID NO: 15, SEQ ID NO: 18, SEQ ID NO: 21 , SEQ ID NO: 24, SEQ ID NO: 27, or SEQ ID NO: 30.
  • the CDR1 region comprises or consists of a sequence having at least 50% homology, or at least 65% homology, or at least 80% homology, or 100% homology to SEQ ID NO: 12, SEQ ID NO: 15, SEQ ID NO: 18, SEQ ID NO: 21 , SEQ ID NO: 24, SEQ ID NO: 27, or SEQ ID NO: 30.
  • CDR1 region comprises or consists of a sequence having at least one, two or three substitutions within SEQ ID NO: 12, SEQ ID NO: 1 5, SEQ ID NO: 18, SEQ ID NO: 21 , SEQ ID NO: 24, SEQ ID NO: 27, or SEQ ID NO: 30.
  • the CDR1 region comprises or consists of SEQ ID NO: 12.
  • polypeptide comprises:
  • CDR3 region sequence having at least 70% homology to SEQ ID NO: 16; (v) a CDR1 region sequence having at least 50% identity to SEQ ID NO: 1 8 and a
  • CDR3 region sequence having at least 70% homology to SEQ ID NO: 19;
  • CDR3 region sequence having at least 70% homology to SEQ ID NO: 22;
  • CDR3 region sequence having at least 70% homology to SEQ ID NO: 25; (xi) a CDR1 region having at least 50% identity to SEQ ID NO: 27 and a CDR3 region sequence having at least 70% identity to SEQ ID NO: 28;
  • CDR3 region sequence having at least 70% homology to SEQ ID NO: 28; (xiii) a CDR1 region sequence having at least 50% identity to SEQ ID NO: 30 and a
  • CDR3 region sequence having at least 70% identity to SEQ ID NO: 31 ; or (xiv) a CDR1 region sequence having at least 50% homology to SEQ ID NO: 30 and a
  • the polypeptide comprises a sequence that has at least 80% identity, at least 90% identity, or at least 95% identity, or at least 97% identity, or at least 98% identity, or at least 99% identity to SEQ ID NO: 1 1 , SEQ ID NO: 14, SEQ ID NO: 1 7, SEQ ID NO: 20, SEQ ID NO: 23, SEQ ID NO: 26, or SEQ ID NO: 29.
  • the polypeptide comprises a sequence that has at least 70% homology, or at least 80% homology, or at least 90% homology, or at least 95% homology, or at least 98% homology, or at least 99% homology to SEQ ID NO: 1 1 , SEQ ID NO: 14, SEQ ID NO: 17, SEQ ID NO: 20, SEQ ID NO: 23, SEQ ID NO: 26, or SEQ ID NO: 29.
  • the polypeptide comprises a sequence set forth in any one of SEQ ID NO: 1 1 , SEQ ID NO: 14, SEQ ID NO: 17, SEQ ID NO: 20, SEQ ID NO: 23, SEQ ID NO: 26, or SEQ ID NO: 29.
  • polypeptide comprises one, two, three, four, five, six, seven, eight, nine or ten substitutions within the sequence selected from the group consisting of SEQ ID NO: 1 1 , SEQ ID NO: 14, SEQ ID NO: 17, SEQ ID NO: 20, SEQ ID NO: 23, SEQ ID NO: 26, SEQ ID NO: 29, SEQ ID NO:40, SEQ ID NO:44, SEQ ID NO:48, SEQ ID NO:52, SEQ ID NO:56, SEQ ID NO:60, SEQ ID NO:64, SEQ ID NO:68, SEQ ID NO:72, or SEQ ID NO: 76.
  • polypeptide comprises or consists of SEQ ID NO: 1 1 .
  • polypeptide comprises a CDR1 region comprising a sequence represented by the formula SX 1 SX 2 XsR wherein
  • X ! is G, K, L or Y;
  • X 2 is D, H, G or N;
  • X 3 is is I, V, M, F, Q or Y;
  • the CDR1 region comprises or consists of the sequence set forth in any one of SEQ ID NO: 41 , SEQ ID NO: 45, SEQ ID NO: 49, SEQ ID NO: 53, SEQ ID NO:57, SEQ ID NO:61 , SEQ ID NO:65, SEQ ID NO:69, SEQ ID NO: 73, or SEQ ID NO:77.
  • the polypeptide comprises a CDR3 region comprises a sequence represented by the formula ⁇ RY ⁇ GY'sYRHRY ⁇ LY'sLG wherein. ⁇ is Y or W ;
  • Y'z is T, V or I
  • Y' 3 is G or A
  • Y' 4 is A or Y
  • Y's is V, R or K
  • the CDR3 region comprises or consists of the sequence set forth in any one of SEQ ID NO: 42, SEQ ID NO: 46, SEQ ID NO: 50, SEQ ID NO: 54, SEQ ID NO: 58, SEQ ID NO: 62, SEQ ID NO: 66, SEQ ID NO: 70, SEQ ID NO: 74, or SEQ ID NO: 78.
  • the polypeptide comprises a sequence at least 70% identical to a sequence selected from the group consisting of SEQ ID NO: 40, SEQ ID NO: 44, SEQ ID NO: 48, SEQ ID NO: 52, SEQ ID NO: 56, SEQ ID NO: 60, SEQ ID NO: 64, SEQ ID NO: 68, SEQ ID NO: 72 or SEQ ID NO: 76.
  • the polypeptide comprises a sequence at least 75%, 80%, 85%, 87%, 90%, 93%, 95%, 98%, or 99% identical to a sequence selected from the group consisting of SEQ ID NO: 40, SEQ ID NO: 44, SEQ ID NO: 48, SEQ ID NO: 52, SEQ ID NO: 56, SEQ ID NO: 60, SEQ ID NO: 64, SEQ ID NO: 68, SEQ ID NO: 72 or SEQ ID NO: 76.
  • polypeptide comprises a sequence represented by the sequence
  • A' is Q or K
  • B' is V or A
  • X ! is G, K, L or Y;
  • X 2 is D, H, G or N;
  • X 3 is I, V, M, F, Q or Y;
  • is Y or W ;
  • Y'z is T, V or I
  • Y' 3 is G or A
  • Y' 4 is A or Y
  • Y's is V, R or K
  • Z is an amino acid(s) selected from M, EAEA, MA or MP or is absent.
  • the polypeptide comprises or consists of the sequence set forth in any one of SEQ ID NO: 40, SEQ ID NO: 44, SEQ ID NO: 48, SEQ ID NO: 52, SEQ ID NO: 56, SEQ ID NO: 60, SEQ ID NO: 64, SEQ ID NO: 68, SEQ ID NO: 72 or SEQ ID NO: 76.
  • polypeptide comprises or consists of the sequence set forth in SEQ ID NO: 40.
  • the K D of the polypeptide for human CXCR4 is between about 0.01 nM to about 700nM, such as between about 0.05nM to about 500nM, for example between about
  • 0.1 nM to about 100nM for example between about 1 nM to about 50nM, between about 5nM to about 30nM, between about 10nM to about 20nM or between about 3nM to about 16nM,
  • polypeptide binds to human CXCR4 with an affinity between
  • polypeptide binds to human CXCR4 with an affinity between 3nM and 5nM.
  • the K D is assessed by immobilizing the human CXCR4 and assessing binding of the polypeptide to the immobilized human CXCR4 using surface plasmon resonance. In one example, the assessment of binding of the polypeptide is to immobilised
  • An exemplary polypeptide of the disclosure has a K D of about 5nM (e.g., +/- 1 nM) for human CXCR4.
  • association rate (Ka) is between about 1 x10 4 M “ 1 s “ 1 to about 10x10 5 M “ 1 s “1 , for example between about 5x1 0 4 M “ V 1 to about 8.5x10 5 M “ V 1 , for example, between about 1 x10 5 M “ V 1 to about 6x1 0 5 M “ V 1 , for example between 6x1 0 5 M “ V 1 to 1 x10 6 M " V
  • the Ka is assessed by immobilizing the human CXCR4 and assessing binding of the molecule to the immobilized human CXCR4 using surface plasmon resonance.
  • the dissociation rate (Kd) is between about 0.005M " V 1 to about 0.9 M " V 1 , for example between about 0.02 M ' V 1 to about 0.7 M ' V 1 , for example between about 0.2 MV and 0.55 IvlV.
  • An exemplary polypeptide of the disclosure has a K a of about 1 .297x10 6 M " V 1 .
  • a further exemplary binding polypeptide of the disclosure has a K d of about 0.00629M " V 1 .
  • the Ka and Kd are assessed by immobilizing a lipoparticle expressing human CXCR4 and assessing binding of the polypeptide to the immobilized lipoparticle expressing human CXCR4 using surface plasmon resonance.
  • Residues involved in the binding of the polypeptides of the present disclosure to CXCR4 have been determined and are disclosed herein.
  • the disclosure provides a CXCR4 binding polypeptide as described herein, that binds to one or more core residues of human CXCR4 selected from the group consisting of E32, Y184, F189, W195, D262 and L266 or combinations of any of these.
  • the residue is selected from the group consisting of E32K, Y184S, F189L, W195R, D262G and L266H or a combination of any of these.
  • the disclosure provide a CXCR4 binding polypeptide as described herein that binds to one or more residues of CXCR4 selected from the group consisting of C28, V1 12, D1 93, P191 , E268 and E288 or combinations of any of these.
  • the residue is selected from the group consisting of C28W, V1 12A, D193G, P1 91 T, E268K and E288G or a combination of any of these.
  • the amino acid residues being substituted are numbered according to the canonical sequence of human CXCR4 having Uniprot sequence identifier number P61073-1 (SEQ ID NO: 105).
  • the CXCR4 binding polypeptides contact the same residues that have been shown to be responsible for the binding of small molecules such as AMD3100 indicating that the CXCR4 binding polypeptides can penetrate deep into the CXCR4 binding pocket.
  • the polypeptide binds to the D262 position of CXCR4.
  • the polypeptide of the present disclosure can generally be used to modulate CXCR4 mediated signalling, and/or to modulate the biological pathways in which CXCR4 is involved, and/or to modulate the biological mechanisms, responses and effects associated with such signalling or these pathways.
  • polypeptide can be used to modulate (i.e. inhibit, prevent, stimulate or boost) one or more of the following activities:
  • tumor cell proliferation may be increased or decreased by at least 30% preferably at least 50% or at least 60%, or 70% or 75%, or 80% or 90% or more, compared to the differentiation and or proliferation of tumor cells under the same condition without the presence of the polypeptide.
  • the polypeptide can be used to inhibit tumor cell proliferation in a tumor cell proliferation assay with an IC 50 of less than 600nM, less than 500nM, less than 200nM, less than 100nM, less than 50nM, less than 25nM, less that 10nM or less than 5nM.
  • the tumor cell proliferation assay is a 5-bromo-2'-deoxyuridine cell proliferation or CTG (CellTiter-Glo®) assay.
  • the inhibition of tumor cell proliferation is determined by way of MTT assay.
  • induction of apoptosis in cells expressing CXCR4 by the polypeptide of the present disclosure can be measured by caspase assay, tunnel and DNA fragmentation assay, cell permeability assay, annexin V assay, protein cleavage assay and mitochondrial and ATP/ADP assay.
  • caspase assay tunnel and DNA fragmentation assay
  • cell permeability assay cell permeability assay
  • annexin V assay protein cleavage assay
  • mitochondrial and ATP/ADP assay mitochondrial and ATP/ADP assay.
  • the polypeptide of the present disclosure can be used inhibit metastases of CXCR4 + tumor cells, for example in a metastatic breast cancer model with cells expressing CXCR4, for example MDA-MB-231 or MDA-MB-468 cells.
  • the present disclosure also provides a method of inhibiting metastasis of a cancer cell expressing CXCR4.
  • polypeptide of present disclosure can be used to inhibit SDF-1 induced migration of cells expressing CXCR4, for example in CEM, MDA-MB-231 , MDA-MB- 468, PC3 and Ramos cells.
  • the polypeptide of the present disclosure can be used to inhibit angiogenesis, which can be measured in a capillary tube formation assay, for example with HUVEC cells or MDA-MB-231 cells.
  • polypeptide of the present disclosure is used in the treatment or prevention of a CXCR4-related disease or disorder in a subject.
  • the human CXCR4 to which the polypeptide binds may be in monomeric, dimeric or multimeric form.
  • the human CXCR4 may be in the form of a heterodimer.
  • CXCR heterodimers that have been described include CXCR4/CXCR7 (Levoye et al Blood 2009 1 13; 6085- 6093), CXCR4/CCR2 (Sohy et al J Biol Chem. 2007 282; 30062- 30069), CXCR4/ P2AR ( ⁇ 2 adrenergic receptor) (La Rocca et al J Cardiovasc Pharmacol. 2010 56; 548-559), CXCR4/CCR5 (Sohy et al J Biol Chem.
  • CXCR4/ DOR Delta opiod receptor
  • T cell receptor Kremer et al J. Immunol. 201 1 187; 1440- 1447.
  • polypeptide of the present disclosure binds to a transmembrane or other domain which influences the structure of CXCR4.
  • polypeptide of the present disclosure specifically binds to any suitable extracellular part, region, domain, loop or extracellular epitope of CXCR4. In one example, the polypeptide specifically binds to one of the extracellular parts of the transmembrane domains or to one of the extracellular loops that links the transmembrane domains.
  • polypeptide of the disclosure is PEGylated.
  • present disclosure also provides a nucleic acid molecule encoding a polypeptide described herein.
  • the nucleic acid molecule comprises a sequence that has at least 80% identity, at least 90% identity, or at least 95% identity, or at least 97% identity, or at least 98% identity, or at least 99% identity, or 100% identity to any one of SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 43, SEQ ID NO: 47, SEQ ID NO: 51 , SEQ ID NO: 55, SEQ ID NO: 59, SEQ ID NO: 63, SEQ ID NO: 67, SEQ ID NO: 71 , SEQ ID NO: 75, or SEQ ID NO: 79.
  • the nucleic acid molecule comprises a sequence that has at least 80% homology, at least 90% homology, or at least 95% homology, or at least 97% homology, or at least 98% homology, or at least 99% homology, or 100% homology to any one of SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 43, SEQ ID NO: 47, SEQ ID NO: 51 , SEQ ID NO: 55, SEQ ID NO: 59, SEQ ID NO: 63, SEQ ID NO: 67, SEQ ID NO: 71 , SEQ ID NO: 75, or SEQ ID NO: 79.
  • the nucleic acid molecule encodes a poypeptide selected from the group consisting of SEQ ID NO: 40, SEQ ID NO: 44, SEQ ID NO: 48, SEQ ID NO: 52, SEQ ID NO: 56, SEQ ID NO: 60, SEQ ID NO: 64, SEQ ID NO: 68, SEQ ID NO: 72, or SEQ ID NO: 76.
  • the present disclosure also provides an expression construct comprising a nucleic acid molecule described herein.
  • the present disclosure also provides a host cell comprising the nucleic acid molecule or expression construct described herein.
  • the present disclosure also provides a method of producing a polypeptide of the present disclosure which comprises culturing a host cell under conditions enabling expression of the polypeptide and recovering the polypeptide.
  • the present disclosure also provides a conjugate (e.g. immunoconjugate) comprising a polypeptide described herein and an agent.
  • a conjugate e.g. immunoconjugate
  • the agent may be, for example, a therapeutic agent, a toxin, a detectable label or an agent which extends the half life of the polypeptide.
  • the agent is polyethylene glycol (PEG).
  • the agent is a consecutive sequence of Pro-Ala-Ser (PAS).
  • the agent which extends the half life of the polypeptide binds to a serum protein (e.g. albumin) or an Fc portion of an immunoglobulin.
  • a serum protein e.g. albumin
  • an Fc portion of an immunoglobulin e.g. albumin
  • polypeptide of the invention may be linked to a toxin or cytotoxic drug for delivery to cells such as tumour cells.
  • polypeptide of the invention may be linked to a label such as a radioisotope.
  • the present disclosure also provides a multimer comprising two or more polypeptides described herein.
  • the polypeptides may comprise the same or different amino acid sequences.
  • at least two polypeptides are directly linked via a suitable linker or sequence or spacer.
  • the linker or spacer can be between 1 and 50 amino acids.
  • a suitable linker is a GS9 linker or GS15 linker or a GS20 linker.
  • the present disclosure also provides for multivalent or multispecific polypeptides (including bi-specific polypeptides).
  • the disclosure provides a polypeptide of the present disclosure linked to a polypeptide directed to a target other than CXCR4, including by not limited to, human serum albumin to increase half-life, CD3, CD64, CD16 or CD89 to redirect and activate any circulating T cells against tumors.
  • the multispecific polypeptide is a bi-specific polypeptide which binds to CXCR4 and human serum albumin (HSA), the polypeptide comprising the sequence of SEQ ID NO:80.
  • the present disclosure also provides a pharmaceutical composition
  • a pharmaceutical composition comprising a polypeptide or a conjugate or a multimer as described herein and an acceptable carrier.
  • the present disclosure also provides a polypeptide, a conjugate or a multimer according to the present disclosure for use in the treatment or prevention of a CXCR4-related disease or disorder, the polypeptide comprising a sequence selected from the group consisting of SEQ ID NO: 1 1 , SEQ ID NO:14, SEQ ID NO:17, SEQ ID NO:20, SEQ ID NO:23, SEQ ID NO:26, SEQ ID NO:29, SEQ ID NO: 40, SEQ ID NO: 44, SEQ ID NO: 48, SEQ ID NO: 52, SEQ ID NO: 56, SEQ ID NO: 60, SEQ ID NO: 64, SEQ ID NO: 68, SEQ ID NO: 72, or SEQ ID NO: 76.
  • polypeptide of the present disclosure binds specifically to human CXCR4.
  • the present disclosure also provides a method of preventing or treating a CXCR4- related disease or disorder or a disease or disorder associated with CXCR4 signalling or a pathway or mechanism in which CXCR4 is involved, comprising administering to a subject in need thereof a polypeptide or a conjugate or a multimer of the present disclosure.
  • the polypeptide comprises a sequence selected from the group consisting of SEQ ID NO: 1 1 , SEQ ID NO:14, SEQ ID NO:17, SEQ ID NO:20, SEQ ID NO:23, SEQ ID NO:26, SEQ ID NO:29, SEQ ID NO: 40, SEQ ID NO: 44, SEQ ID NO: 48, SEQ ID NO: 52, SEQ ID NO: 56, SEQ ID NO: 60, SEQ ID NO: 64, SEQ ID NO: 68, SEQ ID NO: 72, or SEQ ID NO: 76.
  • Diseases or disorders amenable to treatment with the polypeptide, nucleic acid molecule, conjugate or multimer of the present disclosure include cancers (for example, hematopoietic cancers: CLL, AML, ALL, MM, NHL; solid tumors: breast cancer, lung cancer, brain tumors; stromal chemoresistance of tumors; leukemia and other cancers), viral infections (e.g. HIV/AIDS, West Nile Virus encephalitis), inflammatory disease (e.g.
  • rheumatoid arthritis asthma, systemic lupus erythematosus; neuro-inflammatory diseases), fibrosis, for example, lung (pulmonary fibrosis), systemic sclerosis, kidney disease (diabetic nephropathy, FSGS as examples), liver, eye (uveitis, AMD, diabetic retinopathy); immune deficiency disorders; multiple sclerosis, and stroke.
  • Tissue and wound healing including scarring, burns, or radiation induced burns.
  • the CXCR4-related disease or disorder is fibrosis.
  • the disorder is idiopathic pulmonary fibrosis (IPF).
  • the CXCR4-related disease or disorder is kidney disease.
  • the CXCR4-related disease or disorder is multiple sclerosis.
  • the CXCR4-related disease or disorder is atherosclerosis.
  • the CXCR4-related disease or disorder is HIV.
  • the polypeptide of the present disclosure may or may not cause stem cell mobilisation.
  • the present disclosure also provides a method for peripheral blood stem cell mobilisation, comprising administering to a subject in need thereof a polypeptide, nucleic acid molecule, conjugate or multimer of the present disclosure.
  • the peripheral blood stem cells are used for autologous stem cell transplantation.
  • the subject in need thereof has multiple myeloma, acute myeloid leukemia or non-Hodgkin's lymphoma.
  • the stem cells are CD34+ cells.
  • In general, antibodies directed to CXCR4 have been shown to mobilise stem cells which is not desirable for a therapeutic approach in some indications.
  • the polypeptides of the present disclosure do not substantially cause stem cell mobilisation.
  • mobilisation of stem cells is reduced by a polypeptide of the present disclosure by at least 50%, at least 60%, at least 70%, at least 80% or at least 90% compared to the control AMD3100.
  • polypeptide does not substantially inhibit calcium flux.
  • the present disclosure also provides a functional fragment of a CXCR4 binding polypeptide described herein.
  • the functional fragment comprises the CDR3 sequence of a CXCR4 binding molecule described herein.
  • functional fragment we mean a fragment which binds to human CXCR4 with an affinity which is substantially similar or improved when compared to the full length polypeptide from which it is derived, and which inhibits or prevents CXCR4 mediated signalling.
  • the fragment binds to one or more core residues of human CXCR4 selected from the group consisting of E32, Y184, F189, W195, D262 and L266 or combinations of any of these.
  • the functional fragment comprises a sequence selected from the group consisting of SEQ ID NO: 13, SEQ ID NO: 1 6, SEQ ID NO: 19, SEQ ID NO: 22, SEQ ID NO: 25, SEQ ID NO: 28, SEQ ID NO: 31 , SEQ ID NO: 42, SEQ ID NO: 46, SEQ ID NO: 50, SEQ ID NO: 54, SEQ ID NO: 58, SEQ ID NO: 62, SEQ ID NO: 66, SEQ ID NO: 70, SEQ ID NO: 13, SEQ ID NO: 1 6, SEQ ID NO: 19, SEQ ID NO: 22, SEQ ID NO: 25, SEQ ID NO: 28, SEQ ID NO: 31 , SEQ ID NO: 42, SEQ ID NO: 46, SEQ ID NO: 50, SEQ ID NO: 54, SEQ ID NO: 58, SEQ ID NO: 62, SEQ ID NO: 66, SEQ ID NO: 70, SEQ ID NO: 13, SEQ ID NO: 13 6, SEQ ID NO: 19, SEQ ID NO: 22, SEQ ID NO: 25, S
  • the present disclosure further provides a peptide mimetic based on a CXCR4 binding polypeptide described herein or a portion thereof, such as a CDR3 sequence of a CXCR4 binding polypeptide described herein.
  • the peptide mimetic may be based on, or derived from a sequence selected from the group consisting of SEQ ID NO: 13, SEQ ID NO: 16, SEQ ID NO:
  • compositions comprising one or more mimetic peptides for use in treating a CXCR4 related disease or disorder, in particular a CXCR4 related disease or disorder described herein.
  • the present disclosure additionally provides the polypeptide or the nucleic acid or the expression construct, or the cell or the composition of the present disclosure for use in the treatment or prophylaxis of a CXCR4-related disease or disorder.
  • the present disclosure additionally provides for use of the polypeptide or the nucleic acid or the expression construct or the cell or the composition of the present disclosure in medicine.
  • the present disclosure also provides use of a polypeptide or the nucleic acid or the expression construct or the cell or the composition of the present disclosure for the treatment or prophylaxis of a CXCR4-related disease or disorder.
  • the CXCR4-related disease or disorder is fibrosis.
  • the CXCR4-related disease or disorder is lung fibrosis.
  • it is liver fibrosis.
  • it is a fibrosis related condition of the eye.
  • it is skin fibrosis.
  • it is kidney fibrosis.
  • the present disclosure additionally provides for use of the polypeptide or the nucleic acid or the expression construct or the cell of the present disclosure in the manufacture of a medicament for the treatment or prophylaxis of a CXCR4-related disease or condition.
  • the polypeptide of the present disclosure can also be used in a diagnostic format.
  • the present disclosure therefore additionally provides a method for detecting CXCR4 in a sample obtained from a subject, the method comprising contacting a sample with the polypeptide of the disclosure such that a CXCR4-polypeptide complex forms and detecting the complex, wherein detecting the complex is indicative of CXCR4 in the sample.
  • the sample is from a subject suffering from CXCR4-related disease or condition.
  • the sample is a biological sample.
  • the present disclosure also provides a method for detecting a complex of CXCR4 binding polypeptide bound to human CXCR4 in a subject or in a sample obtained from a subject, the method comprising allowing said complex to form and detecting the formed complex.
  • the human CXCR4 may be a dimer, trimer or multimer.
  • Methods of detecting forming complexes will be familiar to persons skilled in the art. Examples include western blot analysis or surface plasmon resonance (biacore). Alternatively, fluorescent based methods may be used where the formation of the complex results in a fluorescently detectable signal being produced which may or may not be quantified.
  • the present disclosure also provides a complex of a CXCR4 binding polypeptide of the disclosure bound to human CXCR4.
  • the human CXCR4 portion of the compelx may be in the form of a dimer, trimer or multimer.
  • the present disclosure additionally provides a method for diagnosing a CXCR4-related disease or disorder in a subject, the method comprising performing the method described herein for detecting CXCR4 in a sample from the subject, wherein detection of CXCR4 in the sample is indicative of the disease or disorder.
  • the method comprises determining the level of CXCR4 in the sample, wherein an increased or decreased level of CXCR4 in the sample compared to a control sample is indicative of the disease or disorder.
  • the present disclosure additionally provides a method for localizing and/or detecting and/or diagnosing and/or prognosing a CXCR4-related disease or disorder, the method comprising detecting in vivo the polypeptide of the present disclosure bound to CXCR4, if present, wherein the polypeptide is conjugated to a detectable tag.
  • the method additionally comprises administering the polypeptide to the subject.
  • the CXCR4 related disease or disorder is a cancer, viral infection (e.g. HIV), inflammatory disease, neuro-inflammatory diseases; fibrosis, immune deficiency disorder; multiple sclerosis, hot flash or stroke.
  • the CXCR4 related disease or disorder is fibrosis, cancer or inflammation.
  • Non-human animals include all vertebrates, e.g., mammals and non- mammals, such as non-human primates, sheep, dogs, cats, cows, horses, chickens, amphibians, and reptiles. Brief Description of the Figures
  • Figure 1 is a diagrammatic representation showing the sequence of the human NCAM domain 1 (A); the i-body scaffold and CDR1 (represented by XXXXX) and CDR3 (represented by Yn) (B); sequence of a specific CXCR4 binder, ADCX-99 (C) and consensus sequence for affinity matured binders of ACDX-99 (D).
  • X and Y are any amino acid
  • n is a number between 10 and 20 inclusive.
  • A', B' is any amino acid.
  • Z is absent or amino acids M, EAEA, MA or MP.
  • Figure 2-1 and 2-2 show surface plasmon resonance (SPR; Biacore) affinities for (A) ADCX- 306 (22.5uM), (B) ADCX-272 (1 .6uM), and (C) ADCX-668 (42uM).
  • SPR surface plasmon resonance
  • Figure 3-1 to 3-3 shows ⁇ -arrestin activity for ADCX-99 (with Flag, Histidine (FH) and with IM7- FH protein tag), ADCX-6, ADCX-306, ADCX-668 and ADCX-272 at various concentrations as indicated. All i-bodies demonstrated some degree of inhibition of ⁇ -arrestin.
  • Figure 4 shows size exclusion chromatography (SEC) results for i-body ADCX-99 protein (conjugated to IM7-FH (IM7 flag histidine tagged immunity protein) purified from the periplasmic fraction. SEC was conducted using a Superdex 75 column.
  • Figure 5 shows surface plasmon resonance (SPR; BIAcore) of i-body ADCX-99 for binding to immobilised CXCR4 positive lipoparticles (A).
  • ADCX-99 did not bind to null lipoparticles (B) or to CCR5 positive lipoparticles (C).
  • Figure 6 shows 90 individual i-bodies from an affinity-matured mutant library derived from i- body ADCX-99.
  • the affinity-matured i-bodies were tested for expression by binding of anti- FLAG antibody compared to negative controls ADCX-272 and ADR-3 and the wildtype i-body ADCX-99, which were grown under the same conditions and is provided in the last two columns.
  • Figure 7-1 and 7-2 show 90 individual i-bodies from the affinity-matured mutant library of i- body ADCX-99.
  • the affinity matured i-bodies were tested for binding to CXCR4 positive lipoparticles (A) and to CCR5 positive lipoparticles (B). Binding of the affinity matured i-bodies to CXCR4 and CCR5 positive lipoparticles is compared to binding of the wild-type i-body ADCX-99 (last two columns) and to the positive control i-body ADCX-272, and negative control i-body ADR-3.
  • Figure 8 shows the sequence alignment of the affinity matured i-bodies relative to starting sequence ADCX-99.
  • Figure 9 shows specificity of i-bodies (of Table 4) acting as antagonists against a number of chemokine receptors expressed on cells and measured by ⁇ -arrestin assay.
  • Figure 10 shows individual sequence alignments for i-bodies AM4-661 (A), AM4-272 (B) and AM3-1 14, AM3-523 and AM5-245 relative to ADCX-99 (C).
  • Figure 1 1 shows surface plasmon resonance (SPR; BIAcore) of bi-specific AM3-1 14-lm7-S21 binding to both CXCR4 and Human Serum Albumin (HSA).
  • SPR surface plasmon resonance
  • A binding of bi-specific i-body AM3-1 14-lm7-S21 to HSA by SA21 peptide (K D 51 8 (+1-2) nM) at various concentrations 60nM, 200nM, 600nM and 1 .00 ⁇
  • B lack of binding by i-body AM3-1 14 to HSA at various concentrations 60nM, 200nM, 600nM and 1 . ⁇
  • C binding of i-body AM3-1 14 to CXCR4 (K D 9nM) and
  • D binding of bi-specific AM3-1 14-lm7-S21 to CXCR4 (K D 9nM).
  • Figure 12 shows the profile of i-body concentration following intravenous injection of mice, as determined by quantitaive mass-spectrometry.
  • I-bodies AM3-1 14, AM4-746
  • IM7-FH IM7-FH-SA21
  • PEG 30K or 2x20K
  • Figure 13 shows chemiluminescent signal detection of CXCR4 for i-bodies AM3-1 14, AM4- 272, AM3-523, AM4-746 and AM4-1 121 , positive control AMD31 00 and negative control i-body as measured by cAMP assay.
  • Figure 14 shows the percent inhibition of Calcium flux measured by the QuestTM Fluo-8 kit for i-bodies AM3-1 1 4, AM4-272, AM3-523, AM4-746, and AM4-1 121 , control Ag (SDF-1 ), 21 H5 negative control i-body and AMD31 00 positive control (effective concentration EC 80 ).
  • Figure 15 shows the results of the BRET ⁇ -arrestin assay for (A) anti-CXCR4 i-body AM3-1 14 compared with two positive controls (small molecule AMD31 00 and MAb12G5) and a negative control i-body; and (B) anti-CXCR4 i-bodies AM3-1 14, AM4-272, AM3-523, AM4-746, and AM4-1 121 , positive control (AMD31 00) and ADCX-99.
  • Figures 16-1 to 16-3 show binding affinity as determined by flow cytometry of i-body AM3-1 14 to various cell lines that do not express CXCR4 T47D (A), and that express CXCR4 at various levels, including: Namalwa (B), MOLP8 (C), MOLT4 (D), Jurkat (E), CCRF-CEM (F), A498 (G), Ramos (H), NCI-H69 (I) and HL-60 (J). All cell lines were tested with i-body concentrations of 10, 1 and 0.001 ⁇ and in addition Namalwa cells (B) were tested with i-bodies at 4.7, 2.1 , 0.47, 0.21 , 0.1 and 0.01 ⁇ .
  • FIG 17 shows competition of CXCR4 i-bodies with SDF-1 for binding to CXCR4 positive lipoparticles measured by surface plamon resonance (SPR; BIAcore). Data shown for i-body AM3-1 14 (A) and AM4-272 (B).
  • Figure 18 shows competition of CXCR4 i-body binding to Ramos cells with various molecules. AM3-1 14 (top panel), AM4-272 (middle panel), AM3-523 (bottom panel) i-bodies bound to Ramos cells and this binding was reduced to varying degrees upon the addition of AMD3100, MAb12G5 and the natural ligand SDF-1 .
  • Figure 19-1 and 19-2 show CXCR4 i-body induced apoptosis of Ramos cells.
  • AM3-1 14 (AD- 1 14), AM4-272 (AD-272), AM3-523 (AD-523) i-bodies bound to Ramos cells and induced apoptosis as assessed by double staining of annexin V and propidium iodide (top left quadrant in each of the flow cytometry traces).
  • Untreated cells acted a negative control and thapsigargin is a well-described inducer of apoptosis (19-1 ). Quantitation of the flow cytometry traces is shown in the graphical form (19-2).
  • Figure 20 shows the resuts of an HIV inhibition assay for i-bodies AM3-272, AM3-1 14 and AM1 -320 relative to a negative control i-body and the positive control small molecule AMD3100.
  • Figure 21 shows NP2-CD4/CXCR4 cell viability of i-bodies AM3-1 14, AM4-272, AM3-523, AM4-746 and AM4-1 121 and control 21 H5 measured using a FLUOStar microplate reader.
  • Figure 22 shows inhibition of HIV strains (NL4.3 and 1 109-F-30) with various i-bodies AM3- 1 14, AM4-272, AM3-523, AM4-746 and AM4-1 121 relative to a negative control i-body 21 H5.
  • CXCR4 i-bodies block infection of of HIV in a dose depedent manner.
  • VSVG is the Envelope from the Vesicular stomatitis virus that undergoes endocytosis after binding to an unrelated receptor.
  • Figure 23-1 and 23-2 show inhibition of HIV with PEGylated (30KDa and 2x20KDa PEG) and non-PEGylated CXCR4 i-bodies AM3-1 14 and AM4-746.
  • CXCR4 i-bodies block infection of three strains of HIV in a dose-dependent manner (A). The CXCR4 i-bodies are unable to block infection of a CCR5 dependent strain of HIV (B).
  • Figure 24 shows white blood cell count (A) of peripheral blood (PB) of mice injected with i- bodies AM4-272, AM4-746, AM4-1 121 , AM3-1 14, AM3-523, or negative controls saline, isotype control i-body (21 H5) or positive control AMD3100; lack of mobilisation of LSK cells by the i- bodies is shown in (B) and lack of mobilisation of LSKSLAM cells by the i-bodies is shown in (C).
  • Figure 26 shows CXCR4 i-bodies do not mobilize human stem and progenitors.
  • HSC HSC
  • A Representative dot plot of human CD34 + CD38 " HSC.
  • B Representative flow cytometric histogram of i-body binding to human cord blood (CB) CD34 + CD38 " HSC with AM3-1 14, AM4-272 and AM3-523 as indicated by arrows
  • C Representative histogram of AM3-1 14 binding to human BM CD34 + CD38 " HSC and muCD45 " huCD45 + CD34 + CD38 " HSC from huNSG BM relative to control i-body (21 H5).
  • Figure 27 shows effect of i-bodies AM3-1 14 (A) and AM4-272 (B) on pro-fibrotic gene expression in laser treated mice.
  • a panel of 85 profibrotic genes were tested for mRNA levels in i-body treated mice.
  • Figure 28 shows binding of AM3-1 14 i-body to human fibrocytes. Human fibrocytes were identified by staining with an antibody to CD45. Binding of i-body AM3-1 14 was identified by an anti-FLAG antibody to the C-terminal tag. DAPI was used to stain the nucleus of the cells. The final panel is a merged image of all three stains.
  • Figure 29 shows i-bodies AM3-1 14, AM4-272, AM3-523, AM4-746 and AM4-1 121 inhibiting leukocyte infiltration into a murine air pouch loaded with SDF-1 compared with a negative control i-body (which does not bind to CXCR4), positive controls AMD3100 and MSX-122 and a vehicle only control.
  • Figure 30 shows the effect of i-bodies (AM3-1 14, AM4-272, AM3-523) at different doses on intrapulmonary fibrocyte recruitment after bleomycin injury compared to positive controls AMD3100 and Pirfenidone and negative control i-body (21 H5). Fibrocytes were measured by staining the lung tissue from Bleomycin treated mice for CD45+CXCR4+Col 1 + cells.
  • FIG. 31-1 to 31-3 show the effect of i-bodies (AM3-1 14, AM4-272, AM3-523), CXCR4 small molecule antagonist AMD3100 and negative control i-body 21 H5 in inhibiting human IPF lung fibroblast invasion.
  • i-body AM3-1 14 which specifically inhibited migration of IPF lung fibroblasts (B and C), i-body AM4-272 inhibited fast progressor fibroblasts (C) but neither i- body had any effect on normal lung fibroblasts (A).
  • AMD3100 and the negative control i-body 21 H5 had no effect on any of these cell lines.
  • Figure 32 shows that AM3-1 14-6H i-body markedly reduced ACTA2, COL 1A 1, COL3A 1 and FN1 transcript expression in slow-IPF lung fibroblasts.
  • Slow lung fibroblasts were plated on BME and treated with 2 mg/ml of BME alone (open bars) and containing i-body AM3-1 14-6H (grey bars) or AMD3100 (black bars).
  • Figure 33 shows the ability of i-bodies to block platelet aggregation.
  • AM4-272, AM4-746, AM4- 1 121 , AM3-1 14, AM3-523 and MAb12G5 as well as a negative control i-body (21 H5) and a negative control MAB (mlgG2a) were tested for blocking SDF-1 a induced platelet aggregation.
  • i-bodies AM3-1 14 and AM4-1 121 were the most effective at blocking this aggregation.
  • Figure 34 shows the effect of i-body AM4-272 on clinical scores and body weight of mice with induced EAE.
  • the lines represent body weights of the mice in the groups with MOG induced experimental autoimmune encephalomyelitis (EAE) and various treatments.
  • the bars represent clinical scores of the mice in the various groups.
  • I-body AM4-272 reduces the clinical scores and prevents the bodyweight loss seen in MOG induced EAE animals.
  • SEQ ID NO 1 amino acid sequence encoding Homo sapiens NCAM domain 1
  • SEQ ID NO: 2 amino acid sequence encoding i-body scaffold.
  • SEQ ID NO: 3 amino acid sequence encoding Bos taurus NCAM domain 1
  • SEQ ID NO: 4 amino acid sequence encoding Mus musculus NCAM domain 1
  • SEQ ID NO: 1 1 amino acid sequence encoding ADCX-99
  • SEQ ID NO: 32 nucleotide sequence encoding ADCX-99
  • SEQ ID NO: 34 nucleotide sequence encoding ADCX-6
  • SEQ ID NO: 38 nucleotide sequence encoding ADCX-306
  • SEQ ID NO: 39 consensus amino acid sequence of affinity matured i-bodies.
  • SEQ ID NO: 40 amino acid sequence encoding AM3-1 14
  • SEQ ID NO: 43 nucleotide sequence encoding AM3-1 14
  • SEQ ID NO: 45 amino acid sequence encoding AM3-920 CDR1
  • SEQ ID NO: 47 nucleotide sequence encoding AM3-920
  • SEQ ID NO: 51 nucleotide sequence encoding AM4-1 121
  • SEQ ID NO: 55 nucleotide sequence encoding AM4-613
  • SEQ ID NO: 63 nucleotide sequence encoding AM4-661
  • SEQ ID NO: 71 nucleotide sequence encoding AM5-245
  • SEQ ID NO: 75 nucleotide sequence encoding AM4-272
  • SEQ ID NO :1 03 amino acid sequence encoding AM5-95 CDR1
  • SEQ ID NO :1 04 amino acid sequence encoding AM5-95 CDR3
  • affinity refers to the strength of binding of a single molecule to its ligands and is typically expressed as the equilibrium dissociation constant (K D ) for the reversible binding of two agents. It is determined by the ratio of K off /K on , between the i-body or CXCR4 binding polypeptide of the present disclosure and CXCR4. K D and affinity are inversely related. The K D value relates to the concentration of i-body or CXCR4 binding polypeptide and so the lower the KD value (lower concentration), the higher the affinity of the antibody.
  • Affinity of an i-body or CXCR4 binding polypeptide of the present disclosure to CXCR4 can be, for example, from about 100 nanomolar (nM) to about 0.1 nM, from about 1 00 nM to about 1 picomolar (pM), or from about 100 nM to about 1 femtomolar (fM) or more.
  • the term "binds" in reference to the interaction of a CXCR4 binding molecule or polypeptide with a target means that the interaction is dependent upon the presence of a particular structure (e.g., an antigenic determinant or epitope) on the target.
  • a CXCR4 binding molecule or polypeptide recognizes and binds to a specific protein structure rather than to proteins generally.
  • conservative amino acid substitution refers to grouping of amino acids on the basis of certain common properties. A functional way to define common properties between individual amino acids is to analyse the normalised frequencies of amino acid changes between corresponding proteins of homologous organisms.
  • groups of amino acids may be defined where amino acids within a group exchange preferentially with eachother, and therefore resemble each other most in their impact on the overall protein structure (Schulz GE and RH Schirmer, Principles of Protein Structure, Springer- Verlag).
  • amino acid groups defined in this manner include:
  • CXCR4-related disease or condition shall be taken to mean disease and disorders that can be prevented and/or treated, respectively, by suitably administering to a subject in need thereof (i.e. having the disease or disorder or at least one symptom thereof and/or at risk of attracting or developing the disease or disorder) of either a CXCR4 binding molecule or a polypeptide or composition of the present disclosure and/or of a known active principle active against CXCR4 or a biological pathway or mechanism in which CXCR4 is involved.
  • CXCR4 related disease or condition also includes CXCR4- mediated diseases or disorders.
  • the term "homology” describes a mathematically based comparison of sequence similarities which is used to identify genes or proteins with similar functions or motifs.
  • the polypeptide sequences of the present disclosure may be used as a "query sequence” to perform a search against public databases to, for example, identify other family memebers, related sequences or homologs. Such searches can be performed using BLAST programs (Altschul et al (1990) J. Mo. Biol. 215:403-10). To obtain gapped alignments for comparison purposes, Gapped BLAST can be utilised a described in Altschul et al (1 997) Nuc Acids Res. 25(17):3389-3402.
  • identity means the percentage of identical nucleotide or amino acid residues at corresponding portions in two or more sequences when sequences are aligned to maximise sequence matching, i.e. taking into account gaps and insertions. Identity can be readily calculated using known methods, including, but not limited to thse described in Computational Molecular Biology, Lesk AM ed. Oxford University Press New York, 1988; Computer Analysis of Sequence data, Part I Griffin AM and Griffin HG eds., Humana Press, New Jersey, 1994; Sequence analysis in molecular biology, von Heinje G, Academic Press, New Jersey, 1 994). Methods to determine identity are designed to give the largest match between the sequences tested.
  • methods to determined identity are codified in publicly available computer programs.
  • Computer program methods to determine identity between two sequence include, but are not limited to, the GCG program package, BLASTP, BLASTN and FASTA.
  • the well known Smith Waterman algorithm may also be used to determine identity.
  • the terms “treating”, “treat” or “treatment” include administering a therapeutically effective amount of the polypeptide, nucleic acid molecule, conjugate or multimer of the present disclosure sufficient to reduce or eliminate at least one symptom of a specified disorder.
  • the treatment involves administering a therapeutically effective amount of the polypeptide, nucleic acid molecule, conjugate or multimer to treat or prevent a CXCR4-related disease or disorder.
  • treatment also refers to prophylactic treatment.
  • the terms "preventing”, “prevent” or “prevention” include administering a therapeutically effective amount of the polypeptide, nucleic acid molecule, conjugate or multimer of the present disclosure sufficient to stop or hinder the development of at least one symptom of a specified disorder.
  • the term "specifically binds" or "binds specifically” shall be taken to mean a CXCR4 binding molecule or polypeptide of the disclosure reacts or associates more frequently, more rapidly, with greater duration and/or with greater affinity with a particular target or cell expressing CXCR4 than it does with alternative targets or cells. More particularly, the CXCR4 binding molecule or polypeptide binds with greater affinity to a target or cell expressing CXCR4 than it does to other chemokine receptors, for example CCR5, CXCR7 or CCR7. For example, a CXCR4 binding molecule or polypeptide that specifically binds to a target binds that target with greater affinity (e.g.
  • a polypeptide which binds specificaly to CXCR4 may demonstrate some cross-reactivity with other chemokine receptors or affinity related molecules but only to the extent that such cross- reactivity does not substantially modulate a biological mechanism response or effect of CXCR4 binding.
  • a CXCR4 binding molecule or polypeptide binds to a target at a level within about 30% or 25% or 20% of the level at which it binds to another target.
  • This term can also mean that one binding molecule or polypeptide binds to a target at a level within about 30% or 25% or 20% of the level at which another binding molecule or polypeptide binds to the same target.
  • the term "substantially” as used herein in the context of binding refers to a polypeptide that binds to CXCR4 at a level within about 15%, or 10% or 5% of the level at which it binds to another target.
  • This term can also mean that one binding molecule or polypeptide binds to a target at a level within about 5% or 4% or 3% of the level at which another binding molecule or polypeptide binds to the same target.
  • random loop sequence refers to a portion of a peptide sequence that extends either from or between a ⁇ -strand conformation or ⁇ -strand conformations of an intermediate (l-SET) domain. Loop regions are typically free of extended ⁇ - strand conformations. Loop region 4 is analogous to a conventional CDR1 loop. Loop region 8 is analogous to a conventional CDR3 loop.
  • CDRs complementarity determining regions
  • scaffold or "i-body scaffold” as used herein is intended to refer to the sequence represented by the scaffold regions of the i-SET human NCAM1 Immunoglobulin (Ig) domain 1 (SEQ ID NO:1 ) defined by amino acids 1 to 26, 33 to 79 and 88 to 97.
  • isolated refers to a protein or recombinant or synthetic origin or some combination thereof, which by virtue of its origin or source of derivation the protein is not associated with proteins found in nature, is free of other proteins from the same source, is expressed by a cell from a different species or does not occur in nature.
  • terapéuticaally effective amount refers to an amount of therapeutic agent that when administered alone or in combination with another therapeutic agent to a cell, tissue or subject is effective to prevent or ameliorate the disease condition or the progression of the disease.
  • peptide mimetic or "peptidomimetic” means a peptide-like molecule that is able to serve as a model for a peptide substrate upon which it is structurally based.
  • peptidomimetics include chemically modified peptides, peptide-like molecules containing non- naturally occurring amino acids, and peptoids, which are peptide-like molecules resulting from oligomeric assembly of N-substituted glycines (see, for example, Goodman and Ro, Peptidomimetics for Drug Design, in BURGER'S MEDICINAL CHEMISTRY AND DRUG DISCOVERY Vol. 1 (ed. M. E. Wolff; John Wiley & Sons 1995), pages 803-861 ).
  • a variety of peptide mimetics are known in the art including, for example, peptide-like molecules which contain a constrained amino acid, a non-peptide component that mimics peptide secondary structure, or an amide bond isostere.
  • a peptide mimetic that contains a constrained, non-naturally occurring amino acid can include, for example, an a-methylated amino acid; an ⁇ , ⁇ -dialkyl-glycine or a-aminocycloalkane carboxylic acid; an Na-Ca cyclized amino acid; an Na-methylated amino acid; a ⁇ - or ⁇ -amino cycloalkane carboxylic acid; an ⁇ , ⁇ - unsaturated amino acid; a ⁇ , ⁇ -dimethyl or ⁇ -methyl amino acid; a ⁇ -5 ⁇ 5 ⁇ -2,3- ⁇ 6 ⁇ 3 ⁇ amino acid; an NC5 or Ca-C5 cyclized amino acid; or a substituted proline or another amino acid mimetic.
  • a peptide mimetic which mimics peptide secondary structure can contain, for example, a nonpeptidic ⁇ -turn mimic; ⁇ -turn mimic; mimic of ⁇ -sheet structure; or mimic of helical structure, each of which is well known in the art.
  • a peptide mimetic also can be a peptide-like molecule which contains, for example, an amide bond isostere such as a retro- inverso modification; reduced amide bond; methylenethioether or methylenesulfoxide bond; methylene ether bond; ethylene bond; thioamide bond; trans-olefin or fluoroolefin bond; 1 ,5- disubstituted tetrazole ring; ketomethylene or fluoroketomethylene bond or another amide isostere.
  • an amide bond isostere such as a retro- inverso modification; reduced amide bond; methylenethioether or methylenesulfoxide bond; methylene ether bond; ethylene bond; thioamide bond; trans-olefin or fluoroolefin bond; 1 ,5- disubstituted tetrazole ring; ketomethylene or fluoroketomethylene bond or another amide isostere
  • the present disclosure provides a binding polypeptide (or "i-body”), which comprises a scaffold with modified CDR1 and CDR3 regions.
  • the scaffold region comprises Domain 1 of human NCAM1 as shown in SEQ ID NO:1 or a related domain sequence that has at least 45% identity thereto or at least 75% homology excluding CDR1 and CDR3 regions as highlighted.
  • NCAM (or Neural Cell Adhesion Molecule) is a glycoprotein of the l-SET domains or intermediate-set domains from the Immunoglobulin (Ig) superfamily.
  • the extracellular domain of NCAM consists of five immunoglobulin-like (Ig) domains followed by two fibronectin type III (FNIII) domains.
  • Domain sequences include SEQ ID NO's 3, 4, 5, 6 and 8 which show cow, mouse, rat, chicken and frog NCAM 1 domain sequences respectively and SEQ ID NO's 7, 9 and 10 which show frog, human and mouse NCAM 2 domain sequences respectively.
  • NCAM1_ _MOUSE RecName NCAM 195 2e -57 Identity (95%)
  • SEQ ID NO: 4 P13596 1 NCAM1__RAT RecName : NCAM 192 3e--57 Identity (95%)
  • SEQ ID NO: 5 P13595.31 NCAM1_ _MOUSE RecName : NCAM 195 2e -57 Identity (95%)
  • SEQ ID NO: 4 P13596 1 NCAM1__RAT RecName : NCAM 192 3e--57 Identity (95%)
  • sequence homology between these related domains is as follows: sp P13591 3 NCAM1_ _HUMAN RecName : NCAM Sequence homology (100%) SEQ ID NO: 1 sp P31836 1 NCAM1_ _BOVIN RecName : NCAM Sequence homology (100%) SEQ ID NO: 3 sp P13595 3 NCAM1_ _MOUSE RecName : NCAM Sequence homology (99%) SEQ ID NO: 4 sp P13596 1 NCAM1_ _RAT RecName : NCAM Sequence homology (99%) SEQ ID NO: 5 sp P13590 3 NCAM1_ _CHICK RecName : NCAM Sequence homology (98%) SEQ ID NO: 6 sp P36335 1 NCA12_ _XENLA RecName : NCAM Sequence homology (89%) SEQ ID NO: 7 sp P16170 1 NCA11_ _XENLA RecName : NCAM Sequence homology (89%) S
  • Domain 1 of human NCAM has been produced as a recombinant polypeptide in a bacterial expression system (Frei et al. (1992) J. Cell Biol. 1 18:177-194).
  • the present disclosure describes modifications introduced into an i-body scaffold in the CDR1 and/or CDR3 regions, which have been shown to alter the binding properties of the domain (or "i-body”).
  • the inventors have developed modified i-body amino acids and polypeptides which surprisingly are able to bind to CXCR4 with high affinity and specificity and inhibit or reduce CXCR4-induced cell migration.
  • the CXCR4 binding polypeptides or i-bodies of the present disclosure are useful in inhibiting cancer metastasis, anti-inflammartory and fibrosis related diseases.
  • the present disclosure provides a number of polypeptides which bind to CXCR4 which comprise the i-body scaffold acid sequence, wherein the CDR1 or CDR3 region of the i-body scaffold have been modified and wherein the molecule binds to human CXCR4 with an affinity of less than 50uM, less than 40 ⁇ , less than 20 ⁇ , less than 1 0uM, less than 1 uM, less than 700nM, less than 600nM, less than 500nM, less than 400nM, less than 300nM, less than 200nM, less than 100nM, less than 50nM, less than 1 0nM, or less than 5 nM or less than 1 nM.
  • the entire CDR1 and/or CDR3 regions of the polypeptide are replaced with a random loop sequence.
  • the CDR1 loop region of the polypeptide may be relaced with a loop region having the sequence as shown in SEQ ID NO: 12, SEQ ID NO:15, SEQ ID NO:18, SEQ ID NO:21 , SEQ ID NO:24, SEQ ID NO: 27, SEQ ID NO: 30, SEQ ID NO: 41 , SEQ ID NO: 45, SEQ ID NO: 49, SEQ ID NO: 53, SEQ ID NO: 57, SEQ ID NO:61 , SEQ ID NO:65, SEQ ID NO:69, SEQ ID NO:73, or SEQ ID NO:77 or a sequence having at least 50% identity thereto.
  • the CDR1 loop region of the polypeptide may be relaced with a loop region having the sequence as shown in SEQ ID NO: 12, SEQ ID NO:15, SEQ ID NO:18, SEQ ID NO:21 , SEQ ID NO:24, SEQ ID NO: 27, SEQ ID NO: 30, SEQ ID NO: 41 , SEQ ID NO: 45, SEQ ID NO: 49, SEQ ID NO: 53, SEQ ID NO: 57, SEQ ID NO: 61 , SEQ ID NO: 65, SEQ ID NO: 69, SEQ ID NO: 73, or SEQ ID NO: 77 or a sequence having at least 50% homology thereto.
  • the CDR3 loop region of the polypeptide may be replaced with a loop region having the sequence as shown in SEQ ID NO: 13, SEQ ID NO: 16, SEQ ID NO: 1 9, SEQ ID NO: 22, SEQ ID NO: 25, SEQ ID NO: 28, SEQ ID NO: 31 , SEQ ID NO: 42 , SEQ ID NO: 46, SEQ ID NO: 50, SEQ ID NO: 54, SEQ ID NO: 58, SEQ ID NO: 62, SEQ ID NO: 66, SEQ ID NO: 70, SEQ ID NO: 74, or SEQ ID NO: 78, a sequence having at least 70% identity thereto.
  • the CDR3 loop region of the polypeptide may be replaced with a loop region having the sequence as shown in SEQ ID NO: 13, SEQ ID NO: 16, SEQ ID NO: 1 9, SEQ ID NO: 22, SEQ ID NO: 25, SEQ ID NO: 28, SEQ ID NO: 31 , SEQ ID NO: 42 , SEQ ID NO: 46, SEQ ID NO: 50, SEQ ID NO: 54, SEQ ID NO: 58, SEQ ID NO: 62, SEQ ID NO: 66, SEQ ID NO:70, SEQ ID NO: 74, or SEQ ID NO: 78 a sequence having at least 70% homology thereto.
  • polypeptide comprises a sequence that has at least 80% identity, at least 90% identity, or at least 95% identity, or at least 97% identity, or at least 98% identity, or at least 99% identity to identity to SEQ ID NO: 1 1 , SEQ ID NO: 14, SEQ ID NO: 17, SEQ ID NO: 20, SEQ ID NO: 23, SEQ ID NO: 26, SEQ ID NO: 29, SEQ ID NO: 40, SEQ ID NO: 44, SEQ ID NO: 48, SEQ ID NO: 52 or SEQ ID NO: 56, SEQ ID NO:60, SEQ ID NO: 64, SEQ ID NO: 68, SEQ ID NO: 72, or SEQ ID NO: 76.
  • the polypeptide comprises a sequence that has at least 80% homology, at least 90% homology, or at least 95% homology, or at least 97% homology, or at least 98% homology, or at least 99% homology to SEQ ID NO: 1 1 , SEQ ID NO: 14, SEQ ID NO: 17, SEQ ID NO: 20, SEQ ID NO: 23, SEQ ID NO: 26, SEQ ID NO: 29, SEQ ID NO: 40, SEQ ID NO: 44, SEQ ID NO: 48, SEQ ID NO: 52 or SEQ ID NO: 56, SEQ ID NO:60, SEQ ID NO: 64, SEQ ID NO: 68, SEQ ID NO: 72, or SEQ ID NO: 76.
  • polypeptide comprises or consists of SEQ ID NO: 1 1 , SEQ ID NO: 14, SEQ ID NO: 17, SEQ ID NO: 20, SEQ ID NO: 23, SEQ ID NO: 26, SEQ ID NO: 29, SEQ ID NO: 40, SEQ ID NO: 44, SEQ ID NO: 48, SEQ ID NO: 52 or SEQ ID NO: 56, SEQ ID NO:60, SEQ ID NO: 64, SEQ ID NO: 68, SEQ ID NO: 72, or SEQ ID NO: 76.
  • polypeptide comprises or consists of SEQ ID NO: 1 1 comprising one, two, three, four, five, six, seven, eight, nine or ten amino acid substitutions.
  • polypeptide comprises or consists of SEQ ID NO: 1 1 .
  • the present disclosure also provides a nucleic acid molecule encoding a polypeptide described herein.
  • the nucleic acid molecule comprises a sequence that has at least 80% identity, at least 90% identity, or at least 95% identity, or at least 97% identity, or at least 98% identity, or at least 99% identity or 100% identity to any one of SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 43, SEQ ID NO: 47, SEQ ID NO: 51 , SEQ ID NO: 55, SEQ ID NO: 59, SEQ ID NO: 63, SEQ ID NO: 67, SEQ ID NO: 71 , SEQ ID NO: 75, or SEQ ID NO: 79.
  • the nucleic acid molecule comprises a sequence that has at least 80% homology, at least 90% homology, or at least 95% homology, or at least 97% homology, or at least 98% homology, or at least 99% homology or 100% homology to any one of SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 43, SEQ ID NO: 47, SEQ ID NO: 51 , SEQ ID NO: 55, SEQ ID NO: 59, SEQ ID NO: 63, SEQ ID NO: 67, SEQ ID NO: 71 , SEQ ID NO: 75, or SEQ ID NO: 79.
  • the query sequence is at least 50 residues in length, and the GAP analysis aligns the two sequences over a region of at least 50 residues.
  • the query sequence is at least 100 residues in length and the GAP analysis aligns the two sequences over a region of at least 100 residues. In one example, the two sequences are aligned over their entire length.
  • alignments of sequences and calculation of homology scores are done using a Needleman-Wunsch alignment (i.e. global alignment), useful for both protein and DNA alignments.
  • the default scoring matrices BLOSUM50 and the identity matrix are used for protein and DNA alignments respectively.
  • the penalty for the first residue in a gap is -12 for proteins and -16 for DNA, white the penalty for additional residues in a gap is -2 for proteins and -4 for DNA.
  • Alignment is from the FASTA package version v20u6 (W. R. Pearson and D. J. Lipman (1988), "Improved Tools for Biological Sequence Analysis", PNAS 85:2444-2448, and W. R. Pearson (1990) "Rapid and Sensitive Sequence Comparison with FASTP and FASTA", Methods in Enzymology, 1 83:63-98).
  • binding protein of the disclosure comprises one or more conservative amino acid substitutions compared to a sequence set forth herein.
  • the binding protein comprises 10 or fewer, e.g., 9 or 8 or 7 or 6 or 5 or 4 or 3 or 2 or 1 conservative amino acid substitutions.
  • a "conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain and/or hydropathicity and/or hydrophilicity.
  • Families of amino acid residues having similar side chains have been defined in the art, including basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), /3-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). Hydropathic indices are described, for example in Kyte and Doolittle (1982) and hydrophylic indices are described in, e.g., US
  • the present disclosure also contemplates non-conservative amino acid changes.
  • non-conservative amino acid changes are substitutions of charged amino acids with another charged amino acid and with neutral or positively charged amino acids.
  • the binding protein comprises 10 or fewer, e.g., 9 or 8 or 7 or 6 or 5 or 4 or 3 or 2 or 1 non-conservative amino acid substitutions.
  • a variant form of a CXCR4 binding protein described herein retains the ability to bind to CXCR4. Methods for determining specific binding to CXCR4 are described herein.
  • a polypeptide of the disclosure is affinity matured to produce an i- body capable of binding to CXCR4 with increased affinity, specificity or activity or to produce an i-body with increased expression or solubility.
  • the sequence encoding the polypeptide of the disclosure is mutated such that one or more amino acid substitutions is introduced.
  • the resulting variant polypeptide is then screened for binding to CXCR4, e.g., in a competitive assay, screened for increase in specificity to other chemokine receptors (for example CCR10, CCR2, CCR3, CCR4, CCR5, CCR6, CCR7, CCR8, CCR9, CX3CR1 , CXCR1 , CXCR2, CXCR3, CXCR5, CXCR6, CXCR7, CCR1 , XCR1 ; see Figure 9), or screened for increase in expression or increase in solubility (see Figure 7) or screened via affinity assays as described below for increases in affinity to CXCR4.
  • CXCR4 for example CCR10, CCR2, CCR3, CCR4, CCR5, CCR6, CCR7, CCR8, CCR9, CX3CR1 , CXCR1 , CXCR2, CXCR3, CXCR5, CXCR6, CXCR7, CCR1 , XCR1 ; see Figure 9
  • Ribosome display coupled with error-prone RNA dependent RNA polymerase from Qbeta bacteriophage has also been used to affinity mature single domains, binding proteins and polypeptides (Kopsidas et al, (2006) Immunology Letters 107 163-168).
  • polypeptides according to the disclosure may be soluble secreted proteins or may be presented as a fusion protein on the surface of a cell, or particle (e.g., a phage or other virus, a ribosome or a spore).
  • a phage or other virus e.g., a phage or other virus, a ribosome or a spore.
  • Exemplary phage display methods are described, for example, in US5821047; US6248516 and US6190908. Phage display particles produced using these methods are then screened to identify a displayed binding protein having a conformation sufficient for binding to CXCR4 or an improved binder to CXCR4.
  • Apparent affinities can be determined by methods such as an enzyme linked immunosorbent assay (ELISA) or any other technique familiar to one of skill in the art. Avidities can be determined by methods such as a Scatchard analysis or any other technique familiar to one of skill in the art. Another technique for measuring apparent binding affinity familiar to those of skill in the art is a surface plasmon resonance technique (analyzed on a BIACORE 2000 system) (Liljeblad, et al., Glyco. J. 2000, 17:323-329). Standard measurements and traditional binding assays are described by Heeley, R. P , Endocr. Res. 2002, 28:217-229.
  • ELISA enzyme linked immunosorbent assay
  • an affinity matured i-body of the present disclosure specifically binds to human CXCR4 with a greater binding affinity (e.g. at least about 5 times, at least about 10 times, at least about 50 times, at least about 100 times, at least about 500 times, or at least about 1000 times greater) than the binding affinity of the non-affinity matured i-body.
  • a polypeptide of the disclosure is produced by culturing a cell line, e.g., an E.Coli cell line under conditions sufficient to produce the protein, e.g., as described herein and/or as is known in the art.
  • nucleic acid encoding same is placed into one or more expression constructs, e.g., expression vector(s), which is/are then transfected into host cells, such as cells that can produce a disulphide bridge or bond, such as bacterial cells including E. coli cells, yeast cells, insect cells, or mammalian cells.
  • host cells such as cells that can produce a disulphide bridge or bond, such as bacterial cells including E. coli cells, yeast cells, insect cells, or mammalian cells.
  • bacterial cells including E. coli cells, yeast cells, insect cells, or mammalian cells.
  • exemplary mammalian cells include simian COS cells, Chinese Hamster Ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein.
  • Exemplary bacterial cells include BL21 (DE3), BL21 (DE3)-pLysS, Tuner, Tuner pLysS, Origami, Origami B, Origami B pLysS, Rosetta, AD494, HMS174 which are all available form Novagen.
  • nucleic acid encoding a protein of the disclosure is inserted into an expression construct or replicable vector for further cloning (amplification of the DNA) or for expression in a cell-free system or in cells.
  • the nucleic acid is operably linked to a promoter.
  • promoter is to be taken in its broadest context and includes the transcriptional regulatory sequences of a genomic gene, including the TATA box or initiator element, which is required for accurate transcription initiation, with or without additional regulatory elements (e.g., upstream activating sequences, transcription factor binding sites, enhancers and silencers) that alter expression of a nucleic acid, e.g., in response to a developmental and/or external stimulus, or in a tissue specific manner.
  • promoter is also used to describe a recombinant, synthetic or fusion nucleic acid, or derivative which confers, activates or enhances the expression of a nucleic acid to which it is operably linked.
  • Exemplary promoters can contain additional copies of one or more specific regulatory elements to further enhance expression and/or alter the spatial expression and/or temporal expression of said nucleic acid.
  • operably linked to means positioning a promoter relative to a nucleic acid such that expression of the nucleic acid is controlled by the promoter.
  • a nucleic acid encoding a CXCR4 binding polypeptide is operably linked to a suitable promoter, e.g., a T7, T5 or SP6 promoter, and the resulting expression construct exposed to conditions sufficient for transcription and translation.
  • a suitable promoter e.g., a T7, T5 or SP6 promoter
  • Typical expression vectors for in vitro expression or cell-free expression have been described and include, but are not limited to the TNT T7 and TNT T3 systems (Promega), the pEXP1 -DEST and pEXP2-DEST vectors (Invitrogen).
  • vectors for expression in cells are available.
  • the vector components generally include, but are not limited to, one or more of the following: a signal sequence, a sequence encoding a polypeptide of the present disclosure (e.g., derived from the information provided herein), an enhancer element, a promoter, and a transcription termination sequence.
  • a signal sequence e.g., a sequence encoding a polypeptide of the present disclosure (e.g., derived from the information provided herein)
  • an enhancer element e.g., derived from the information provided herein
  • a promoter e.g., a promoter
  • a transcription termination sequence e.g., a transcription termination sequence.
  • vectors can be plasmids, viral e.g. phage or phagemid as appropriate.
  • Many known techniques and protocols for manipulation of nucleic acid for example, in the preparation of nucleic acid constructs, mutagenesis, introduction of DNA into cells and gene expression and analysis of protein are
  • Useful expression vectors can consist of segments of chromosomal, non- chromosomal and synthetic DNA sequences.
  • Suitable vectors include derivatives of SV40 and known bacterial plasmids, e.g., E.
  • coli plasmids col El, Perl, Pbr322, Pmb9 and their derivatives, plasmids such as RP4; phage DNAs, e.g., the numerous derivatives of phage ⁇ e.g., NM989, and other phage DNA, e.g., M13 and filamentous single stranded phage DNA; yeast plasmids such as the 2u plasmid or derivatives thereof; vectors useful in eukaryotic cells, such as vectors useful in insect or mammalian cells; vectors derived from combinations of plasmids and phage DNAs, such as plasmids that have been modified to employ phage DNA or other expression control sequences; and the like.
  • phage DNAs e.g., the numerous derivatives of phage ⁇ e.g., NM989, and other phage DNA, e.g., M13 and filamentous single stranded phage DNA
  • Exemplary signal sequences include prokaryotic secretion signals (e.g., DsbA, pelB, alkaline phosphatase, penicillinase, Ipp, or heat-stable enterotoxin II), yeast secretion signals (e.g., invertase leader, a factor leader, or acid phosphatase leader) or mammalian secretion signals (e.g., herpes simplex gD signal).
  • prokaryotic secretion signals e.g., DsbA, pelB, alkaline phosphatase, penicillinase, Ipp, or heat-stable enterotoxin II
  • yeast secretion signals e.g., invertase leader, a factor leader, or acid phosphatase leader
  • mammalian secretion signals e.g., herpes simplex gD signal
  • leader peptides include those active in prokaryotes (such as PelB, OmpA, PIN, DsbA, TorT, TolB, phoA promoter, ⁇ -lactamase and lactose promoter systems, alkaline phosphatase, a tryptophan (trp) promoter system, and hybrid promoters such as the tac promoter).
  • prokaryotes such as PelB, OmpA, PIN, DsbA, TorT, TolB, phoA promoter, ⁇ -lactamase and lactose promoter systems, alkaline phosphatase, a tryptophan (trp) promoter system, and hybrid promoters such as the tac promoter).
  • Suitable bacterial promoters include the E. coli lacl and lacZ promoters, the T3 and T7, T5 promoters, the gpt promoter, the lambda PR and PL promoters and the trp promoter.
  • Eukaryotic promoters include the CMV immediate early promoter, the HSV thymidine kinase promoter, the early and late SV40 promoters, the promoters of retroviral LTRs, such as those of the Rous sarcoma virus (RSV), and metallothionein promoters, such as the mouse metallothionein-l promoter.
  • Exemplary promoters active in mammalian cells include cytomegalovirus immediate early promoter (CMV-IE), human elongation factor 1 -a promoter (EF1 ), small nuclear RNA promoters (U1 a and U1 b), a-myosin heavy chain promoter, Simian virus 40 promoter (SV40), Rous sarcoma virus promoter (RSV), Adenovirus major late promoter, ⁇ -actin promoter; hybrid regulatory element comprising a CMV enhancer/ ⁇ -actin promoter or an immunoglobulin promoter or active fragment thereof.
  • CMV-IE cytomegalovirus immediate early promoter
  • EF1 human elongation factor 1 -a promoter
  • U1 a and U1 b small nuclear RNA promoters
  • a-myosin heavy chain promoter Simian virus 40 promoter (SV40), Rous sarcoma virus promoter (RSV), Adenovirus major late promoter, ⁇ -actin promote
  • Examples of useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7, AUSTRALIAN CELL BANK CRL 1651 ); human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture; baby hamster kidney cells (BHK, AUSTRALIAN CELL BANK CCL 1 0); or Chinese hamster ovary cells (CHO).
  • COS-7 monkey kidney CV1 line transformed by SV40
  • human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture
  • baby hamster kidney cells BHK, AUSTRALIAN CELL BANK CCL 1 0
  • Chinese hamster ovary cells CHO
  • Typical promoters suitable for expression in yeast cells such as for example a yeast cell selected from the group comprising Pichia pastoris, Saccharomyces cerevisiae and S. pombe, include, but are not limited to, the ADH1 promoter, the GAL 1 promoter, the GAL4 promoter, the CUP1 promoter, the PH05 promoter, the nmt promoter, the RPR1 promoter, or the TEF1 promoter.
  • Means for introducing the isolated nucleic acid molecule or a gene construct comprising same into a cell for expression are known to those skilled in the art. The technique used for a given cell depends on the known successful techniques. Means for introducing recombinant DNA into cells include microinjection, transfection mediated by DEAE-dextran, transfection mediated by liposomes such as by using lipofectamine (Gibco, MD, USA) and/or cellfectin (Gibco, MD, USA), PEG-mediated DNA uptake, electroporation, viral transduction (e.g., using a lentivirus) and microparticle bombardment such as by using DNA-coated tungsten or gold particles (Agracetus Inc., Wl, USA) amongst others.
  • polypeptide insoluble form In some cases it is useful to express a protein, polypeptide or peptide in insoluble form, particularly when the polypeptide of interest is rather short, normally soluble, and/or subject to proteolytic degradation within the host cell. Production of the protein in insoluble form both facilitates simple recovery and protects the polypeptide from the undesirable proteolytic degradation.
  • One means to produce the polypeptide in insoluble form is to recombinantly produce the polypeptide as part of an insoluble fusion protein by including in the fusion construct at least one peptide tag (i.e., an inclusion body tag) that induces inclusion body formation.
  • the fusion protein is designed to include at least one cleavable peptide linker so that the polypeptide of interest can be subsequently recovered from the fusion protein.
  • the fusion protein may be designed to include a plurality of inclusion body tags, cleavable peptide linkers, and regions encoding the polypeptide of interest.
  • Fusion proteins comprising a peptide tag that facilitate the expression of insoluble proteins are well known in the art.
  • the tag portion of the chimeric or fusion protein is large, increasing the likelihood that the fusion protein will be insoluble.
  • large peptide tags typically used include, but are not limited to chloramphenicol acetyltransferase (Dykes et al., Eur. J. Biochem., 174:41 1 (1988), .beta.-galactosidase (Schellenberger et al., Int. J. Peptide Protein Res., 41 :326 (1993); Shen et al., Proc. Nat. Acad. Sci.
  • Shorter inclusion body tags have recently been developed from the Zea mays zein protein (U.S. patent application Ser. No. 1 1 /641 ,936), the Daucus carota cystatin (U.S. patent application Ser. No. 1 1 /641 ,273), and an amyloid-like hypothetical protein from Caenorhabditis elegans (U.S. patent application Ser. No. 1 1 /516,362; each hereby incorporated by reference in their entirety)
  • the use of short inclusion body tags increases the yield of the target peptide produced within the recombinant host cell.
  • a recombinant host cell which comprises one or more polynucleotide constructs.
  • a polynucleotide encoding an i-body of the present disclosure is encompassed herein as are methods of production of i-bodies which method comprises expression from a polynucleotide. Expression can be achieved, for example, by culturing under appropriate conditions recombinant host cells containing the polynucleotide.
  • the host cells used to produce the binding molecule or poypeptide of this disclosure may be cultured in a variety of media, depending on the cell type used.
  • Commercially available media such as Ham's FI0 (Sigma), Minimal Essential Medium ((MEM), (Sigma), RPMI-1 640 (Sigma), and Dulbecco's Modified Eagle's Medium ((DMEM), Sigma) are suitable for culturing mammalian cells.
  • Media for culturing other cell types discussed herein are known in the art. It will be understood that not all vectors, expression control sequences and hosts will function equally well to express the DNA sequences. Neither will all hosts function equally well with the same expression system.
  • the present disclosure also provides a host cell containing one or more polynucleotides as disclosed herein.
  • the present disclosure also provides a method of introducing such one or more polynucleotides into a host cell by any suitable technique as described above.
  • expression of the polynucleotide can occur, e.g. by culturing host cells under conditions for expression of one or more polypeptides from one or more polynucleotides.
  • a polynucleotide encoding an i-body of the present disclosure can be prepared recombinantly/synthetically, in addition to, or rather than cloning.
  • the polynucleotide can be designed with the appropriate codons for the CXCR4 binding polypeptide. In general, one will select preferred codons for an intended host if the sequence will be used for expression.
  • the complete polynucleotide can be assembled from overlapping oligonucleotides prepared by standard methods and assembled into a complete coding sequence. See, e.g., Edge, Nature, 292:756 (1981 ); Nambair et al., Science, 223:1299 (1984); Jay et al., J. Biol. Chem., 259:631 1 (1984).
  • a CXCR4 binding molecule or polypeptide or i-body of the present disclosure can be isolated or purified.
  • the polypeptide of the disclosure can be produced intracellularly, in the periplasmic space, or directly secreted into the medium. If the protein is produced intracellularly, as a first step, the particulate debris, either host cells or lysed fragments, is removed, for example, by centrifugation or ultrafiltration. Where the protein is secreted into the medium, supernatants from such expression systems can be first concentrated using a commercially available protein concentration filter, for example, an Amicon or Millipore Pellicon ultrafiltration unit. A protease inhibitor such as PMSF may be included in any of the foregoing steps to inhibit proteolysis and antibiotics may be included to prevent the growth of adventitious contaminants.
  • a protease inhibitor such as PMSF may be included in any of the foregoing steps to inhibit proteolysis and antibiotics may be included to prevent the growth of adventitious contaminants.
  • the protein prepared from the cells can be purified using, for example, ion exchange, hydroxyapatite chromatography, hydrophobic interaction chromatography, gel electrophoresis, dialysis, affinity chromatography (e.g., protein A affinity chromatography or protein G chromatography), heat, or any combination of the foregoing. These methods are known in the art and described, for example in W099/57134.
  • a polypeptide of the disclosure can be modified to include a tag to facilitate purification or detection, e.g., a poly-histidine tag, e.g., a hexa-histidine tag, or a influenza virus hemagglutinin (HA) tag, or a Simian Virus 5 (V5) tag, or a FLAG tag, or a glutathione S-transferase (GST) tag.
  • a poly-histidine tag e.g., a hexa-histidine tag, or a influenza virus hemagglutinin (HA) tag, or a Simian Virus 5 (V5) tag, or a FLAG tag, or a glutathione S-transferase (GST) tag.
  • a poly-histidine tag e.g., a hexa-histidine tag, or a influenza virus hemagglutinin (HA) tag, or a Simian Virus 5
  • a protein comprising a hexa-his tag is purified by contacting a sample comprising the protein with nickel-nitrilotriacetic acid (Ni-NTA) that specifically binds a hexa-his tag immobilized on a solid or semi-solid support, washing the sample to remove unbound protein, and subsequently eluting the bound protein.
  • Ni-NTA nickel-nitrilotriacetic acid
  • a polypeptide, ligand or antibody that binds to a tag is used in an affinity purification method.
  • the present disclosure also provides conjugates of CXCR4 binding molecules or polypeptides described herein.
  • Examples of compounds to which a polypeptide of the present disclosure can be conjugated are selected from the group consisting of a radioisotope, a detectable label, a therapeutic compound, a colloid, a toxin, a nucleic acid, a peptide, a protein, a compound that increases the half life of the protein in a subject and mixtures thereof.
  • Exemplary therapeutic agents include, but are not limited to an anti-angiogenic agent, an anti-neovascularization and/or other vascularization agent, an anti-proliferative agent, a pro- apoptotic agent, a chemotherapeutic agent, anti-mitotic agents (eg anti-mitotic agent Auristatin, (MMAF/MMAE as per Angew. Chem. Int. Ed. 2014, 53, 1 - 6) or a therapeutic nucleic acid.
  • an anti-angiogenic agent an anti-neovascularization and/or other vascularization agent
  • an anti-proliferative agent e.g., a pro- apoptotic agent
  • a chemotherapeutic agent eg anti-mitotic agent Auristatin, (MMAF/MMAE as per Angew. Chem. Int. Ed. 2014, 53, 1 - 6) or a therapeutic nucleic acid.
  • a chemotherapeutic agent eg anti-mitotic agent Auristat
  • a toxin includes any agent that is detrimental to (e.g., kills) cells.
  • kills e.g., kills
  • a toxin includes any agent that is detrimental to (e.g., kills) cells.
  • Exemplary toxins include diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin and the tricothecenes. See, for example, W093/21232.
  • the CXCR4 binding molecules or polypeptides or i-bodies can be covalently or non-covalently coupled to a cytotoxin or other cell proliferation inhibiting compound, in order to localise delivery of that agent to a tumour cell.
  • the agent can be selected from the group consisting agents, enzyme inhibitors, proliferation inhibitors, lytic agents, DNA or RNA synthesis inhibitors, membrane permeability modifiers, DNA metabolites, dichloroethylsulfide derivatives, protein production inhibitors, ribosome inhibitors, inducers of apoptosis, and neurotoxins.
  • chemotherapeutic agents for forming immunoconjugates of the present disclosure include taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorubicin, daunorubicin, dihydroxy anthracin dione, mitoxantrone, mithramycin, actinomycin D, 1 de-hydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, and puromycin, antimetabolites (such as methotrexate, 6-mercaptopurine, 6 thioguanine, cytarabine, fludarabin, 5-fluorouracil, decarbazine, hydroxyurea, asparaginase, gemcitabine, cladribine), alkylating agents (such as mechlorethamine
  • a CXCR4 binding molecule or polypeptide as described herein is conjugated or linked to another protein (e.g. Human Serum Albumin or HSA), including another CXCR4 binding molecule or polypeptide of the disclosure or a protein comprising a CDR1 and/or CDR3 region as described herein.
  • another protein e.g. Human Serum Albumin or HSA
  • HSA Human Serum Albumin
  • a CXCR4 binding molecule or polypeptide as described herein may also be conjugated to another binding molecule or polypeptide which targets, for example, a tumour antigen, or a target that has the potential to redirect and activate any circulating T cells against tumors (for example CD3), or a target that is notably expressed on monocytes and macrophages and upregulated upon activation on neutrophils (for example CD64) or a target that is expressed on the surface of natural killer cells, neutrophil polymorphonuclear leukocytes, monocytes and macrophages.
  • a tumour antigen for example CD3
  • a target that has the potential to redirect and activate any circulating T cells against tumors for example CD3
  • a target that is notably expressed on monocytes and macrophages and upregulated upon activation on neutrophils for example CD64
  • the binding molecule or polypeptide is a low affinity binder of IgG (for example CD1 6) or a target that is constitutively expressed primarily on neutrophils, monocytes, macrophages and eosinophils (for example CD89).
  • IgG for example CD1 6
  • target that is constitutively expressed primarily on neutrophils, monocytes, macrophages and eosinophils
  • Additional proteins will be apparent to the skilled artisan and include, for example, an immunomodulator or a half-life extending protein or a peptide or polypeptide or other protein that binds to serum albumin amongst others.
  • Exemplary serum albumin binding peptides or protein are described in US20060228364 or US20080260757.
  • a CXCR4 binding molecule or polypeptide of the present disclosure is conjugated to an XTEN polypeptide as described in Schellenberger et al (2009) Nature Biotechnology 27(12):1 186-1 192.
  • a CXCR4 binding molecule or polypeptide of the present disclosure is conjugated to a polypeptide as described in Schlapschy et al (2013) Protein Engineering, Design & Selection vol. 26 no. 8 pp. 489 - 501 .
  • a polypeptide of the present disclosure is conjugated to an Fc region of an immunoglobulin as described, for example, in Peters et al (2010), Blood Vol. 1 15 no. 1 0 2057-2064, Kim et al, (2009) BMB Rep. 42:212-216 and Nagashima et al (201 1 ) J Biochem. 149: 337-346.
  • CXCR4 binding polypeptide conjugates can be prepared using methods known in the art. For example, each binding specificity of the bispecific molecule can be generated separately and then conjugated to one another. When the binding specificities are proteins, polypeptides or peptides, a variety of coupling or cross-linking agents can be used for covalent conjugation.
  • cross-linking agents examples include protein A, carbodiimide, N- succinimidyl-S-acetyl- thioacetate (SATA), 5,5'-dithiobis(2-nitrobenzoic acid) (DTNB), o- phenylenedimaleimide (oPDM), N-succinimidyl-3-(2-pyridyldithio)propionate (SPDP), and sulfosuccinimidyl 4-(N-maleimidomethyl) cyclohaxane-1 -carboxylate (sulfo- SMCC) (see e.g., Karpovsky el al. (1984) J. Exp.
  • radionuclides are available for the production of radioconjugated proteins. Examples include, but are not limited to, low energy radioactive nuclei (e.g., suitable for diagnostic purposes), such as 13C, 15N, 2H, 1251, 1231, 99Tc, 43K, 52Fe, 67Ga, 68Ga, 1 1 1 1n and the like.
  • the radionuclide is a gamma, photon, or positron-emitting radionuclide with a half-life suitable to permit activity or detection after the elapsed time between administration and localization to the imaging site.
  • the present disclosure also encompasses high energy radioactive nuclei (e.g., for therapeutic purposes), such as 1251, 131 1, 1231, 1 1 1 ln, 105Rh, 153Sm, 67Cu, 67Ga, 166Ho, 177Lu, 1 86Re and 188Re.
  • high energy radioactive nuclei e.g., for therapeutic purposes
  • isotopes typically produce high energy a- or ⁇ -particles which have a short path length.
  • Such radionuclides kill cells to which they are in close proximity, for example neoplastic cells to which the conjugate has attached or has entered. They have little or no effect on non-localized cells and are essentially non-immunogenic.
  • high-energy isotopes may be generated by thermal irradiation of an otherwise stable isotope, for example as in boron neutron-capture therapy (Guan et al., 1998).
  • isotopes which may be suitable are described in Carter. (2001 ) Nature Reviews Cancer 1 , 1 18-129, Goldmacher et al. (201 1 ) Therapeutic Delivery 2;397-416, Payne (2003) Cancer Cell 3, 207-212, Schrama et al, (2006) Nature Rev. Drug Discov. 5, 147-159, Reichert et al. (2007) Nature Reviews Drug Discovery 6; 349-356.
  • the protein is conjugated to a "receptor” (such as streptavidin) for utilization in cell pretargeting wherein the conjugate is administered to the patient, followed by removal of unbound conjugate from the circulation using a clearing agent and then administration of a "ligand” (e.g., avidin) that is conjugated to a therapeutic agent (e.g., a radionucleotide).
  • a "receptor” such as streptavidin
  • a "ligand” e.g., avidin
  • a therapeutic agent e.g., a radionucleotide
  • the CXCR4 binding molecules or polypeptides of the present disclosure can be modified to contain additional nonproteinaceous moieties that are known in the art and readily available.
  • the moieties suitable for derivatization of the protein are physiologically acceptable polymer, e.g., a water soluble polymer.
  • a water soluble polymer Such polymers are useful for increasing stability and/or reducing clearance (e.g., by the kidney) and/or for reducing immunogenicity of a CXCR4 binding polypeptide of the disclosure.
  • water soluble polymers include, but are not limited to, polyethylene glycol (PEG), polyvinyl alcohol (PVA), or propropylene glycol (PPG).
  • a CXCR4 binding molecule or polypeptide as described herein comprises one or more detectable markers to facilitate detection and/or isolation.
  • the compound comprises a fluorescent label such as, for example, fluorescein (FITC), 5,6- carboxymethyl fluorescein, Texas red, nitrobenz-2-oxa-l,3- diazol-4-yl (NBD), coumarin, dansyl chloride, rhodamine, 4'-6-diamidino-2- phenylinodole (DAPI), and the cyanine dyes Cy3, Cy3.5, Cy5, Cy5.5 and Cy7, fluorescein (5-carboxyfluorescein-N-hydroxysuccinimide ester), rhodamine (5,6- tetramethyl rhodamine).
  • FITC fluorescein
  • NBD nitrobenz-2-oxa-l,3- diazol-4-yl
  • DAPI nitrobenz-2-oxa-l,3- dia
  • the absorption and emission maxima, respectively, for these fluors are: FITC (490 nm; 520 nm), Cy3 (554 nm; 568 nm), Cy3.5 (581 nm ; 588 nm), Cy5 (652 nm : 672 nm), Cy5.5 (682 nm ; 703 nm) and Cy7 (755 nm ; 778 nm).
  • the i-bodies of the present disclosure can be coupled with an agent useful in imaging tumors.
  • agents include: metals; metal chelators; lanthanides; lanthanide chelators; radiometals; radiometal chelators; positron-emitting nuclei; microbubbles (for ultrasound); liposomes; molecules microencapsulated in liposomes or nanosphere; monocrystalline iron oxide nanocompounds; magnetic resonance imaging contrast agents; light absorbing, reflecting and/or scattering agents; colloidal particles; fluorophores, such as near- infrared fluorophores.
  • such secondary functionality/moiety will be relatively large, e.g., at least 25 amu in size, and in many instances can be at least 50,100 or 250 amu in size.
  • the secondary functionality is a chelate moiety for chelating a metal, e.g., a chelator for a radiometal or paramagnetic ion. In additional examples, it is a chelator for a radionuclide useful for radiotherapy or imaging procedures.
  • the CXCR4 binding molecule or polypeptide as described herein is labelled with, for example, a fluorescent semiconductor nanocrystal (as described, for example, in US6306610).
  • the CXCR4 binding molecule or polypeptide is labelled with, for example, a magnetic or paramagnetic compound, such as, iron, steel, nickel, cobalt, rare earth materials, neodymium-iron-boron, ferrous-chromium-cobalt, nickel-ferrous, cobalt- platinum, or strontium ferrite.
  • a magnetic or paramagnetic compound such as, iron, steel, nickel, cobalt, rare earth materials, neodymium-iron-boron, ferrous-chromium-cobalt, nickel-ferrous, cobalt- platinum, or strontium ferrite.
  • a CXCR4 binding molecule or polypeptide of the disclosure is immobilized on a solid or semi-solid matrix.
  • immobilization is to be understood to involve various methods and techniques to fix proteins onto specific matrices, e.g. as described in W099/56126 or WO02/26292.
  • immobilization can serve to stabilize the proteins so that its activity is not reduced or adversely modified by biological, chemical or physical exposure, especially during storage or in single-batch use.
  • Exemplary matrices include porous gels, aluminium oxide, bentonite, agarose, starch, nylon or polyacrylamide. Assaying Activity of a CXCR4 Binding Molecule or Polypeptide of the Disclosure
  • the most specific and potent antibodies against G-protein coupled receptors typically target conformationally-complex epitopes formed by the tertiary structure of the proteins.
  • the approaches used with regard to soluble protein targets are not effective for membrane spanning proteins, whose native structure depends on an intact lipid bilayer.
  • CXCR4 binding molecules or polypeptides of the present disclosure can be tested for binding to CXCR4 by, for example, standard flow cytometric methods. Since the CXCR4 binding molecules or polypeptides of the present disclosure preferably recognise human CXCR4 in its native conformation, binding to CXCR4 is preferably determined using an assay that utilises a reagent expressing the native conformation of CXCR4. Non-limiting examples of reagents expressing native conformation CXCR4 that can be used in the binding assays include cells that naturally express CXCR4, cells that have been transfected to express CXCR4 (e.g. R161 0 cells transfected with a CXCR4 expression vector).
  • suitable cells that express CXCR4 include MDA-MB-231 , MDA-MB-468, MDA-MB-361 , MDA-MB-549, Ramos, Namalwa, MOLT-4, DU-4475, DU-145, PC3, LNcaP, SW480, HT29, NCI-H69, SJSA-1 -met-luc and HL-60 cells. Briefly, for the flow cytometry assay, cells expressing CXCR4 are incubated with the test CXCR4 binding molecule or polypeptide, washed, incubated with a labelled secondary reagent capable of binding to the test antibody, washed again, and subjected to analysis to detect the binding of the secondary reagent to the cells (e.g.
  • binding assays suitable for use according to the present disclosure include radioligand binding assays such as the filtration assay (PerkinElmer) or the SPA assay (PerkinElmer or GE Healthcare), or tagged ligand binding assays such as DELFIATM TRF (PerkinElmer), LanthaScreenTM system (Invitrogen), or Tag-liteTM system (Cisbio).
  • radioligand binding assays such as the filtration assay (PerkinElmer) or the SPA assay (PerkinElmer or GE Healthcare
  • tagged ligand binding assays such as DELFIATM TRF (PerkinElmer), LanthaScreenTM system (Invitrogen), or Tag-liteTM system (Cisbio).
  • a cell line such as a CHO cell line may be transfected with an expression vector encoding a transmembrane form of CXCR4.
  • the transfected protein may comprise a tag, such as a myc-tag, preferably at the N-terminus, for detection using an antibody to the tag. Binding of a CXCR4 binding molecule or polypeptide of this disclosure to CXCR4 may be determined by incubating the transfected cells with the CXCR4 binding polypeptide, and detecting bound polypeptide. Binding of an antibody to the tag on the transfected protein may be used as a positive control.
  • a further approach for assessing binding requires the use of lipoparticles which are capable of incorporating high concentrations of target membrane proteins in their native conformations (e.g. magnetic proteoliposomes incorporating CXCR4 or liposome particles incorporating CXCR4).
  • lipoprotein particles are described in, for example WO 2005/042695, WO 201 1 /083141 , Banik et al (2009) Drug Discovery & Development 12(9):14- 17; Willis S et al (2008) Biochemistry 47:6988-90.
  • Lipoparticles are produced from mammalian cells by co-expressing the retroviral structural core polyprotein, Gag, along with a desired membrane protein (e.g. CXCR4).
  • Gag core proteins self assemble at the plasma membrane where they bud off and capture target membrane proteins.
  • Lipoproteins are approximately 150nm in diameter so are readily suspended in aqueous solutions that can be used for inoculation. Because membrane proteins within lipoparticles are derived directly from the cell surface without mechanical disruption or detergents, the native structure and orientation of the membrane proteins is retained. Lipoproteins do not contain cytoplasmic proteins or inverted membrane proteins that can result in an unfocussed immune response.
  • the lipoproteins can be immobilised onto a solid support using standard techniques and binding by the CXCR4 molecules or polypeptides according to the present disclosure analysed by surface Plasmon resonance (see for example Maynard JA et al (2009) Biotechnol J 4(1 1 ):1542-1558, Stenlund P et al (2003) Anal Biochem 316(2):243-50, Hoffman et al (2000) Proc Natl Acad Sci 97:1 1215- 1 1220, WO 2005/042695).
  • the lipoparticles can be mutated residue by residue to determine which residues of CXCR4 the CXCR4 binding polypeptides of the present disclosure are binding. This validates critical residues that represent amino acids whose side chains make the highest energetic contributions to the interaction between the binding CXCR4 binding polypeptide and the CXCR4 epitope (Bogan and Thorn, (1998) J. Mol. Biol. 280, 1 -9; Lo Conte et al., (1999) J. Mol. Biol. 285, 2177-21 98.
  • Another assay is an antigen binding assay, e.g., as described in Scopes In: Protein purification: principles and practice, Third Edition, Springer Verlag, 1 994.
  • Such a method generally involves labelling the CXCR4 binding molecule or polypeptide and contacting it with immobilized target or a fragment thereof, e.g., human CXCR4 or CXCR4 positive lipoparticle. Following washing to remove non-specific bound protein, the amount of label and, as a consequence, bound protein is detected.
  • the CXCR4 binding molecule or polypeptide can be immobilized and the target labeled. Panning-type assays can also be used.
  • An exemplary method for determining an inhibitor of CXCR4 activity is a competitive binding assay.
  • labelled SDF-1 is added to cells expressing CXCR4 or immobilised CXCR4 positive lipoparticles either with a CXCR4 binding molecule or polypeptide or after addition of the CXCR4 binding molecule or polypeptide.
  • the amount of label bound to CXCR4 is detected. This is compared to the amount bound following incubation in the absence of CXCR4 binding molecule or polypeptide, and a CXCR4 binding molecule or polypeptide that reduced the amount of SDF-1 binding (i.e. bound label) is considered a CXCR4 inhibitory agent.
  • Binding assays can also be used to detect receptor-mediated G -protein activation (e.g. Regulation of G Protein-Coupled Receptor Function and Expression ed. Benovic JL pp1 19-132 (2000) Wiley-Liss NY). Such assays include receptor-stimulated GTP binding to Ga subunits. Activation of GPCR results in GDP-GTP exchange in the Ga subunit and this exchange can be quantified and used as a direct measurement of the receptor-G protein interaction. This typically involves the use of radiolabeled guanine nucleotide with the receptor in cell free membrane preparations or artificial lipid membranes. The amount of radiolabel incorporated is used as a measure of the extent of G protein activation. Methods for assaying antigen-binding affinity are well known in the art and also include half-maximal binding assays, competition assays, and Scatchard analysis.
  • the dissociation rate constant (Kd), association rate constant (Ka) or binding constant/equilibrium dissociation constant (K D , i.e., Koff/Kon) of a CXCR4 binding polypeptide is determined.
  • Kd dissociation rate constant
  • Ka association rate constant
  • K D binding constant/equilibrium dissociation constant
  • K D binding constant/equilibrium dissociation constant
  • the constants are measured by using surface plasmon resonance assays, e.g., using BIAcore surface plasmon resonance (BIAcore, Inc., Piscataway, NJ) with immobilized CXCR4 positive lipoparticles (WO 2005/042695).
  • surface plasmon resonance assays e.g., using BIAcore surface plasmon resonance (BIAcore, Inc., Piscataway, NJ) with immobilized CXCR4 positive lipoparticles (WO 2005/042695).
  • the dissociation rate constant (Kd) is used to calculate the off rate (koff), a constant used to calculate how quickly a binding molecule dissociates from its target.
  • Koff the off rate
  • a flatter slope seem in BIAcore SPR analysis indicates a slower off rate and hence stronger binding.
  • a steeper downside means a faster off rate/weaker antibody binding.
  • the association rate constant (Ka) is the part of the reaction used to calculate the on rate, a constant used to characterise how quickly the binding molecule binds to its target.
  • K D value K D value.
  • Most binding molecules have K D values in the low micromolar (10 ⁇ 6 ) to nanomolar (10 ⁇ 7 to 10 ⁇ 9 ) range.
  • High affinity antibodies are generally considered to be in the low nanomolar range (10 ⁇ 9 ) with very high affinity antibodies being in the picomolar (10 ⁇ 12 ) range.
  • the binding of a ligand, such as an agonist or SDF-1 to CXCR4 can result in signalling by this G protein coupled receptor, and the activity of G proteins as well as stimulating other intracellular signalling molecules.
  • the inhibitory or stimulatory activity of a CXCR4 binding molecule or polypeptide of the present disclosure can be determined with or without a ligand in a suitable assay, as well as the assessment of the ability of the CXCR4 binding molecule or polypeptide to inhibit or stimulate the activity in the presence or absence of the ligand.
  • the activity of the CXCR4 receptor by the CXCR4 binding molecule or polypeptide of the present disclosure can be measured in a number of ways, for example alteration of ⁇ - arrestin modulation, alteration in intracellular Ca 2+ concentration, activation of phospholipase C, alteration in intracellular inositol triphosphate QP3 concentration, alteration in intracellular diacylglycerol (DAG) concentration, and alteration in intracellular adenosine cyclic 3', 5'- monophosphate (cAMP) concentration.
  • ⁇ - arrestin modulation alteration in intracellular Ca 2+ concentration
  • activation of phospholipase C alteration in intracellular inositol triphosphate QP3 concentration
  • DAG diacylglycerol
  • cAMP adenosine cyclic 3', 5'- monophosphate
  • G protein activity such as hydrolysis of GTP to GDP, or later signalling event triggered by receptor binding, such as induction of rapid and transient increase in the concentration of intracellular (cytosolic) free calcium can be assayed by methods known in the art or other suitable methods (e.g. Neote et al (1993) Cell 72:415-425; Van Riper et al (1993) J. Exp. Med 177:851 -856).
  • Activation of GPCRs by the polypeptides of the invention can be monitored by measuring the increase or decrease in intracellular cAMP with fluorescent dyes.
  • Methods of measuring intracellular cAMP are known in the art. Assays measuring cellular levels of cAMP are dependent on the activity of adenylate cyclase, which is regulated by GPCRs coupled to Ga s or Ga i 0 protein. Adenylate cyclase requires pre-stimulation with forskolin.
  • PDE phosphodiesterase
  • an inhibitor of PDE e.g. IBMX
  • membrane permeant dyes examples include acetoxymethyl ester forms of dyes that can be cleaved by intracellular esterases to form a free acid, which is no longer membrane permeant and remains trapped inside a cell.
  • Assays designed to directly measure levels of cAMP produced upon modulation of adenylate cyclase activity by GPCRs can also be used. Such assays are based on competition between endogenous cAMP and exogenously added biotinylated cAMP. Capture of cAMP is achieved by using a specific antibody conjugated to a solid material such as a capture bead.
  • Radiometric assays such as the SPA cAMP assay (GE Healthcare) and the FlashPlateTM cAMP assay from PerkinElmer using 125 l-labelled cAMP are widely used. More recently these assays have been replaced with luminescence or fluorescence based homogenous assays to avoid the use of radioactivity.
  • a further assay is the Enzyme Fragment Complementation assay (HitHunterTM) by DiscovRx. Cellular cAMP competes with cAMP labelled with a small peptide fragment of ⁇ -galactosidase for binding to an anti-cAMP antibody.
  • the resulting free labelled cAMP complements with the enzyme fragment, producing active ⁇ - galactosidase which is detected with fluorescent or luminescent substrates.
  • AlphaScreenTM PerkinElmer
  • Cellular cAMP competes with a biotinylated cAMP probe recognized by a streptavidin donor and anti-cAMP antibody-conjugated acceptor beads. Release of the biotinylated cAMP from the antibody results in the dissociation of the streptavidin donor from its acceptor, which can be measured as a decrease in the chemiluminescent signal.
  • fluorescence polarization (FP)-based cAMP kits are available from Perkin- Elmer, Molecular Devices and GE Healthcare.
  • HTRF-based cAMP detection is available from Cisbio.
  • novel donor (cAMP antibody labelled with europium cryptate) and acceptor (cAMP labelled with a modified allophycocyanin dye) pairs are designed to increase the stability of the signal and make this assay highly sensitive and reproducible for cAMP measurement.
  • cAMP-GloTM assay Promega
  • cAMP-GloTM assay Promega
  • the assay is based on cAMP as a potent activator of the tetrameric, inactive cAMP-dependent protein kinase (PKA) resulting in dissociation of its cAMP-bound regulatory subunits and release of the free, active catalytic subunits.
  • PKA cAMP-dependent protein kinase
  • Activation of PKA can be monitored by measuring APT use in a kinase reaction with a luciferase/luciferin-based reaction.
  • the amount of ATP consumed reflects the activation of PKA by cAMP.
  • Beta-arrestins are intracellular proteins that are recruited to the cell surface following activation of the GPCR. They regulate the activity of G protein-coupled receptors (GPCRs) (Luttrell et al. (2002) Journal of Cell Science, 1 15:455-465). In this case by the polypeptides of the invention, resulting in desensitization and targeting of the receptor for internalization. In addition to its role in receptor desensitization, termination of G protein-coupled signalling, and internalization, ⁇ -arrestin also acts as a scaffolding protein to link activated GPCR's to additional intracellular signalling pathways such as activation of c-Src, ERK 1 /2 and Akt in a G protein-independent manner.
  • GPCRs G protein-coupled receptors
  • ⁇ -arrestin recruitment includes, the TransFluor ® assay (Molecular Devices) in which ⁇ -arrestin is coupled to GFP and upon receptor activation, diffuse cytoplasmic distribution of GFP changes to formation of GFP containing pits or vesicles that are visualized with high content imaging system.
  • TransFluor ® assay Molecular Devices
  • BRET Bioluminescence Resonance Energy Transfer
  • DiscoveRx PathHunterTM technology
  • TangoTM assay Invitrogen
  • the receptor of interest is tagged at the C-terminus with a fluorescent protein tag (such as eGFP2, GFP1 0 or YFP) and the ⁇ -arrestin is tagged with a Renilla luciferase (RLuc) or vice versa.
  • RLuc Renilla luciferase
  • Invitrogen's TangoTM GPCR Assay System is a platform based on a protease-activated reporter gene, ⁇ -arrestin is fused to a TEV protease, while GPCR is extended at its C-terminus with a protease cleavage site followed by the transcription factor Gal-VP16.
  • protease-tagged arrestin is recruited to the receptor and the Gal-VP16 that is fused to the receptor is cleaved and enters the nucleus to regulate the transcription of a ⁇ -lactamase reporter gene.
  • the ⁇ -lactamase catalyzes the cleavage of a modified substrate tagged with two fluorophores, and the change in FRET signal between these two fluorophores can be monitored.
  • the PathHunterTM assay utilizes enzyme fragment complementation of ⁇ - galactosidase and subsequent enzymatic activity to measure receptor ⁇ -arrestin interactions.
  • ⁇ -arrestin is fused to an N-terminal deletion mutant of ⁇ -galactosidase that is catalytically inactive, and GPCR is tagged at the C-terminus with a small (4 kDa) fragment derived from the deleted N-terminal sequence of ⁇ -galactosidase (ProLinkTM).
  • ProLinkTM small (4 kDa) fragment derived from the deleted N-terminal sequence of ⁇ -galactosidase
  • Activation of GPCRs by the polypeptides of the invention can be monitored by measuring the increase or decrease in intracellular calcium with fluorescent dyes.
  • the Ca2+ assay is very popular in GPCR screening owing to the availability of cell-permeable Ca2+- sensitive fluorescent dyes (such as Fluo-3 and Fluo-4) and automated realtime fluorescence plate readers, such as FLIPRTM (Molecular Device). Molecular Device also offers fluorescent dye kits, which contain proprietary quenching molecules that allow cellular loading of dye without the need of subsequent cell washing to remove excess dye.
  • the integrated pipetting capabilities of the FLIPRTM allow ultra high-throughput screening in 384- or 1536-well format with the ability to detect agonists, antagonists, and modulators all in one assay.
  • Chemotaxis assays can also be used to assess the ability of a CXCR4 binding polypeptide of the invention to block binding of a ligand to CXCR4 and/or inhibit function associated with binding of the ligand to the receptor (Fernandis et al. (2004) Oncogene 23: 157-167). These assays are based on the functional migration of cells in vitro or in vivo induced by a compound (chemoattractant). Chemotaxis can be assessed by any suitable means, for example, in an assay utilising a 96-well chemotaxis plate, or other art recognised method for assessing chemotaxis.
  • Jurkat cells, MDA-MB-231 , MDA-MB-468, PC3, or NCI-H69 cells can be assessed for migration utilising a chemotaxis assay.
  • Jurkat cells 5 10 5 cells in 200 ml RPMI-1 640
  • SDF-1 5-mM-pore polycarbonate Transwell culture insert (Costar, Cambridge, MA) with 0.25% BSA.
  • SDF-1 fixed concentration
  • Migrated cells in the lower chamber are counted with a ZM Coulter counter (Coulter Diagnostics, Hialeah, FL).
  • the CXCR4 binding polypeptides of the present disclosure can be assessed for their ability to inhibit cell proliferation of tumor cells (e.g. tumor cells expressing surface CXCR4 such as MDA-MB-231 , MDA-MB-361 , MDA-MB-549, Ramos, Namalwa, MOLT-4, DU-4475, DU-145, PC3, LNcaP, SW480, HT29, NCI-H69 and HL60), or in a cell line which has been engineered to express CXCR4.
  • the CXCR4 binding polypeptides of the present disclosure can also be assessed for their ability to inhibit cell proliferation of CD34 + progenitor cells (e.g. Kahn et al.
  • Cell proliferation assays will be known to persons skilled in the art. Examples of cell proliferation assays include the MTT Cell Proliferation Assay (ATCC), the CellTiter Aqueous Cell proliferation assay (Promega), alamarBlue Assay (Invitrogen), CyQUANT Direct Cell Proliferation assay (Life Technologies), for described in, for example WO01 /081614, and US5972639.
  • the CXCR4 binding molecules or polypeptides of the present disclosure can be assessed for their ability to induce apoptosis.
  • Apoptosis assays are available in a variety of formats which will be known to persons skilled in the art. These include:
  • caspase assays e.g. PhiPhiLux ® (Oncolmmunin, Inc), caspase 3 activity assay (Roche Applied Science), caspase-GloTM Assays (Promega), CaspACETM Assay System (Promega), EnzChek Caspase-3 assay kit (Invitrogen), Active Caspase-3 detection kits (Stratagene), Caspase-mediated apoptosis products (BioVision), CasPASETM Apoptosis Assay Kit (Genentech);
  • Annexin V assays e.g. Annexin V, Alexa Fluor ® (Invitrogen), Rhodamine 1 10, bis-(L- aspartic acid amide), trifluoroacetic acid salt (Invitrogen), Annexin V Apoptosis kits (BioVision);
  • Mitochondrial and ATP/ADP assays e.g. ApoGlow ® Rapid Apoptosis Screening kit, mitochondrial membrane potential detection kit (Stratagene) and Mitochondrial-mediated apoptosis products (BioVision); and
  • Angiogenesis is characterised by a number of cellular events including endothelial cell migration, invasion and differentiation into capillaries.
  • endothelial tube formation assays are used as a model for studying endothelial differentiation and modulation of endothelial tube formation by antiangiogenic agents (see for example Sharon McGonigle and Victor Shifrin Current Protocols in Pharmacology DOI: 10.1002/0471 141755. phi 212s43 or Liang et al, (2007) Biochem Biophys Res Commun. August 3; 359(3): 716-722.).
  • endothelial tube formation assays are performed using human umbilical vein endothelial cells (HUVEC), HMVEC and HMEC-1 cells.
  • the cells are plated onto a layer of Matrigel at a density of 1 x10 5 cells/ml of M199 medium with 1 % FBS and 200 ng/ml of CXCL12. After 18 hrs, the wells were photographed at 4x magnification and the number of their tubular networks is counted.
  • CXCR4 interacts with CXCR7, CCR5, p 2 AR ( ⁇ 2 adrenergic receptor), CCR2, DOR (Delta opiod receptor ) and CCR7 at the plasma membrane to form a heterodimer, oligomer or even higher order complexes including homodimers with CXCR4.
  • Compounds that specifically target GPRC heterodimers or affect receptor dimerisation may have potential to achieve specific therapeutic effects (Rozenfeld R et al (201 1 ) Biochem J 433:1 1 -8).
  • Various technologies have been established to monitor receptor dimerization, including resonance energy transfer approaches (FRET or BRET).
  • donor and acceptor molecules are genetically fused to the C-terminus of GPCRs, which are overexpressed in the cells.
  • Resonance energy transfer occurs when donor and acceptor molecules are brought into close proximity as a consequence of GPCR dimerization (reviewed in Achour L et al (201 1 ) Methods Mol Biol 756:183-200).
  • Achour L et al (201 1 ) Methods Mol Biol 756:183-200 one limitation of such traditional FRET and BRET assays is that in the overexpression system, resonance energy transfer can also occur within the intracellular compartments such that it is difficult to demonstrate a specific signal resulting only from a direct interaction of proteins at the cell surface.
  • the GPCR dimerization assay as described in US patent 8,283,127 entitled 'Detection System and Uses Therefor' covers Dimerix's Heteromer Identification Technology (HIT) assay configuration for ligand dependent identification, monitoring and screening of heteromers of any two proteins. It also covers the application of Dimerix's assay on all proximity based reporter systems.
  • HIT Heteromer Identification Technology
  • the GPCR dimerization assay with Tag-liteTM is a method combining TR-FRET with SNAP-tagTM technology (Cisbio), enabling quantitative analysis of protein-protein interactions at the surface of living cells in a 96- or 384-well format.
  • GPCRs are tagged with either a SNAP- or CLIP-tag at the N-terminus, which can be subsequently labelled with their corresponding cell-impermeable substrates carrying appropriate TR-FRET-compatible fluorophores, typically using terbium cryptate as a donor and a green or red fluorescent molecule as an acceptor.
  • 1 /4 of the dimers contain both receptors labeled with the donor
  • 1 /4 of the dimers contain both receptors labeled with the acceptors
  • 1 /2 of the dimers contain one receptor labeled with the donor and one receptor labelled with the acceptor. Only the last fraction will emit the FRET signal.
  • the PathHunterTM system (DiscoveRx) is another platform that can be used for GPCR heterodimerization analysis.
  • Cell lines utilized in the previously described PathHunterTM ⁇ - arrestin recruitment assay can be used as the starting material. In these cell lines, ⁇ -arrestin is fused to the larger portion of the ⁇ -galactosidase enzyme acceptor, and the smaller 42-amino acid ProLinkTM tag is attached to one of the GPCR targets.
  • a second untagged GPCR can be introduced into the cells and the transactivation effects of the untagged GPCR on the ProLinkTM-tagged GPCR can be measured by the recruitment of ⁇ -arrestin to the tagged-GPCR using PathHunter detection reagents.
  • the transactivation strength can be estimated as a ratio between the cellular response to the agonist of the untagged GPCR and the response to the agonist of ProlinkTM-GPCR.
  • the assay can be used to investigate the interaction between GPCR pairs, as well as screen for compounds that modulate GPCP activity through enhancing or disrupting GPCR heterodimerization in a 384-well format, for example CXCR4 and CXCR7, CXCR4 and CCR5 or CXCR4 and p 2 AR or CXCR4 and DOR or CXCR4 and CCR2 or CXCR4 and CCR7.
  • CXCR4 binding molecules including the ligand SDF-1 or polypeptides (i-bodies) to compete for binding to CXCR4.
  • the CXCR4 i-bodies are titrated in a 1 :3 serial dilution series resulting in a concentration range, for example from 100nm to 5pM in the presence of a constant concentration of SDF-1 or FITC-labelled human anti-CXCR4 antibody (e.g. 12G5).
  • the mixture is then added to CXCR4 expressing cells and allowed to bind.
  • the ability of each i-body to compete with 12G5 for binding to CXCR4 expressing cells can be assessed by fluorescent cytometry and detection of FITC.
  • the ability of the i-bodies of the present disclosure to bind to a variety of different cell lines can also be examined by flow cytometry by carrying out a FACS titration. Increasing amounts of the i-body can be incubated with 100,000 cells and binding assessed by flow cytometry. The Bmax value can also be determined, which indicated approximately how many CXCR4 molecules are present on each cell. Based on the binding curves, an EC50 for i-body binding can be determined.
  • suitable cell lines include Ramos, Raji, Namalwa, L540, DMS79, MDA-MB-231 , MDA-MB-361 , MDA-MB-549, MOLT-4, DU-4475, DU-145, PC3, LNcaP, SW480, HT29, NCI-H69 and HL60.
  • PBMCs peripheral blood mononuclear cells
  • Human PBMCs can be isolated by standard methods and the cellular subsets further isolated by FACS. Examples of cellular subsets include one or more of the following CD3+, CD20+, CD1 1 b+, and CD14+. Binding can be assessed by flow cytometry compared to a suitable control as shown in the examples herein.
  • the competition assay may be performed using lodine-125-labeled SDF-I and a cell line, which naturally express CXCR4 or CXCR4 lipoparticles.
  • a comparison of the i-bodies on blocking SDF-I binding to the CXCR4 expressing cell line can be performed by a standard radiolabeled ligand binding assay.
  • the i-bodies can be serially diluted 1 :3 to yield a range of concentrations and then added to CXCR4 expressing cells in the presence of 125 I-SDF- 1 with a specific activity of 2000 Ci/mmole (Amersham, catalog #EM314-25UCI).
  • the total possible bound radiolabeled ligand can be determined by allowing the 125 I-SDF-I to bind to CXCR4 expressing cells in the absence of i-bodies for 2 hours at 40°C. Non-specific binding of the radio-labeled ligand can be determined by allowing the 125 I-SDF-I to bind in the presence of 1 ⁇ unlabeled SDF-I (Peprotech, catalog # 300-28A). The amount of cell-associated 125 l- SDF-I is then determined by standard methods.
  • unlabelled SDF-1 could be used to compete the binding of the i-body to lipoparticles overexpressing CXCR4. Binding of the i-body to these lipoparticles could be detected using an antibody to the His tag or to the FLAG tag. Increasing concentrations of SDF-1 will be added and the amount of i-body remaining bound will be measured. This can be done in an ELISA format where the CXCR4 lipoparticles are immobilised on plastic. This information will determine if the binding site of the i-body on CXCR4 is the same or near or different to the ligand SDF-1 .
  • One example of the disclosure detects the presence of CXCR4 or a cell expressing same or a lipoparticle containing CXCR4 within the membrane.
  • the amount, level or presence of a protein or cell is determined using any of a variety of techniques known to the skilled artisan such as, for example, a technique selected from the group consisting of flow cytometry, immunohistochemistry, immunofluorescence, an immunoblot, a Western blot, a dot blot, an enzyme linked immunosorbent assay (ELISA), radioimmunoassay (RIA), enzyme immunoassay, fluorescence resonance energy transfer (FRET), matrix-assisted laser desorption/ionization time of flight (MALDI-TOF), electrospray ionization (ESI), mass spectrometry (including tandem mass spectrometry, e.g. LC MS/MS), biosensor technology, evanescent fiber-optics technology or protein chip technology.
  • the assay used to determine the amount or level of a protein is a semiquantitative assay.
  • the assay used to determine the amount or level of a protein is a quantitative assay.
  • the protein is detected with an immunoassay, e.g., using an assay selected from the group consisting of, immunohistochemistry, immunofluorescence, enzyme linked immunosorbent assay (ELISA), fluorescence linked immunosorbent assay (FLISA), Western blotting, radioimmunoassay (RIA), a biosensor assay, a protein chip assay and an immunostaining assay (e.g. immunofluorescence).
  • an immunoassay e.g., using an assay selected from the group consisting of, immunohistochemistry, immunofluorescence, enzyme linked immunosorbent assay (ELISA), fluorescence linked immunosorbent assay (FLISA), Western blotting, radioimmunoassay (RIA), a biosensor assay, a protein chip assay and an immunostaining assay (e.g. immunofluorescence).
  • an ELISA or FLISA comprises of immobilizing a CXCR4 lipoparticle on a solid matrix, such as, for example, a membrane, a polystyrene or polycarbonate microwell, a polystyrene or polycarbonate dipstick or a glass support.
  • a sample that includes the CXCR4 binding molecule or polypeptide of the disclosure is then brought into physical relation with the immobilised CXCR4 protein and then bound or 'captured'.
  • the bound CXCR4 binding molecule or polypeptide is then detected using a second labelled compound that binds to a tag sequence situated on the end of the CXCR4 binding molecule or polypeptide.
  • a polypeptide is detected within or on a cell, using methods known in the art, such as, for example, immunohistochemistry or immunofluorescence.
  • Methods using immunofluorescence are exemplary, as they are quantitative or at least semi- quantitative. Methods of quantitating the degree of fluorescence of a stained cell are known in the art.
  • Lipoparticles containing CXCR4 can be used to assess the binding of a CXCR4 binding molecule or polypeptide of the present disclosure with CXCR4.
  • the CXCR4 protein embedded in the lipoparticle can be used in assays where soluble proteins or whole cells cannot be used, such as assays where the protein of interest (e.g. CXCR4) must be bound to a support or substrate, for example an assay using a microfluidic device e,g. a biosensor assay.
  • a lipoprotein is attached to a surface and is then contacted with the CXCR4 binding molecule or polypeptide of the disclosure and the biosensor detects the binding of the CXCR4 polypeptide of the invention to the lipoparticle.
  • the detection can be by surface plasmon resonance, colorimetric diffraction grating, deflection of micro cantilevers (Weeks BL et al (2003) Scanning 25(6):297-9), or acoustic wave response (Coper MA et al (2001 ) Nature Biotechnology 19, 833-837).
  • the CXCR4 binding molecule or polypeptide is attached to a surface that is part of a sensor and this is then contacted with a lipoparticle and the binding is detected.
  • the detection can be by surface plasmon resonance, colorimetric diffraction grating, deflection of microcantilevers, or acoustic wave response.
  • the CXCR4 binding molecule or polypeptide and lipoparticle are contacted in solution.
  • Biosensor devices are designed to measure the interaction between biological molecules.
  • Biosensor devices generally employ an electrode surface in combination with current or impedance measuring elements to be integrated into a device in combination with the assay substrate (such as that described in US5567301 ).
  • biosensors measure direct interactions between a protein of interest and potential ligands that may bind to it.
  • Biosensors are typically highly sensitive and can work with and detect even very weak or very small quantity interactions.
  • Biosensor devices have been constructed that consist of optical chips, fiber optics, spectrometer detectors, microchannel chips, nanowells and microcantilevers, and acoustic wave devices.
  • biosensors known in the art also rely on surface plasmon resonance to detect protein interactions, whereby a change in the surface plasmon resonance surface of reflection is indicative of a protein binding to a ligand or antibody (US5485277 and US5492840).
  • the lipoparticle is attached to a sensor surface, where a "sensor surface” is any substrate where a change in a property of the substrate mediated by the contacting the surface with a molecule or polypeptide is detected and can be compared to the surface in the absence of such contacting.
  • the lipoparticle is already attached to a sensor surface.
  • the sensor surface can be a biosensor chip
  • the senor surface also includes any biosensor chip known in the art e.g. Biacore C1 chip, a F1 chip, a glass substrate comprising a coating of e.g. gold.
  • Biosensors are of particular use in high throughput analysis due to the ease of adapting such systems to micro- or nano-scales. Furthermore, such systems are conveniently adapted to incorporate several detection reagents, allowing for multiplexing of diagnostic reagents in a single biosensor unit. This permits the simultaneous detection of several proteins or peptides in a small amount of body fluids.
  • the present disclosure also encompasses any assay where the protein of interest is a membrane component (e.g. CXCR4) and where study of the binding of the protein with a binding molecule or polypeptide requires, or is facilitated by presenting the protein in the context of a lipid bilayer and/or attaching the protein to a support or solid substrate.
  • assays include assays using a microfluidic device, an optical biosensor, PATIR-FTIR spectroscopy, which is a type of biosensor using total internal reflection Fourier-transform intrared spectroscopy (19998, Chem. Phys.
  • the sensor surface comprises a 96
  • a CXCR4 binding molecule or polypeptide of the disclosure also contemplates imaging methods using a CXCR4 binding molecule or polypeptide of the disclosure.
  • a CXCR4 binding molecule or polypeptide is generally conjugated to a detectable label, which can be any molecule or agent that can emit a signal that is detectable by imaging.
  • a secondary labelled compound that specifically binds to a CXCR4 binding molecule or polypeptide of the disclosure may also be used.
  • Exemplary detectable labels include a protein, a radioisotope, a fluorophore, a visible light emitting fluorophore, infrared light emitting fluorophore, a metal, a ferromagnetic substance, an electromagnetic emitting substance a substance with a specific magnetic resonance (MR) spectroscopic signature, an X-ray absorbing or reflecting substance, or a sound altering substance.
  • MR magnetic resonance
  • the CXCR4 binding molecule or polypeptide of the disclosure can be administered either systemically or locally to an organ, or tissue (or tumor, in the case of a cancer) to be imaged, prior to the imaging procedure.
  • the CXCR4 binding molecule or polypeptide is administered in doses effective to achieve the desired optical image of a tumor, tissue, or organ.
  • doses may vary widely, depending upon the particular CXCR4 binding molecule or polypeptide employed, condition to be imaged, tissue, or organ subjected to the imaging procedure, the imaging equipment being used, and the like.
  • the CXCR4 binding molecule or polypeptide is used as in vivo optical imaging agents of tissues and organs in various biomedical applications including, but not limited to, imaging of tumors, tomographic imaging of organs, monitoring of organ functions, coronary angiography, fluorescence endoscopy, laser guided surgery, photoacoustic and sonofluorescence methods, and the like.
  • imaging methods include magnetic resonance imaging (MRI), MR spectroscopy, radiography, computerized tomography (CT), ultrasound, planar gamma camera imaging, single-photon emission computed tomography (SPECT), positron emission tomography (PET), other nuclear medicine-based imaging, optical imaging using visible light, optical imaging using luciferase, optical imaging using a fluorophore, other optical imaging, imaging using near infrared light, or imaging using infrared light.
  • MRI magnetic resonance imaging
  • CT computerized tomography
  • SPECT single-photon emission computed tomography
  • PET positron emission tomography
  • other nuclear medicine-based imaging optical imaging using visible light
  • optical imaging using luciferase optical imaging using a fluorophore
  • other optical imaging imaging using near infrared light, or imaging using infrared light.
  • an imaging agent is tested using an in vitro or in vivo assay prior to use in humans, e.g., using a model described herein.
  • sample should be understood as a reference to any sample of biological material derived from a subject such as, but not limited to, a body fluid (e.g., blood or synovial fluid or cerebrospinal fluid), cellular material (e.g. tissue aspirate), tissue biopsy specimens or surgical specimens.
  • a body fluid e.g., blood or synovial fluid or cerebrospinal fluid
  • cellular material e.g. tissue aspirate
  • the sample which is used according to a method of the present disclosure may be used directly or may require some form of treatment prior to use.
  • a biopsy or surgical sample may require homogenization or other form of cellular dispersion prior to use.
  • a reagent such as a buffer
  • such an assay may require the use of a suitable control, e.g. a normal or healthy individual or a typical population, e.g., for quantification.
  • a suitable control e.g. a normal or healthy individual or a typical population, e.g., for quantification.
  • a "healthy subject” is one that has not been diagnosed as suffering from a condition, e.g., a CXCR4-related disease or disorder and/or is not at risk of developing the disease or disorder.
  • a suitable control sample is a control data set comprising measurements of the marker being assayed for a typical population of subjects known not to suffer from a condition.
  • a reference sample is not included in an assay. Instead, a suitable reference sample is derived from an established data set previously generated from a typical population. Data derived from processing, analyzing and/or assaying a test sample is then compared to data obtained for the sample population.
  • CXCR4 binding molecules or polypeptides of the disclosure are useful for formulations into a pharmaceutical composition for parenteral, topical, oral, or local administration, aerosol administration, or transdermal administration, for prophylactic or for therapeutic treatment.
  • the pharmaceutical compositions can be administered in a variety of unit dosage forms depending upon the method of administration.
  • unit dosage forms suitable for oral administration include powder, tablets, pills, capsules and lozenges.
  • compositions of the present disclosure are useful for parenteral administration, such as intravenous administration or subcutaneous administration or administration into a body cavity or lumen of an organ or joint.
  • the compositions for administration will commonly comprise a solution of the CXCR4 binding molecule or polypeptide of the disclosure dissolved in a pharmaceutically acceptable carrier, such as an aqueous carrier.
  • a pharmaceutically acceptable carrier such as an aqueous carrier.
  • aqueous carriers can be used, e.g., buffered saline and the like.
  • the compositions may contain pharmaceutically acceptable carriers as required to approximate physiological conditions such as pH adjusting and buffering agents, toxicity adjusting agents and the like, for example, sodium acetate, sodium chloride, potassium chloride, calcium chloride, sodium lactate and the like.
  • the concentration of binding molecules or polypeptides of the present disclosure in these formulations can vary widely, and will be selected primarily based on fluid volumes, viscosities, body weight and the like in accordance with the particular mode of administration selected and the patient's needs.
  • exemplary carriers include water, saline, Ringer's solution, dextrose solution, and 5% human serum albumin.
  • Nonaqueous vehicles such as mixed oils and ethyl oleate may also be used.
  • Liposomes may also be used as carriers.
  • the vehicles may contain minor amounts of additives that enhance isotonicity and chemical stability, e.g., buffers and preservatives.
  • a CXCR4 binding molecule or polypeptide of the disclosure can be formulated for parenteral administration, e.g., formulated for injection via the intravenous, intramuscular, subcutaneous, transdermal, or other such routes, including peristaltic administration and direct instillation into a tumor or disease site (intracavity administration).
  • parenteral administration e.g., formulated for injection via the intravenous, intramuscular, subcutaneous, transdermal, or other such routes, including peristaltic administration and direct instillation into a tumor or disease site (intracavity administration).
  • peristaltic administration direct instillation into a tumor or disease site
  • Suitable pharmaceutical compositions in accordance with the disclosure will generally include an amount of the CXCR4 binding molecule or polypeptide of the present disclosure mixed with an acceptable pharmaceutical carrier, such as a sterile aqueous solution, to give a range of final concentrations, depending on the intended use.
  • an acceptable pharmaceutical carrier such as a sterile aqueous solution.
  • compounds of the present disclosure Upon formulation, compounds of the present disclosure will be administered in a manner compatible with the dosage formulation and in such an amount as is therapeutically/prophylactically effective. Suitable dosages of compounds of the present disclosure will vary depending on the specific compound, the condition to be treated and/or the subject being treated. It is within the ability of a skilled physician to determine a suitable dosage, e.g., by commencing with a sub-optimal dosage and incrementally modifying the dosage to determine an optimal or useful dosage.
  • compositions of the present disclosure can be combined with other therapeutic moieties or imaging/diagnostic moieties.
  • a pharmaceutical composition of the present disclosure may comprise an additional active agent selected from the group consisting of bisphosphonates, active vitamin D3, calcitonin and derivatives thereof, hormone preparations such as estradiol, SERMs (selective estrogen receptor modulators), ipriflavone, vitamin K2 (menatetrenone), calcium preparations, PTH (parathyroid hormone) preparations, nonsteroidal anti-inflammatory agents, soluble TNF receptor preparations, anti-TNF-[alpha] binding molecules, antibodies or functional fragments of the antibodies, anti-PTHrP (parathyroid hormone-related protein) binding molecules, antibodies or functional fragments of the antibodies, IL-1 receptor antagonists, anti-IL-6 receptor binding molecules, antibodies or functional fragments of the antibodies, anti- VEGF-A binding molecules or antibodies anti-CD20 binding molecules
  • a pharmaceutical composition of the present disclosure also may include a pharmaceutically acceptable anti-oxidant.
  • pharmaceutically acceptable antioxidants include (1 ) water soluble antioxidants, such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like, (2) oil-soluble antioxidants, such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), lecithin, propyl gallate, alpha-tocopherol, and the like, and (3) metal chelating agents, such as citric acid, ethylenediamine tetraacetic acid (EDTA), sorbitol, tartaric acid, phosphoric acid, and the like.
  • EDTA ethylenediamine tetraacetic acid
  • compositions of the present disclosure also can be administered in combination therapy, i.e., combined with other agents.
  • the combination therapy can include a CXCR4 binding molecule or polypeptide of the present disclosure combined with at least one other anti-cancer, anti-inflammatory or immunosuppressant agent.
  • anti-cancer or chemotherapeutic agents may include Mitoxantrone, etoposide, Azacitidine, Lenalidomide, Temozolomide, Decitabine, Ganetespib, Clofarabine Cytarabine, Daunorubicin, vinorelbine, azacitidine, sorafenib, rituximab, bevacizumab or bortezomib.
  • compositions may also contain adjuvants such as preservatives, wetting agents, emulsifying agents and dispersing agents. Prevention of presence of microorganisms may be ensured both by sterilization procedures, and by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like. It may also be desirable to include isotonic agents, such as sugars, sodium chloride, and the like into the compositions. In addition, prolonged absorption of the injectable pharmaceutical form may be brought about by the inclusion of agents which delay absorption such as aluminum monostearate and gelatine.
  • the amount of active ingredient which can be combined with a pharmaceutically acceptable carrier to produce a single dosage form will vary depending upon the subject being treated, and the particular mode of administration.
  • the amount of active ingredient which can be combined with a carrier material to produce a single dosage form will generally be that amount of the composition which produces a therapeutic effect. Generally, out of one hundred percent, this amount will range from about 0.01 per cent to about ninety-nine percent of active ingredient (i.e. CXCR4 binding polypeptide), in one example from about 0.1 percent to about 70 percent, in one example from about 1 percent to about 30 percent of active ingredient in combination with a pharmaceutically acceptable carrier. Dosage regimens are adjusted to provide the optimum desired response (e.g., a therapeutic response).
  • Dosage unit form refers to physically discrete units suited as unitary dosages for the subjects to be treated. Each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
  • the specification for the dosage unit forms of this disclosure are dictated by and directly dependent on (a) the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and (b) the limitations inherent in the art of compounding such an active compound for the treatment of sensitivity in individuals.
  • the dosage ranges from about 0.0001 to 100 mg/kg, and more usually 0.01 to 5 mg/kg, of the host body weight.
  • dosages can be 0.3 mg/kg body weight, 1 mg/kg body weight, 3 mg/kg body weight, 5 mg/kg body weight or 1 0 mg/kg body weight or within the range of 1 - 10 mg/kg.
  • An exemplary treatment regime entails administration once per day, once per week, once every two weeks, once every three weeks, once every four weeks, once a month, once every 3 months or once every three to 6 months.
  • Preferred dosage regimens for a CXCR4 binding molecules or polypeptides of this disclosure include 1 mg/kg body weight or 3 mg/kg body weight via intravenous administration, with the antibody being given using one of the following dosing schedules (i) every four weeks for six dosages, then every three months, (ii) every three weeks, (iii) 3 mg/kg body weight once followed by 1 mg/kg body weight every three weeks.
  • Actual dosage levels of the active ingredients in the pharmaceutical compositions of the present disclosure may be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the subject.
  • the selected dosage level will depend upon a variety of pharmacokinetic factors including the activity of the particular compositions of the present disclosure employed, or the ester, salt or amide thereof, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.
  • a "therapeutically effective dosage" of a CXCR4 binding molecule or polypeptide of this disclosure preferably results in a decrease in severity of disease symptoms, an increase in frequency and duration of disease symptom-free periods, or a prevention of impairment or disability due to the disease affliction.
  • a "therapeutically effective dosage” preferably inhibits cell growth or tumor growth by at least about 20%, at least about 40%, at least about 60%, or at least about 80% relative to untreated subjects.
  • the ability of a compound to inhibit tumor growth can be evaluated in an animal model system predictive of efficacy in human tumors.
  • this property of a composition can be evaluated by examining the ability of the compound to inhibit cell growth, such inhibition can be measured in vitro by assays known to the skilled practitioner.
  • a therapeutically effective amount of a therapeutic compound can decrease tumor size, or otherwise ameliorate symptoms in a subject.
  • One of ordinary skill in the art would be able to determine such amounts based on such factors as the subject's size, the severity of the subject's symptoms, and the particular composition or route of administration selected.
  • compositions can be administered with medical devices known in the art.
  • a therapeutic composition of the present disclosure can be administered with a needleless hypodermic injection device, such as the devices disclosed in U S Patent Nos 5,399, 1 63, 5,383,851 , 5,312,335, 5,064,413, 4,941 ,880, 4,790,824, or 4,596,556.
  • Examples of well-known implants and modules useful in the present disclosure include U S Patent No 4,487,603, which discloses an implantable micro-infusion pump for dispensing medication at a controlled rate, US Patent No 4,486,1 94, which discloses a therapeutic device for administering medicants through the skin, US Patent No 4,447,233, which discloses a medication infusion pump for delivering medication at a precise infusion rate, US Patent No 4,447,224, which discloses a variable flow implantable infusion apparatus for continuous drug delivery, US Patent No 4,439, 196, which discloses an osmotic drug delivery system having multi-chamber compartments, and US Patent No 4,475, 196, which discloses an osmotic drug delivery system. Many other such implants, delivery systems, and modules are known to those skilled in the art.
  • the compositions are formulated to be free of pyrogens such that they are capable for administration to human patients.
  • the present disclosure also contemplates the use of any of the CXCR4 binding polypeptide/i-body compositions of the present disclosure to make a medicament for treating a disorder of the present disclosure.
  • Medicaments can be packaged in a suitable pharmaceutical package with appropriate labels for the distribution to hospitals and clinics according to indication on the label.
  • the CXCR4 binding molecules or polypeptides of the present disclosure have numerous in vitro and in vivo diagnostic and therapeutic utilities involving the diagnosis and treatment of CXCR4 related diseases and disorders.
  • these molecules can be administered to cells in culture, in vitro or ex vivo, or to human subjects, e.g., in vivo, to treat, prevent and to diagnose a variety of disorders.
  • Preferred subjects include human subjects having disorders mediated by or modulated by CXCR4 activity or involving the CXCR4/SDF-1 pathway.
  • a CXCR4 binding polypeptide is administered together with another agent, the two can be administered in either order or simultaneously.
  • CXCR4 binding molecules or polypeptides of this disclosure for CXCR4 can be used to specifically detect CXCR4 expression on the surface of cells and, moreover, can be used to purify CXCR4 positive cells via immunoaffinity purification.
  • Target-specific effector cells e g , effector cells linked to compositions of this disclosure can also be used as therapeutic agents.
  • Effector cells for targeting can be human leukocytes such as macrophages, neutrophils or monocytes. Other cells include eosinophils, natural killer cells and other IgG- or IgA-receptor bearing cells. If desired, effector cells can be obtained from the subject to be treated.
  • the target-specific effector cells can be administered as a suspension of cells in a physiologically acceptable solution. The number of cells administered will vary depending on the therapeutic purpose. In general, the amount will be sufficient to obtain localization at the target cell, e.g, a tumor cell expressing CXCR4, and to effect cell killing by, e g. phagocytosis.
  • Target-specific effector cells can be performed in conjunction with other techniques for removal of targeted cells.
  • anti-tumor therapy using the compositions of the present disclosure and/or effector cells armed with these compositions can be used in conjunction with chemotherapy.
  • combination immunotherapy may be used to direct two distinct cytotoxic effector populations toward tumor cell rejection.
  • CXCR4 binding polypeptides linked to anti-Fc-gamma receptor or anti-CD3 may be used in conjunction with IgG- or IgA-receptor specific binding agents.
  • Bispecific and multispecific molecules of the present disclosure can also be used to modulate FcyR or FcyR levels on effector cells, such as by capping and elimination of receptors on the cell surface.
  • CXCR4 As a co-receptor for HIV entry into T cells, CXCR4 is known to be involved in HIV infection. Additionally, the CXCR4/SDF-1 pathway has been shown to be involved in inflammatory conditions. Still further, the CXCR4/SDF-1 pathway has been shown to be involved in angiogenesis or neovascularisation. Accordingly, the CXCR4 binding polypeptides of the present disclosure can be used to modulate CXCR4 activity in a number of clinical situations, as detailed below.
  • sample refers to a sample from a human, animal, or to a research sample, e.g., a cell, tissue, organ, fluid, gas, aerosol, slurry, colloid, or coagulated material. Samples also include, but are not limited to, protein or membrane extracts of cells, biological fluids such as sputum, blood, serum, plasma, or urine, or biological samples such as formalin-fixed or frozen tissue sections employing antibodies described herein.
  • sample can also refer to a cell, tissue, organ, or fluid that is freshly taken from a human or animal, or to a cell, tissue, organ, or fluid that is processed or stored.
  • the sample can be tested in vivo, e.g., without removal from the human or animal, or it can be tested in vitro.
  • the sample can be tested after processing, e.g., by histological methods.
  • diagnostic assay techniques known in the art can be used, such as competitive binding assays, direct or indirect sandwich assays and immunoprecipitation assays conducted in either heterogeneous or homogeneous phases (Zola, Monoclonal Antibodies: A Manual of Techniques, CRC Press, Inc. (1987) pp. 147- 158).
  • the antibodies used in the diagnostic assays can be labeled with a detectable moiety.
  • the detectable moiety directly or indirectly produces a detectable signal.
  • the detectable moiety can be any of those described herein such as, for example, a radioisotope, such as 3H, 14C, 32P, 35S, or 1251, a fluorescent or chemiluminescent compound, such as fluorescein isothiocyanate (FITC), Texas red, cyanin, photocyan, rhodamine, or luciferin, or an enzyme, such as alkaline phosphatase, /3-galactosidase or horseradish peroxidase.
  • a radioisotope such as 3H, 14C, 32P, 35S, or 1251
  • a fluorescent or chemiluminescent compound such as fluorescein isothiocyanate (FITC), Texas red, cyanin, photocyan, rhodamine, or luciferin
  • FITC fluorescein isothiocyanate
  • FITC fluorescein isothiocyanate
  • cyanin cyanin
  • photocyan photocyan
  • any method known in the art for conjugating the antibody to the detectable moiety can be employed, including those methods described by Hunter et al., Nature, 144:945 (1962); David et al., Biochemistry, 13:1014 (1974); Pain et al., J. Immunol. Meth., 40:219 (1981 ); and Nygren, J. Histochem. and Cytochem., 30:407 (1982).
  • a method of diagnosing a condition associated with CXCR4 comprising assessing a level of CXCR4 and/or SDF-1 in a sample of a subject, wherein a change in level of CXCR4 and/or SDF-1 in the sample in comparison with a reference sample indicates the presence or increase of a tumor or metastasis or fibrosis.
  • the condition associated with CXCR4 or SDF-1 is a tumor, a metastasis, angiogenesis, or fibrosis.
  • An increase in CXCR4 and/or SDF-1 levels in the sample in comparison with a reference sample can indicate the presence of a tumor or metastasis or an increase in tumor or metastatic growth or fibrosis.
  • the reference sample can be a sample taken from the subject at an earlier time point or a sample from another individual.
  • the level of CXCR4 and/or SDF-1 levels in the sample can be detected by contacting the sample with the CXCR4 binding molecule, polypeptide or i-body thereof described herein.
  • the CXCR4 binding molecule, polypeptide or i-body thereof is detectably labeled.
  • a method for diagnosing cancer metastasis in a subject having a tumor comprising: assessing CXCR4 levels or activity in the tumor, whereby a change in CXCR4 levels or activity in the tumor in comparison with a reference sample indicates the presence of metastatic tumor growth.
  • the CXCR4 levels or activities in the tumor can be higher than those when measured earlier, which can indicate that the subject is at a greater risk of cancer metastasis; that the cancer has metastasized; or that cancer metastasis has increased.
  • the reference sample can derive from the same subject, taken from the same tumor at a different time point or from other site of the body, or from another individual.
  • a method for diagnosing the leval or rate of progression of fibrosis in a subject having fibrosis comprising: assessing CXCR4 levels or activity in the tissue, blood, plasma or biological fluids, whereby a change in CXCR4 levels in comparison with a reference sample indicates the presence of fibrosis.
  • the CXCR4 levels or activities can be higher than those when measured earlier, which can indicate that the subject is at a faster progressor of disease.
  • the reference sample can derive from the same subject, taken from the same tissue, blood, plasma or biological fluids at a different time point or from other site of the body, or from another individual.
  • Methods are provided herein for treating or preventing a CXCR4 related disease or disorder.
  • the methods comprise administering a therapeutically effective amount of a CXCR4 binding molecule or polypeptide and another therapeutic agent.
  • CXCR4 has been shown to be expressed by a variety of cancer types and in certain situations an inverse correlation has been established between CXCR4 expression and subject prognosis or survival.
  • cancer types associated with CXCR4 expression include breast, prostate, non-small cell lung, pancreatic, thyroid, nasopharyngeal carcinoma, melanoma, renal cell carcinoma, lymphoma (e.g. non-Hodgkin's lymphoma), neuroblastoma, glioblastoma, rhabdomyosarcoma, colorectal, kidney, osteosarcoma, acute lymphoblastic leukemia, and acute myeloid leukemia.
  • lymphoma e.g. non-Hodgkin's lymphoma
  • neuroblastoma e.g. non-Hodgkin's lymphoma
  • glioblastoma rhabdomyosarcoma
  • colorectal ectal
  • kidney ectal
  • a CXCR4 binding molecule or polypeptide of the present disclosure can be used to treat a CXCR4 related disease or disorder, wherein the disease is cancer, and wherein the cancer includes, but is not limited to a cancer selected from the group consisting of bladder cancer, breast cancer, colorectal cancer, endometrial cancer, head & neck cancer, leukemia, lung cancer, lymphoma, melanoma, non- small-cell lung cancer, ovarian cancer, prostate cancer, testicular cancer, uterine cancer, cervical cancer, thyroid cancer, gastric cancer, brain stem glioma, cerebellar astrocytoma, cerebral astrocytoma, ependymoma, Ewing's sarcoma family of tumors, germ cell tumor, extracranial cancer, Hodgkin's disease, leukemia, acute lymphoblastic leukemia, acute myeloid leukemia, liver cancer, medulloblastoma, neuroblastom
  • a CXCR4 binding molecule or polypeptide of the present disclosure can be used to inhibit metastatic tumour cell growth.
  • a CXCR4 binding molecule or polypeptide of the present disclosure can be used to treat fibrosis.
  • the CXCR4 binding molecule or polypeptide of the present disclosure can be used alone or in combination other cancer treatments, such as surgery and/or radiation, and/or with other anti-neoplastic agents, such as the anti-neoplastic agents discussed and set forth above, including chemotherapeutic drugs and other anti-tumor antigen antibodies, such as those that bind CD20, Her2, PD-1 , PDL-1 , IL-2, PSMA, Campath-1 , EGFR and the like.
  • the CXCR4 binding molecule or polypeptide of the present disclosure can be used alone or in combination with other inflammatory and fibrosis treatments.
  • CXCR4 has been shown to be a coreceptor for HIV entry into T cells and, additionally, certain murine anti-CXCR4 antibodies have been demonstrated to be able to inhibit entry of HIV isolates into T cells (see Hou, T et al. (1998) J Immunol 160 180-1 88, Carnec, X et al. (2005) J Virol 79 1930- 1938).
  • CXCR4 can be used as a receptor by viruses for entry into the cell and antibodies or other blocking agents can be used to inhibit cell entry of such viruses that use CXCR4 as a receptor.
  • the CXCR4 binding molecules or polypeptides of present disclosure can be used to inhibit entry of a virus into a cell, wherein the virus uses CXCR4 as a receptor for cell entry, such that viral infection is inhibited.
  • the CXCR4 binding molecules or polypeptides are used to inhibit entry of HIV into T cells, e.g, in the treatment or prevention of HIV/AIDS.
  • the CXCR4 binding molecule or polypeptide can be used alone or in combination with other anti-viral agents, such as anti- retroviral drugs such as AZT or protease inhibitors.
  • CXCR4 has been found to form a heterodimer with CXCR7 and regulated CXCL12- mediated G protein signalling (Levoye A et al (2009) Blood 1 13(24):6085-6093).
  • the CXCR4/CXCR7 heterodimer has also been shown to recruite beta-arrestin to enhance cell migration (Decaillot FM et al (201 1 ) J Biol Chem 286(37):32188-97).
  • CXCR4 binding molecules or polypeptides of the present disclosure can be administered alone or together with agents that target the CXCR7 receptor as described in for example, WO 2007/1 15231 , WO 2007/1 15232, WO 2008/048519, WO 2008/109154, WO 2010/054006.
  • CXCR4 has also been found to form a heterodimer with CCR5 (Sohy et al J Biol Chem. 2009 284; 31270-31279), p 2 AR (La Rocca et al J Cardiovasc Pharmacol. 2010 56; 548-559) CCR2 (Sohy et al J Biol Chem.
  • CXCR4 binding molecules or polypeptides of the present disclosure can be administered alone or together with agents that target these receptors.
  • the CXCR4/SDF-1 pathway has been shown to play a role in a variety of inflammatory conditions, including but not limited to inflammatory liver disease (Terada, R et al. (2003) Lab. Invest 83:665-672), autoimmune joint inflammation (Matthys, P et al. (2001 ) J. Immunol 167 4686-4692), allergic airway disease (Gonzalo, J A et al (2000) J. Immunol 165-499-508), and periodontal disease (Hosokawa, Y et al (2005) Clin. Exp. Immunol 4:467-474).
  • CXCR4 binding molecules or polypeptides of the present disclosure that inhibit binding of SDF-I to CXCR4 can be used to inhibit inflammation, inflammatory disorders, including disorders selected from the group consisting of inflammatory liver disease, autoimmune joint inflammation, allergic airway disease, periodontal disease (induced by Porphyromonas gingivalis) ( Hajishengallis et al PNAS 2008 105; 13532-13537), rheumatoid arthritis, inflammatory bowel disease, systemic lupus erythematosus, Type I diabetes, inflammatory skin disorders (e.g., psoriasis, lichen planus), skin repair and regeneration (burns, scarring), eye (AMD, uveitis) systemic sclerosis, radiation induced fibrosis, autoimmune thyroid disease, Sjogren's syndrome, pulmonary inflammation (e.g., chronic obstructive pulmonary disease, pulmonary sarcoidosis, lymphocytic alveolitis, idiopathic
  • the CXCR4 binding polypeptide can be used alone or in combination with other anti-inflammatory agents, such as non-steroidal antiinflammatory drugs (NSAIDs), corticosteroids (e.g., prednisone, hydrocortisone), methotrexate, COX-2 inhibitors, TNF antagonists (e.g., etanercept, infliximab, adalimumab) and immunosuppressants (such as 6- mercaptopurine, azathioprine and cyclosporine A).
  • NSAIDs non-steroidal antiinflammatory drugs
  • corticosteroids e.g., prednisone, hydrocortisone
  • methotrexate e.g., COX-2 inhibitors
  • COX-2 inhibitors e.g., TNF antagonists (e.g., etanercept, infliximab, adalimumab)
  • immunosuppressants such as 6- mercaptopurine,
  • CXCR4 binding molecules or polypeptides of the present disclosure that inhibit binding of SDF-I to CXCR4 can be used to inhibit fibrosis, in fibrotic disorders, including disorders selected from the group consisting of lung fibrosis (Idiopathic pulmonary fibrosis, fungal cystic fibrosis (Carevic et al Eur Respir J 2015 46; 395-404), pulmonary arterial hypertension (Farkas et al PLoSONE 2014 9; e8981 0), radiation induced fibrosis (Shu et al PLoSONE 2013; 8; e79768.) and systemic sclerosis, asthma (Lukacs etal AJP 2012 160; 1353- 1360 & Nagase etal J Immunol 2000; 164: 5935-5943)), liver fibrosis (nonalcoholic steatohepatitis (NASH) (Boujedidi et al Clinical Science 2015 128; 257-26
  • eye fibrosis proliferative vitroretinopathy, diabetic retinopathy (Butler et al The Journal of Clin Invest 2005 1 15; 86-93), retinopathy of prematurity (Villalvilla et al Life Sciences 2012 91 ;264-270), noninfectious uveitis (Zhang et al Experimental Eye Research 2009 89;522-531 ), and wet-AMD (US_7964191 )
  • cardiac fibrosis hypertension, ischemic cardiomyopathy, endomyocardial fibrosis, arterial fibrosis (Chu et al Circ Heart Fail.
  • the CXCR4 binding molecules or polypeptides of the current invention can be used alone or in combination with other anti-fibrotic agents, for example Pirfenidone or Nintedanib.
  • SDF-1 induces neovascularization through recruitment of CXCR4-expressing hemangiocytes (Jin, D. K. et al. (2006) Nat Med. 12:557-567).
  • CXCR4 has also been found to be essential for vascularisation of the gastrointestinal tract (Tachibana et al. (1998) Nature 393(6685):591 -4).
  • blockade of the SDF-1 /CXCR4 pathway can attenuate in vivo tumor growth by inhibiting angiogenesis in a VEGF-independent manner (Guleng, B. et al. (2005) Cancer Res. 65:5864-58-71 ).
  • the CXCR4 binding molecules or polypeptides of the present disclosure that inhibit binding of SDF-I to CXCR4 can be used to inhibit angiogenesis by interfering with the SDF- 1 /CXCR4 pathway.
  • Inhibition of angiogenesis can be used, for example, to inhibit tumor growth or tumor metastasis (regardless of whether the tumor is CXCR4 + ).
  • the CXCR4 binding molecule or polypeptide can be used alone or in combination with other anti-angiogenic agents, such as anti-VEGF (Grunewald M et al (2006) Cell 124(1 ):175-89) or PDGF-D antibodies or fragments of antibodies.
  • CXCR4 inhibitors/antagonists that do not mobilise stem cells such as the i-bodies described herein, will be useful in long- term studies and treatment of chronic diseases.
  • the response to injury involves the activation of adaptive mechanisms designed not only to maintain homeostasis but also to induce tissue repair.
  • This potential for regenerative repair is evident in humans in certain circumstances such as following hepatic resection or acute tubular necrosis.
  • the response mostly involves a combination of disordered parenchymal cell regeneration in conjunction with the production of large quantities of ECM, eventually leading to the formation of a connective tissue scar. While this repair by connective tissue clearly assists in the maintenance of organ integrity following, for instance, a skin wound, its presence in the other organs such as the heart, kidney and lungs is often detrimental (Wynn etal Nat Med (2012) 18: 1028-1040).
  • Idiopathic pulmonary fibrosis is an interstitial inflammatory disease characterized by scarring and fibrosis of the lungs ultimately resulting in terminal respiratory insufficiency.
  • Idiopathic pulmonary fibrosis is an interstitial inflammatory disease characterized by scarring and fibrosis of the lungs ultimately resulting in terminal respiratory insufficiency.
  • circulating fibrocytes that express CXCR4 contribute to the pathogenesis of pulmonary fibrosis (Phillips etal J Clin Invest (2004) 1 14: 438-446.). This and other recent studies suggest that blocking the activity of the CXCR4 on these fibrocytes might be useful approach for therapy in patients with various types of fibrosis, including fibrosis associated with pulmonary disease, diabetes and cardiovascular disease.
  • Occular fibrosis Occular fibrosis
  • the pathological growth of new blood vessels in the posterior eye is a devastating consequence of a number of diseases including Age related Macular Degeneration, proliferative diabetic retinopathy and Retinopathy of Prematurity. Advanced, vision threatening, Age Related Macular Degeneration (referred to as Wet AMD) affects 5.7% of all people over 85 years. Diabetic retinopathy is the most feared complication of diabetes affecting approximately 40% of those with Type II diabetes and 86% of those with type I diabetes (Cheung et al Lancet 2010; 376: 124-36). Another retinal vascular disease, called Retinopathy of Prematurity, is a devastating consequence of premature birth, and remains the leading cause of childhood blindness in the Western world. A common feature of these conditions is the abnormal growth of blood vessels and subsequent scar formation that is the crucial event leading to blindness. In order to prevent blindness from these diseases, treatments that target both abnormal growth of retinal blood vessels as well as subsequent scarring are necessary.
  • Wet AMD is currently treated with a monthly or bimonthly injection into the eye of a humanized antibody or antibody fragment that blocks the action of the angiogenic growth factor, Vascular Endothelial Growth Factor (VEGF).
  • VEGF Vascular Endothelial Growth Factor
  • These new treatments have transformed the clinical care of those with Wet AMD and prevents the sudden loss of vision in a majority of patients (Rosenfeld etal N Engl J Med 2006; 355: 1419-31 ; Brown etal N Engl J Med 2006; 355: 1432-44).
  • the CXCR4 binding molecule or polypeptides of the current invention can be used for the treatment of scaring and fibrotic related disorders of the eye including vitreoretinopathy, diabetic retinopathy and retinopathy of prematurity.
  • Atherosclerosis treatment can be used for the treatment of scaring and fibrotic related disorders of the eye including vitreoretinopathy, diabetic retinopathy and retinopathy of prematurity
  • SDF-1 and its receptor, CXCR4 have been implicated in angiogenesis and scar formation (fibrosis)(Ferrara etal Nature 2005; 438: 967-74). Indeed, SDF-1 is increased in the vitreous of those with wet AMD, proliferative diabetic retinopathy and retinopathy of prematurity (Scotti etal Retina 2014; 34: 1802-10, Butler etal J Clin Invest 2005; 1 15: 86-93, Sonmez etal Ophthalmology 2008; 1 15: 1065-1070). Its receptor, CXCR4, is localized to the growing tips of pathologically growing blood vessels.
  • CXCR4 has been shown to prevent the abnormal growth of vessels in a rodent model of choroidal neovascularization and retinopathy of prematurity (Lima e Silva etal FASEB J 2007; 21 : 3219-30). Another study has shown that circulating fibrocytes may function as precursors of myofibroblasts in Proliferative vitreoretinopathy (PVR) membranes.
  • PVR Proliferative vitreoretinopathy
  • a treatment is needed that targets both angiogenesis and subsequent fibrosis.
  • novel polypeptides or i- bodies of the present disclosure are useful for such treatment.
  • the CXCR4 binding molecules, polypeptides or i-bodies of the present disclosure could be effective in reducing angiogenesis and subsequent scarring in models of vascular disease of the posterior eye in AMD, proliferative diabetic retinopathy, retinopathy of prematurity, proliferative vitreoretinopathy, uvetis, corneal angiogenesis.
  • CXCR4 binding molecules or polypeptides of the present disclosure can be examined in inflammatory mouse models.
  • These models include the murine experimental colitis model, the carrageenan-induced paw edema model and the bleomycin-induce lung fibrosis model as described in Liang Zhongxing et al (2012) PLoS ONE 7(4): e34038.doi:1 0.1371 .
  • CXCR4 binding molecules or polypeptides of the present disclosure to inhibit fibrosis can be examined in the bleomycin rodent model.
  • the rodent bleomycin model which is used frequently to mimic idiopathic pulmonary fibrosis (IPF)
  • IPF idiopathic pulmonary fibrosis
  • SDF-1 levels are increased in serum and bronchial alveolar lavage fluid.
  • neutralizing antibodies to CXCR4 and the small molecule CXCR4 antagonist, AMD3100 were found to reduce lung eosinophilia, indicating that CXCR4-mediated signals contribute to lung inflammation in a mouse model of allergic airway disease (Gonzalo etal J Immunol. 2000; 165:499-508, Lukacs etal Am J Pathol.
  • CXCR4 has a prominent role in promoting fibrosis than re-epithelialisation.
  • the CXCR4 binding molecule or polypeptides of the current invention can be used as an anti-fibrotic agent.
  • TN14003 a 14-mer peptide, blocks development of pulmonary fibrosis in bleomycin-treated mice, while MSX-122, a small molecule has also demonstrated superiority over TN14003 and AMD3100 in completely preventing bleomycin- induced lung fibrosis (Xu et al Cell Mol Biol. 2007; 37: 291 -299) and irradiated mice that received MSX-122 had significant reductions in development of pulmonary fibrosis while AMD3100 did not significantly suppress this fibrotic process (Shu etal PLoS ONE 2013; 8(1 1 ): e79768.).
  • the CXCR4 binding molecule or polypeptides of the current invention have the ability to block stem cell homing while not increasing stem cell mobilization.
  • An alternative technique to elucidate the role of novel targets in the pathogenesis of IPF involves isolation of fibroblasts from patients with the disease and comparing mediator release to fibroblasts from healthy subjects. In this process, cells are exposed to pharmacologic agonists and antagonists. The fibroblasts can be embedded and cultured in three-dimensional matrices and cocultured with other cell types. The ability of the CXCR4 binding molecules or polypeptides of the present disclosure to inhibit fibrosis can be examined with the human patient fibroblasts.
  • CXCR4 binding molecules or polypeptides of the present disclosure can be examined in mouse models.
  • These models include the breast cancer model (via administration of MDA-MB-231 cells), the head and neck cancer animal model (via administration of 686LN-Ms cells) and the uveal melanoma micrometastasis model as described in Liang Zhongxing et al (2012) PLoS ONE 7(4): e34038.doi:1 0.1371 .
  • the CXCR4 binding molecule or polypeptides may be provided in a kit or pharmaceutical package.
  • kits for carrying out the administration of a CXCR4 binding molecule described herein relate to kits for carrying out the administration of a CXCR4 binding molecule described herein.
  • kits can additionally include an excipient, a carrier, a buffering agent, a preservative or a stabilizing agent in a pharmaceutical formulation.
  • Each component of the kit can be enclosed within an individual container and all of the various containers can be within a single package.
  • Invention kits can be designed for room temperature or cold storage.
  • the preparations can contain stabilisers to increase shelf life of the kits and include, for example bovine serum albumin (BSA) or other known conventional stabilizers.
  • BSA bovine serum albumin
  • the kit can contain further preparations of solutions to reconstitute the preparations.
  • Acceptable solutions are well known in the art and include, for example, pharmaceutically acceptable phosphate buffered saline (PBS).
  • the pharmaceutical packages or kits provided herein can further include any of the other moieties provided herein such as, for example, a chemotherapeutic agent as described elsewhere in more detail.
  • kits of the present invention can further include the components for an assay provided herein, such as, for example, an ELISA assay.
  • preparations of the kits are used in immunoassays, such as immunohistochemistry to test patient tissue biopsy sections.
  • Pharmaceutical packages and kits of the present invention can further include a label specifying, for example, a product description, mode of administration and indication of treatment.
  • Pharmaceutical packages provided herein can include any of the compositions as described herein.
  • the pharmaceutical package can further include a label for preventing, reducing the risk of, or treating any of the disease indications described herein.
  • Kits of the present disclosure can additionally include labels or instructions for using the kit components in any method of the invention.
  • a kit can include an i-body compound of the present disclosure in a pack, or dispenser together with instructions for administering the compound in a method of the disclosure.
  • Instructions can include instructions for practicing any of the methods of the disclosure described herein including treatment, detection, monitoring or diagnostic methods. Instructions may additionally include indications of a satisfactory clinical endpoint or any adverse symptoms that may occur, or additional information required by regulatory agencies such as the Food and Drug Administration for use on a human subject.
  • Biotinylated CXCR4 lipoparticles (Integral Molecular, Cat#LEV-101 B; 3.6 U/mL as described in WO 2005/042695) were typically diluted 1 in 20 in the running buffer and immobilized onto a Streptavidin containing channel by injecting at 2 ⁇ _/ ⁇ _ for 1 ,800 sec resulting in captured response levels of greater than 2,500 RU.
  • BRET was used in this study to assess the real-time kinetic profiles resulting from any consequent increase in proximity, building upon the previously validated monitoring of GPCR/p-arrestin interactions utilizing BRET.
  • BRET occurs between a complementary Renilla luciferase (Rluc) variant as donor and green fluorescent protein variant as acceptor.
  • Rluc Renilla luciferase
  • eBRET EnduRen for extended BRET
  • BRET ⁇ -arrestin assays were carried out as described previously (See, H. B., Seeber, R. M., Kocan, M., Eidne, K. A. and Vietnameser, K. D. (201 1 ) 'Application of G protein-coupled receptor-heteromer identification technology to monitor beta- arrestin recruitment to G protein-coupled receptor heteromers', Assay Drug Dev Technol, 9(1 ), 21 -30, 10.1089/adt.2010.0336).
  • CXCR4/Rluc8 cDNA constructs were generated from plasmids containing the respective receptor cDNA tagged with Rluc kindly provided by Aron Chakera (Oxford University, United Kingdom).
  • the ⁇ -arrestin 2/Venus cDNA construct was prepared previously from pCS2-Venus kindly provided by Atsushi Miyawaki (RIKEN Brain Science Institute, Wako-city, Japan). BRET technology in cells transiently expressing CXCR4/Rluc8 and P-arrestin2/ Venus in the presence of 100 nM SDF-1 agonist was evaluated in the presence of the CXCR4 agonist SDF-1 /CXCL12 and the i-bodies.
  • HEK293FT cells were maintained at 37oC, 5% C0 2 in Complete Media (Dulbecco's modified Eagle's medium containing 0.3 mg/mL glutamine, 100 lU/mL penicillin, and 100 mg/mL streptomycin; Gibco) supplemented with 10% fetal calf serum (FCS) and 400 mg/mL Geneticin (Gibco). Transfections were carried out 24 h after seeding using Genejuice (Novagen) according to manufacturer's instructions. Cells were harvested with 0.05% Trypsin-EDTA (Gibco). HEK293FT cells were transfected using FuGene6 (Promega).
  • the BRET signal was calculated by subtracting the ratio of 520- 540 nm emission over 400-475 nm emission for a vehicle-treated cell sample from the same ratio for a second aliquot of the same cells treated with agonist (in this instance in the presence of SDF-1 or CXCL12) and i-body (ADCX-99, ADCX-272, ACDX-6, ACDX-306, ADCX-668) at various concentrations. Data are mean ⁇ S.E.M. of four independent experiments carried out in duplicate.
  • Im7-FH corresponds to an N-terminal solubility and purification tag wherein Im7 is an E.coli protein (Hosse RJ et al (2009) Anal Biochem 15;385(2):346-57 and FH is flag + 6 Histidine residues.
  • Shark IgNAR antibodies are structurally close to the immunoglobulin superfamily of l-set domains such as Domain 1 of NCAM.
  • the modified Domain 1 of NCAM is referred to as the i-body scaffold.
  • a library of polypeptides is created and displayed on phage for screening against particular targets for specific binders to that target.
  • Such libraries are anticipated to primarily contain variability in the CDR1 and CDR3 analogous regions.
  • i-body library was created which had a random amino acid sequence in the CDR1 region (represented by XXXXX in Figure 1 B) and in the CDR3 region (represented by Y'n in Figure 1 B), wherein n (the number of amino acids in the random CDR3 sequence) is varied randomly between 10 and 20 amino acids in length and sequence as per SEQ ID NO:2.
  • the i- bodies of the disclosure comprise a scaffold region which corresponds to amino acid resdiues 1 to 26, 33 to 79 and 88 to 97 of SEQ ID NO:1 or a sequence at least 60% identical thereto or otherwise may comprise between one and five amino acid additions or substitutions.
  • the scaffold region comprises the sequence set forth in SEQ ID NO:2 or the sequence set forth in SEQ ID NO:2 comprising between 1 and 5 amino acid additions or substitutions.
  • the complementarity determining regions (CDR1 and CDR3) of SEQ ID NO:2 are modified by amino acid addition and/or substitution relative to the corresponding CDR1 and/or CDR3 regions in SEQ ID NO:1 represented by amino acid positions 27 to 32 and 80 to 86 in SEQ ID NO:1 respectively.
  • the resulting i-body polypeptides are able to bind to human CXCR4 with an affinity of less than 50 ⁇ .
  • A' and B' in SEQ ID NO:2 are any amino acid residue.
  • A' in SEQ ID NO:2 is amino acid Q or K and B' in SEQ ID NO:2 is amino acid residue V or A.
  • A' is Q and B' is V or A in SEQ ID NO:2.
  • Sequence ID NO:2 may further comprise between 1 and 4 consecutive N-terminal amino acid residues selected from the group consisting of M, EAEA, MA, or MP.
  • I-bodies displayed on phage were selected against human CXCR4 (hCXCR4) displayed in a lipoparticle or expressed in a HEK cell line, following incubation of the i-body library and hCXCR4 lipoparticle captured on plates or beads or with CXCR4 positive cells in solution. Extensive washing was completed to remove non-specific binders in either format. Enrichment to the hCXCR4 positive lipoparticles or cells was observed and single colonies were picked and grown. The sequence of the i-body scaffold remains the same except for the specific regions of the CDR1 and CDR3 regions. The CDR1 and CDR3 sequences of the single colonies that specifically bound to hCXCR4 are detailed in Table 1 . The affinities of the i- bodies to CXCR4 are described in Table 1 and Figure 5 for ADCX-99 and Figure 2 for i-bodies ADCX-306, ADCX-272 and ADCX-668.
  • ND not determined.
  • a control i-body was generated, designated 21 H5 which does not bind to CXCR4. This was used as an isotype control.
  • the sequence of this i-body is shown below: LQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTPNQQRISVVWNDDSSSTLTI YNANIDDAGIYKCVVTGSDAMSNYSYPISESEATVNVKIFQ (SEQ ID NO:82)
  • I-bodies were expressed and purified using an E.coli expression system. I-bodies were expressed with various affinity tags including E coli. immunity protein (Im7) FLAG and 6xHIS (designated Im7-FH in Figure 4). I-bodies were purified from the periplasmic fraction and the cytoplasm using the various tags using anti-FLAG resin or Ni-NTA resin respectively. The results of size exclusion chromatography are shown in Figure 4.
  • the i-body ADCX-99 was shown in a BIAcore assay to bind to immobilised CXCR4 positive lipoparticles (A), but showed very little binding to null lipoparticles (B) or to lipoparticles that were positive for the GPCR CCR5 (C), demonstrating the specificity of the i-body ADCX-99 to CXCR4 (Figure 5).
  • ADCX-99 The affinity of one CXCR4 i-body identified, ADCX-99 was approximately K D of 600nM
  • the i-body ADCX-272 was shown in a BIAcore assay to bind to immobilised CXCR4 positive lipoparticles (Figure 2), but showed very little binding to null lipoparticles or to lipoparticles that were positive for the GPCR CCR5 via ELISA ( Figure 7B), demonstrating the specificity of the i-body ADCX-272 to CXCR4.
  • the i-body ADCX-99 was affinity matured using error prone PCR. This was carried out in two ways; either by creating a library of random mutations directed to the CDR1 and CDR3 or using an average of 2-3 nucleotide mutations anywhere in the sequence.
  • the library was panned according to Henderson et al. (2007) Structure 15:1452-66. Using this strategy, the i- body ADCX-99 was modified in the CDR1 and/or the CDR3 regions to improve the affinity or expression to create a library of mutants. 3.1 Improvement to expression levels, affinity and specificity of i-bodies
  • mutant clones of ADCX-99 were subject to a further round of affinity maturation and over 1000 mutant clones examined for improved affinity and expression.
  • the CD1 and CDR3 regions are represented by SX 1 SX 2 X 3 R and ⁇ RY' 2 GY' 3 YRHRY'4LY' 5 LG respectively.
  • the affinity matured i-bodies of the disclosure comprise a scaffold region which corresponds to amino acid resdiues 1 to 26, 33 to 79 and 88 to 97 of SEQ ID NO:1 or a sequence at least 60% identical thereto or otherwise may comprise between one and five amino acid additions or substitutions.
  • the polypeptide comprises the sequence set forth in SEQ ID NO:2 or the sequence set forth in SEQ ID NO:2 comprising between 1 and 5 amino acid additions or substitutions.
  • A' and B' in SEQ ID NO:39 are any amino acid residue.
  • A' in SEQ ID NO:39 is amino acid Q or K and B' in SEQ ID NO:39 is amino acid residue V or A.
  • A' is Q and B' is V or A in SEQ ID NO:39.
  • Z is absent or an amino acid selected from M, EAEA, MA or MP.
  • VLGEATVNVKIFQ (SEQ ID NO:1 1 )
  • Figure 1 A summary of the amino acid positions modified relative to the consensus sequence of ADCX-99 (SEQ ID NO: 2 and 39) is shown in Figure 1 .
  • Figure 8 indicates the particular amino acid residue substitutions corresponding to each affinity matured i-body. Underlining corresponds to the CDR1 and CDR3 regions in each sequence.
  • Table 3 summarises improvements in relation to the off-rates of the top twenty affinity matured i-bodies for CXCR4 expressed on lipoparticles.
  • Table 4 summarises the affinity (Ka, Kd and K D ) of the top twenty affinity matured i-bodies for CXCR4 expressed on lipoparticles.
  • a dual specificity i-body was generated by conjugating an 18-residue human serum albumin (HAS) binding peptide (N-terminus)-RLIEDICLPRWGCLWEDD-(C-terminus) (described in US 20100104588; Dennis MS et al (2002) J. Biol. Chem. 277, 35035-35043) to the C-terminus of AM3-1 14 to generate AM3-1 14-lm7-SA21 (SEQ ID NO: 80).
  • HAS human serum albumin
  • RLS human serum albumin
  • RLS human serum albumin binding peptide
  • RIEDICLPRWGCLWEDD-(C-terminus) described in US 20100104588; Dennis MS et al (2002) J. Biol. Chem. 277, 35035-35043
  • the Im7 protein was used to facilitate detection of the conjugate.
  • Affinity for CXCR4 and HSA was measured by surface plasmon resonanceas shown in Figure 1 1 .
  • the bi-specific CXCR4 and HSA binder AM3-1 14-lm7-SA21 demonstrated approximately 5-10 nM affinity for CXCR4 and approximately 500 nM affinity for human serum albumin (HSA) ( Figure 1 1 A).
  • the affinity to CXCR4 was unchanged with and without the additional of the 18 residue HSA peptide SA21 ( Figure 1 1 C and D respectively).
  • the i-body AM3-1 14 did not bind to HSA without the addition of the 18 residue HSA peptide SA21 ( Figure 1 1 B). Accoringly, the conjugate demonstrating specific binding to both CXCR4 and HSA.
  • AM3-1 14-lm7-FH and AM4-746-lm7-FH [Im7-FH corresponds to an N-terminal solubility and purification tag wherein Im7 is an E.coli protein (Hosse RJ et al (2009) Anal Biochem 15;385(2):346-57 and FH is flag + 6 His] were conjugated to 30K linear or 2x20K branched PEG using a site-specific conjugation approach (HiPEGTM technology, PolyTherics, UK) in order to increase the hydrodynamic radius of the i-body molecules and thus reduce renal and hepatic elimination (Konterman et al 201 1 Curr Opin Biotech 22:868-8760).
  • the PEGylated material (AM3-1 14-30K PEG, AM3-1 14-2x20K PEG, AM4-746-2x20K PEG) and one HSA peptide conjugate (AM3-1 14-lm7-FH-SA21 ) were evaluated in a preclinical pharmacokinetic study in mice alongside control i-bodies ADCX99-9H (9 histidine tag) and AM3-1 14-lm7-FH (containing both the Im7 protein and FLAG + 6 His tag).
  • the test items were administered to groups of mice once by intravenous injection administration as described in Table 4 below:
  • the dose volume administered to animals in groups 1 , 2 and 5 was 3 mL/kg.
  • the dose volume administered to animals in group 3 was 2 mL/kg.
  • the dose volume administered to animals in groups 4 and 6 was 1 .25 mL/kg.
  • each mouse (CD-1 mouse) was bled via the saphenous vein or under isoflurane anaesthesia by cardiac puncture and the samples collected into tubes containing the anticoagulant, K 2 -EDTA. Tubes were placed on wet ice pending processing. Following its last blood sampling, each animal was euthanized by cervical dislocation and discarded without further examination.
  • Sample pre-treatment involved the direct tryptic digestion of ADCX99-9H, AM3-1 14-IM7-FH, AM3-1 14- Im7-FH-SA21 , AM4-746-2x20K PEG, AM3-1 14-30K PEG and AM3-1 14-2x20K PEG to a signature peptide (sPeptide) from CD-1 mouse plasma; GEKLTPNQQRIG was used as the internal standard.
  • the compounds were identified and quantified over a theoretical concentration range of 0.500 ⁇ g/mL to 100.000 ⁇ g/mL for ADCX99-9H, AM3-1 14-IM7-FH, AM3-1 14-lm7-FH-SA21 , AM3-1 14-30K PEG and AM3-1 14-2x20K PEG and 0.083 ⁇ g/mL to 16.667 ⁇ g/mL for AM4-746-2x20K PEG.
  • An AB Sciex API 5000 or QTRAP 5500 quadrupole mass spectrometer using a Turbo ionspray was used for the detection of ADCX99-9H, AM3-1 14-IM7-FH, AM3-1 14-lm7-FH- SA21 , AM4-746-2x20K PEG, AM3-1 14-30K PEG and AM3-1 14-2x20K PEG.
  • the half-life of the AM3-1 14 i-body was extended by the addition of both the SA21 HSA-binding peptide and by the addition of PEG 30K and PEG 2x20K as demonstrated in Figure 12, and Table 6A and 6B.
  • the inventors examined the utility of the XTEN approach which utilises the addition of roughly 400 residues of quasi-repeat sequence to the i- body, to increase the half-life of i-body in vivo, followed by a C-terminal His tag for purification/detection.
  • the XTEN sequence is engineered to be intrinsically unstructured and therefore non-immunogenic, and is also highly hydrophilic which should aid with the solubility and stability of the i-bodies during expression/purification/downstream applications (Schellenberger et al, (2009) Nature Biotech; 27(12): 1 186-1 190).
  • AM3-1 14 was cloned into a bacterial expression vector (pET26) and initial expression trials were performed. Western blotting shows a band that was reactive to anti-His antibody, which is not present in the non-induced control, strongly suggesting that the AM3-1 14-XTEN construct is indeed being expressed.
  • the predicted MW of the AM3-1 14-XTEN construct is roughly 50 kDa, whereas the band of interest is at an apparent MW of just over 100 kDa (data not shown). This is consistent with the expected mobility shift due to the highly unstructured and acidic XTEN group causing a significant decrease in the electrophoretic mobility of the ibody, a phenomenon that has previously been observed for other unstructured proteins.
  • PAS polypeptide sequence that consists of several hundred residues of the small amino acids proline, alanine, and/or serine
  • PAS sequences particularly the PAS(400) and PAS(600) adopt a random coil structure in aqueous solution thus generating a large hydrodynamic volume that allows for extension of the half-life of the protein in blood
  • proteins fused with these sequences have also reported to have very low immunogenicity and toxicity, (Schlapschy et al. Protein Eng Des Sel (2013) 26:489).
  • the i-body will be fused to the PAS sequence at the C-terminus and protein expressed in E.Coli.
  • DiscoveRx has developed a panel of cell lines stably expressing non-tagged GPCRs that signal through cAMP.
  • Hit Hunter® cAMP assays monitor the activation of a GPCR via an inhibitory regulative G-protein (Gi) and a stimulative regulative G-protein (Gs) secondary messenger signaling in a homogenous, non-imaging assay format using a technology developed by DiscoveRx called Enzyme Fragment Complementation (EFC) with ⁇ - galactosidase ( ⁇ -Gal) as the functional reporter.
  • EFC Enzyme Fragment Complementation
  • ⁇ -Gal ⁇ - galactosidase
  • ED is fused to cAMP and in the assay competes with cAMP generated by cells for binding to a cAMP-specific antibody.
  • Active ⁇ - Gal is formed by complementation of exogenous EA to any unbound ED-cAMP. Active enzyme can then convert a chemiluminescent substrate, generating an output signal detectable on a standard microplate reader.
  • cAMP Hunter cell lines were expanded from freezer stocks according to standard procedures. The cells were then seeded in a total volume of 20 ⁇ _ into white walled, 384-well microplates and incubated at 37°C for the appropriate time prior to testing. cAMP modulation was determined using the DiscoveRx HitHunter cAMP XS+ assay according to manufacturer's instructions.
  • the Hunter cells which express CXCR4 were pre- incubated with sample followed by agonist challenge at the EC80 concentration.
  • Gi cAMP assays a forskolin concentration of 1 5 ⁇ was used.
  • Media was aspirated from cells and replaced with 10 ⁇ _ 1 :1 HBSS/Hepes : cAMP XS+ Ab reagent.
  • 5 ⁇ _ of 4X stock of AMD3100 or i-bodies to CXCR4 were added to the cells and incubated at 37 °C or room temperature for 30 minutes.
  • 5 ⁇ _ of 4X EC80 agonist SDF-1 was added to cells and incubated at 37 °C or room temperature for 30 or 60 minutes.
  • Gi coupled GPCRs EC80 forksolin was included (a forskolin concentration of 1 5 ⁇ was used).
  • assay signal was generated through incubation with 20 ⁇ _ cAMP XS+ ED/ CL lysis cocktail for one hour followed by incubation with 20 ⁇ _ cAMP XS+ EA reagent for three hours at room temperature.
  • Microplates were read following signal generation with a PerkinElmer EnvisionTM instrument for chemiluminescent signal detection.
  • the i-bodies were very effective at blocking the SDF-1 induced decrease in cAMP in these cells. Indeed, all i-bodies had IC50 values lower than AMD3100. Based on the IC50 results, the CXCR4-binding i-body AM3-1 14 is a potent inhibitor of cAMP.
  • i-bodies can bind to CXCR4 and inhibit key functional signalling such as Gai-signaling pathway, which controls cAMP modulation without blocking the Gq-pathway that influences calcium flux. This could be the reason why the i-bodies could block inflammation and fibrosis but not mobilise stem cells which would be an advantage when used in long term therapy.
  • CXCR4 transfected cells were treated with i-bodies or AMD3100 for 30 min, then stimulated with 100 ng/ml of SDF-1 for 30 min. Inhibition of Ca2+ influx by controls or i-bodies (IC 50 ) was then determined.
  • Mammalian cells stably expressing human CXCR4 receptor were produced in-house by Multispan, Inc (catalog no. C1004-1 ).
  • Control agonist used was SDF-1 (Peprotech, Cat# 300- 28 A).
  • Binding of the i-bodies to CXCR4 were examined in a ⁇ -Arrestin BRET assay as described in See, Heng B et al (201 1 ) Assay and Drug Development Technologies 9(1 ):21 -30.
  • the i-bodes were examined at ten concentrations with and without 100nM SDF-1 with the addition of 'vehicle' and 'SDF-1 + vehicle' controls in order to characterise if the i-bodies are agonist or antagonists of CXCR4 activity.
  • Any cell that expresses human CXCR4 on the surface can be used to examine the ability of the CXCR4 binding molecules or polypeptides (i-bodies) described herein to bind native, cell surface CXCR4.
  • Examples of such cell lines include the human T cell line, CEM, as well as other cell lines such as Ramos, Raji, Namalwa, L540, DMS79, MDA-MB-231 , MDA-MB- 361 , MDA-MB-549, MOLT-4, DU-4475, DU-145, PC3, LNcaP, SW480, HT29, NCI-H69 and HL60.
  • Cells were treated with i-bodies AM3-1 14, AM4-272, AM3-523, AM4-746 and AM4- 1 121 (1 ⁇ , 1 ⁇ and 0.001 ⁇ ), and the staining intensities were evaluated by flow cytometry analysis.
  • Cell lines tested were T47D (CXCR4 negative), MDA-MB-231 (low CXCR4 expression) and Namalwa, NCI-H69, Jurkat, CCRF-CEM, A498, Ramos (high CXCR4 expression).
  • Cell Lines were harvested and transfered cells to 96-well tissue culture plates (2 x10 5 cells/well). The culture plate was then centrifuged at l OOOrpm, 4°C for 5 min. Cells were resuspended with 100 uL of PBS buffer containing test antibody and incubated at 4 S C for 60min. Cells were washed with 300ul ice-cold FACS buffer twice, 1000 rpm, 5 min and resuspended with 100 ul of PBS buffer containing anti-His -PE antibody (for i-bodies) and incubated at 4°C for 40min in dark. Cells were then washed with 300 uL ice-cold FACS buffer x 2, l OOOrpm, 5 min and the cells resuspended with 300ul of suspension buffer and subject to FACS analysis according to standard methods.
  • Binding affinity for CXCR4 demonstrated by flow cytometery analysis is shown in Figures 16-1 to 16-3 for representative i-body AM3-1 14 on T47D cells (A), Namalwa cells (B), MOLP8 (C), MOLT4 (D), Jurkat cells (E), CCRF-CEM (F), A498 (G), Ramos (H), NCI-H69 (I), and HL-60 (J).
  • Cell lines were tested with three i-body concentrations, (10 ⁇ , 1 ⁇ and 0.001 ⁇ ) with the exception of Namalwa cells which were also tested with i-bodies at 4.7, 2.1 , 0.47, 0.21 , 0.1 and 0.01 ⁇ .
  • FIG. 17 shows an example of two i-bodies, one which competed with SDF-1 in a dose dependant manner (AM3-1 14 Figure 17A) and one which did not compete well (AM4-272 Figure 17B).
  • CXCR4 lipoparticles were co-injected with i-body and SDF-1 at 2nM 50nM and 200nM.
  • Table 12 shows the extent (indicated by +) of each i-body to compete with SDF-1 for binding to CXCR4 positive lipoparticles.
  • CXCR4 i-bodies (AM3-1 14-6H, AM4-272-6H and AM3-523-6H) containing the N-terminal sequence EAEA to CXCR4 expressed on the surface of cells and the ability of SDF-1 to compete for the binding was assessed using flow cytometry.
  • the i-bodies were incubated with Ramos cells in 100 ⁇ of FACS buffer (1 x PBS & 2% FCS) at 4°C for 60 minutes.
  • Example 8 Inhibition of migration of CXCR4 expressing cells by the i-bodies
  • CXCR4 binding molecules or polypeptides disclosed herein to inhibit migration induced by SDF-1 can be examined using breast cancer cells line MDA-MB- 468 and prostate cancer cell line PC3 which are well characterised in terms of their metastatic potential and properties both in vitro and in vivo (Kaighn et al 1979 Invest Urol. 17(1 ):1 6-23. Yoneda et al 2000 Cancer 88:2979-88).
  • MDA-MB-468 cells are invasive and metastasise to lung from the primary mammary fat pad tumours of nude mice. The method is described in Byeong-Chel Lee et al (2004) Mol Cancer Res 2;327.
  • the cells are added to fibronectin (50 ⁇ g/mL)-coated transwell inserts (Costar Corp., Cambridge, MA).
  • the MDA-MB-468 cells and PC3 cells are then starved overnight in serum-free media and would then be incubated with the anti-CXCR4 i-body before their application to 8 ⁇ m-pore-size transwell inserts.
  • Cells are suspended into the upper chamber at a final concentration of 7 10 4 /ml_ in 500 ⁇ _ of RPMI 1640.
  • Serially diluted recombinant SDF-1 is added to the lower chamber.
  • the cells on the upper surface of the filters are removed by wiping with cotton swabs, and the migrated cells on the lower chamber are fixed and stained using a Hema3 kit (Biochemical Sciences Inc., Swedesboro, NJ), according to the manufacturer's instructions. Cellular transmigration is then enumerated in four separate microscopic fields per field (Kashima et al Cancer Sci 105 (2014) 1343-1350; Zhu et al Molecular Cancer Research (2013) 1 1 (1 ) 86-94).
  • CXCR4 i-body antagonist is pre-incubated with human umbilical vein endothelial cells (HUVEC) at 100 nM, 5 ⁇ , and 1 ⁇ g/ml concentrations, respectively, for 10 min at room temperature before seeding.
  • HUVEC human umbilical vein endothelial cells
  • the cells are then plated onto the layer of Matrigel at a density of 1 x10 5 cells/ml of M199 medium with 1 % FBS and 200 ng/ml of SDF-1 . After 18 hrs, the wells are photographed at 4x magnification in five randomized fields and the number of their tubular networks is counted.
  • CXCR4 molecules or polypeptides disclosed herein to inhibit proliferation of Ramos tumor cells, a human Burkitt's lymphoma cell line expressing CXCR4 mentioned above, in vitro was examined in a MTT cell proliferation assay as described in (Lapteva (2005) Cancer Gene Therapy 12, 84-89).
  • Cells were grown in a 96-well tissue culture plate and treated with a vehicle or the anti-CXCR4 i-body. The cells were then incubated with the MTT solution for approximately 4 hours. After this incubation period, a water-insoluble formazan dye is formed. After solubilization, the formazan dye is quantitated using a scanning multi-well spectrophotometer (ELISA reader). The absorbance revealed directly correlates to the cell number.
  • ELISA reader scanning multi-well spectrophotometer
  • i-body AM3-1 14 at 1 0 ⁇ was able to substantially inhibit the growth of RAMOS cells. This effect was particularly obvious between 24 and 48hrs after addition of the i- body, although there was still substantial inhibition of cells at 72 hrs after i-body addition. As expected AMD3100 was also able to inhibit cell growth in this time frame. Two control i-bodies (21 H5 and AM8-7) had little effect on cell growth. There was a small inhibitory effect of i-body AM4-272 but AM3-523 had no observable effect in this assay. The i-bodies had no effect on normal HEK cells.
  • an i-body of the invention to induce apoptosis in Ramos tumor cells (a human Burkitt's lymphoma cell line) was examined in an apoptosis assay according to the methods as described in Mishra M et al (201 1 ) J Cell Mol Med 15(1 1 ):2462-77. I-bodies were incubated with Ramos cells and examined by flow cytometry after 24 or 72 hours. The cells were stained for annexin V and propidium iodide which are classic markers for apoptosis. Cells which were double positive were assessed to have become apoptotic.
  • the three CXCR4 i- bodies (AM3-1 14-6H, AM4-272-6H and AM3-523-6H) were able to strongly induce apoptosis (Figure 19).
  • Untreated cells acted a negative control to show that the cells were otherwise healthy.
  • Thapsigargin is a well-described inducer of apoptosis, and shows the expected level of apoptosis.
  • AMD31 00 does not induce significant apoptosis in Ramos cells. This is consistent with a previous report showing that the human anti-CXCR4 mAb MDX-1338 was able to induce apoptosis in Ramos cells but AMD31 00 was not (Kuhne et al Clin Cancer Res (2013) 1 9(2) : 357-66).
  • Immunohistochemistry staining using the anti CXCR4 i-bodies was carried out on the spleens and livers of SCID/bg mice that had been intravenously injected with CCRF-CEM cells and sacrificed after 27 days. Tissues were fixed in 1 0% neutral buffered formalin overnight and subsequently transferred into tissue cassettes and placed in 70% ethanol. The tissues were then paraffin embedded.
  • CXCR4 binding molecules or polypeptides to inhibit proliferation of an established solid tumor in vivo can be examined using a Ramos subcutaneous tumor cell model (or Namawala cells or MDA-MB-231 or MDA-MB-468 or PC3 cells).
  • a Ramos subcutaneous tumor cell model or Namawala cells or MDA-MB-231 or MDA-MB-468 or PC3 cells.
  • 1 0 x 1 0 6 cells/mouse are implanted into the flank region of each mouse and allowed to grow to a mean size of 40 mm 3 , calculated by length x width x height/2 of the tumors.
  • the mice then receive an intraperitoneal (ip) injection of a first dose of i-body (designated as day 0 of treatment) and a second ip dose of antibody on day 7.
  • mice are treated with either (i) vehicle (ii) i-body or (iii) anti-CD20 positive control.
  • Tumor volume and mouse body weight are measured at regular intervals (approximately 2-3 times/week) between day 0 and day 30 post dosing.
  • This assay model can also be used to assess the ability of the i-bodes to increase survival time of the mice.
  • the anti-metastatic efficacy of the i-bodies of the present disclosure can be tested in animal models.
  • MDA-MB-231 cells are injected intravenously to generate an experimental metastasis model.
  • Six- to eight-week-old female nude mice are given injections of 1 .5x10 6 MDA-MB-231 breast cancer cells mixed with the i-body (1 mM, less than 5 min preincubation) through the tail vein (10/group). From the following day, mice in the treated group are given 4 mg/kg of the i-body daily by i.p. injection.
  • the animals are sacrificed 35 days after the tumor cell injection.
  • Whole lung tissues are harvested and sectioned for realtime RT-PCR for human CXCR4 and H&E histostaining to evaluate the metastatic tumor area in five fields per section microscopically.
  • each mouse is inoculated with 1 x10 6 wild-type OMM2.3 cells expressing HGF/TGF-b/CXCR4/MMP2 into the posterior chamber of right eye.
  • mice are treated with the i-body of the invention daily by i.p. injection, whereas the control mice are injected with 0.1 mL 45% (2-hydroxypropyl)-beta cyclodextrin.
  • eyes with tumor are enucleated. The growth of tumor is checked by histological methods.
  • hepatic tissues are collected and fixed in 10% formalin, processed, H&E stained, and the number of hepatic micrometastases counted under microscope.
  • Six sections through the center of the liver are microscopically examined for the presence of micrometastases (100 mm diameter) and the average number of micrometastases per section determined (Liang et al PLoS One. 2012; 7(4): e34038).
  • AM3-1 14 was able to block HIV entry into CXCR4 expressing T-cells with a similar efficacy as AMD3100 as shown in Figure 20.
  • AM3-1 14 and AMD-3100 had an IC 50 of 50 nM, whereas the negative control i-body (21 H5) had no effect in the inhibition assay as expected.
  • NP2-CD4/CXCR4 cells (1 x10 4 in 100 ⁇ ) were seeded in flat-bottom 96-well plates 24 h prior to addition of i-body (negative control i-body 21 H5, and anti-CXCR4 i-bodies AM3-1 14, AM4-272, AM3-523, AM4-746 or AM4-1 121 ). Media was then removed from the cells and replaced with 100 ⁇ of fresh media with five-fold dilutions of i-body for 16 hr at 37°C. The concentration range for the CXCR4 i-bodies was 25 ⁇ g/ml to 0.008 ug/ml.
  • NP2-CD4/CXCR4 cells were incubated at 37°C for a total of 72 h.
  • the cell viability in each well was assessed using the CellTitre-Glo Luminescent Cell Viability Assay (Promega) according to the manufacturer's protocol. Luminescence was measured using a FLUOStar microplate reader (BMG). To determine the percentage cell viability in the presence of antibody, the amount of luciferase in cells treated with the antibody was expressed as a percentage of that in untreated cells. The results are presented in Figure 21 .
  • CXCR4 i-bodies appear to cause significant levels of inhibition of two HIV-1 CXCR4-using envelope strains NL4.3 and 1 109-F-30.
  • NL4.3 is a lab adapted Envelope whilst 1 109-F-30 is a subtype C clinical Envelope from a chronically infected individual.
  • the i-bodies did not inhibit entry of an unrelated virus, VSVG, which is the Envelope from the Vesicular stomatitis virus which undergoes endocytosis after binding to an unrelated receptor, The results are presented in Figure 22.
  • the negative control i-body, 21 H5 had little effect on strain 1 109-F-30 but some invasion effect on strain NL4.3.
  • i-bodies AM3-1 14, AM4-746 and AM4-1 121 all inhibited both HIV strains very well with an IC 50 of around 80nM.
  • i-bodies AM3-1 14 and AM4-746 were conjugated to PEG sized 30K (linear) and 2x20K (branched) the IC 50 s remained consistently around 80 nM. Also consistent with the earlier experiment, AM4- 272 was the least effective at blocking HIV infection.
  • PEGylated i-bodies were assayed for their ability to block HIV infection into host cells.
  • AM3-1 14 conjugated with 20K PEG, AM3-1 14 conjugated with 30K PEG and AM4-746 conjugated with 30K PEG were assayed for the ability to block HIV invasion of three different virus strains. These were compared with the non-PEGylated versions of the i-body. Both AM3-1 14 and AM4-746 were able to block HIV invasion in a similar fashion to the non- PEGylated versions, with only a slight reduction in the potenency of the PEGylated i-bodies compared to the non-PEgylated i-bodies ( Figure 23-1 )
  • the PEGylated i-bodies and non-PEGylated ibodies are not able to block HIV entry into host cells by a strain of HIV (YU-2) that relies on CCR5 for entry ( Figure 23-2). This demonstrates that the anti-CXCR4 activity of the i-bodies are critical for blocking HIV entry.
  • NP2-CD4/CXCR4 cells (1 x10 4 in 1 00 ⁇ ) were seeded in flat-bottom 96-well plates 24 h prior to infection.
  • the anti-CXCR4 antibodies were resuspended in phosphate buffered saline (PBS). Prior to infection the media was removed from cells and replaced with 100 ⁇ of fresh media with five-fold dilutions of i-body (at a x2 concentration) for 30 min at 37°C.
  • the concentration range for the CXCR4 antibodies was 25 ⁇ g/ml to 0.008 ug/ml.
  • the concentration of PBS (5.8%, vol/vol) was maintained in the untreated wells.
  • NP2-CD4/CXCR4 cells were infected with 200 TCID50 of Env-pseudotyped luciferase reporter viruses in 1 00 ⁇ for 12 h at 37°C. Following this, the inoculum was removed and replaced with fresh media. The i-body concentrations were maintained throughout the subsequent culture period. NP2-CD4/CXCR4 were incubated at 37°C for a total of 72 h. The level of HIV-1 entry was measured by luciferase activity in cell lysates (Promega) according to the manufacturers protocol. Luminescence was measured using a FLUOStar microplate reader (BMG). Background activity was assessed by mock-infected cells and was subtracted from all wells. To calculate the percentage of HIV-1 entry in the presence of i-body, the amount of luciferase in cells treated with an i-body was expressed as a percentage of that in untreated cells.
  • Plerixafor or AMD3100 is a small molecule bicyclam CXCR4 inhibitor, which has been approved for use in combination with G-CSF for HSC mobilisation.
  • CXCR4 inhibitors of the prior art are known to cause stem cell mobilisation.
  • i-bodies of the present disclosure lack the ability to cause mobilisation of stem cells.
  • CXCR4 antibodies FLAG-tagged
  • bone marrow cells harvested from C57/BL6 mice were stained with a cocktail of five CXCR4 i-bodies (AM4-272, AM4-746, AM4-1 121 , AM3-1 14 or AM3-523) and then secondarily labelled with a fluorescent anti- FLAG antibody. These cells were stained for lineage, progenitor and HSC markers and CXCR4 expression assessed on various haemopoietic cell populations.
  • the results of this experiment validate CXCR4 i-body activity on primary mouse haemopoietic cells.
  • the same experiment was performed on bone marrow cells harvested from humanised NSG mice to validate CXCR4 i-body activity on primary human haemopoietic cell populations (data not shown).
  • the i-bodies were all able to bind to bone marrow cells and human cord blood, which were CD34 + and CD38 " .
  • mice were injected with a CXCR4 i-body (AM4-272, AM4-746, AM4-1 121 , AM3-1 14 or AM3- 523) by i.v. injection (5 mice/group). After 1 and 3 hours, mice were euthanized and peripheral blood (PB) harvested. Spleens were harvested and weighed to assess for splenomegaly (enlargement of the spleen). PB was counted to assess white blood cell content as shown in Figure 24A.
  • PB peripheral blood
  • Figure 24C shows lack of mobilisation of Lin “ , Sca-1 + , c-Kit + , CD150 + , CD48 " , (CD34 ) LSKSLAM cells by i-bodies. Again, no mobilisation was observed for all i-bodies.
  • NSG mice are severely immunodeficient and lack mature T cells, B-cells and NK cells and have severely defective innate immunity, which allows engraftment of human cells without subsequent rejection.
  • NSG mice were transplanted with freshly sorted CD34 + cord blood cells and upon confirmation of positive human CD45/CD34 engraftment (-4-5 weeks) were used as a mouse model for human stem cell mobilisation.
  • CD34 + human stem and progenitors
  • CXCR4 i-bodies bind HSC
  • Umbilical cord blood (CB) and human bone marrow (BM) were collected as previously described (Nilsson SK et al, 2005 1 5; 1 06(4) :1232-9; Grassinger, 2009 2; 1 14(1 ) :49-59).
  • Enriched human BM CD34 + cells and purified CB CD34+ cells were isolated as previously described (Grassinger, 2009).
  • huCD45-PECy7 (BD Biosciences #557748) and muCD45-BUV395 (BD Biosciences #564279) were also included in the antibody cocktail.
  • HSC from human CB and BM were defined as CD34+CD38- and HSC from huNSG mice were defined as muCD45 " huCD45 + CD34 + CD38 " .
  • CB and BM samples from 3 individual donors and BM from 3 individual huNSG mice were assessed.
  • AM3-1 14, AM4-272 and AM3-523 effectively bound human Cord Blood HSC in decreasing avidity (Figure 26).
  • AM3-1 14 also effectively bound to human Bone Marrow HSC and Bone Marrow harvested from humanized NODSCI DIL2RY _ " (huNSG) mice ( Figure 26).
  • Corneal alkali burn model Fibrosis induction (corneal neovascularisation (NV)) by the i-bodies can be examined using the corneal alkali burn model as described in Cai X et al (2014) PLoS ONE 9(2):e88176.
  • the method involves anesthetising rats (e.g. Sprague Dawley) with an intraperitoneal injection of 60 mg/kg of Nembutal and the topical administration of a drop of tetracaine.
  • a corneal alkali- wound is made by placing a 1 .5 mm diameter circular piece of filter paper, soaked in 1 N naOH, in contact with the central cornea on the right eye for 40 sec.
  • mice Immediately after alkali exposure, the ocular surface is rinsed with PBS for 60 sec.
  • CNV laser induced choroidal neovascularisation
  • a total of twenty (20) Dark agouti rats or C57BL/6 mice housed in a Biomedical Animal Facility in a cyclic light environment (12 hours on, 12 hours off, at an in-cage luminance of ⁇ 350 lux) for 10 days or more before use are anaesthetised and treated with a 532 nm continuous wave thermal laser applied as 4 spots around the optic nerve.
  • animals are treated with the highest dose of i-body (concentration at the retina being 20 mg/ml).
  • the structure of the retina of all rats is examined with a dedicated rodent fundus camera/OCT (Micron III, Phoenix Insruments), and the integrity of the vascular quantified using fluorescein angiography.
  • the size (diameter and area) of all fluorescent lesions is then quantified to provide a measure of the extent of angiogenesis.
  • the animals are killed by anaesthetic overdose and the posterior eye cups fixed in 4% paraformaldehyde for 30 mins.
  • Retinal wholemounts are then processed for IB4 labelling to assess the extent of the growth of choroidal vessels into the subretinal space. The diameter and area of the lesion provides an assessment of the extent of neovascularisation.
  • the level of scarring that develops as a consequence of invasion of choroidal blood vessels is quantified by immunolabelling for the gliotic marker GFAP.
  • retinal contraction, lesion size, alteration in microglia and glial response and pro-fibrotic gene expression in the treated retinas following laser treatment is also examined to evaluate fibrosis.
  • the anti-CXCR4 i-body AM3-1 14-6H (plus a control i-body) reduces pathological angiogenesis or lesion characteristics in a mouse model of choroidal neovascularization.
  • the levels of CXCR4 have been examined in the eye following laser treatment (PCR fibrosis array; SABiosciences) and were shown to be dysregulated.
  • the upregulation of CXCR4 in this setting suggests that treatment with CXCR4 antagonist i-bodies could have a beneficial effect.
  • the i-body drug was injected intravitreally in 1 ⁇ volume at a concentration up to 20 mg/ml.
  • RNA samples from untreated, laser treated eyes and untreated fellow eyes were pooled within their respective treatment groups (3 independent experiments containing 3 pooled samples), reversed transcribed (RT2 first strand, Qiagen) and then underwent pre- amplification of the cDNA target templates (RT2 pre-AMP, Qiagen).
  • Samples were added to a commercial mastermix (RT2 SYBR green mastermix, Qiagen) and amplified for 40 cycles (ABI 7900HT, Life Technologies, Grand Island NY). Three independent arrays were performed for each treatment group. The data were analysed using delata delta Ct (AACt), expressed as fold change and regulation assessed using an unpaired t-test.
  • AACt delata delta Ct
  • This gene expression data from both AM3-1 14 and AM4-272 treated eyes which indicates that there is extensive down regulation of pro fibrotic genes such as Coll A2, TGF-b1 , connective tissue growth factor (CTGF) and Tissue inhibitor of metalloproteinase (TIMP3), Thrombospondin 2 (Thbs2), serine peptidase inhibitor (SerpinHI ), Integrin ⁇ 8 subunit (ITGB8), Lysyl oxidase (LOX), Eotaxin (CCL1 1 ), ⁇ 3 integrin (ITGB3), serine- threonine protein kinase (Akt1 ), SMAD family member 6 (SMAD6), Platelet- Derived Growth Factor Alpha Polypeptide (PDFGA), Transforming Growth Factor, Beta Receptor II (Tgfbr2), Bone Morphogenetic Protein 7 (Bmp7), (Figure 27).
  • pro fibrotic genes such as Coll A2, TGF-b1 , connective tissue growth factor (CT
  • Circulating bone-derived mesenchymal cells that have the potential to develop into fibrocytes and can play a critical role in the pathogenesis of fibrosis (Strieter RM, Keeley EC, Burdick MD and Mehrad B. The Role of Circulating Mesenchymal Progenitor Cells, Fibrocytes, in Promoting Pulmonary Fibrosis.
  • Double labeling of i-body (AM3-1 14) and CD-45 was performed as follows, l-body AM3- 1 14 was incubated with isolated human PBMCs at room temperature for 4 hours. PBMCs were smeared on a microscope slide and fixed with acetone at 4 S C for 10 minutes. Following three times washing and rehydration with PBS the slides were incubated with mouse antiFLAG 1 :1 00 dilution over night at 4 S C. After washing the slides were incubated with Goat anti-mouse Alex Fluor 568 (to detect i-body by binding anti FLAG) at room temperature for 1 hour. The slides were then washed and incubated with Mouse anti-CD-45 FITC labeled antibody over night at 4 S C. After further washing the slides were and mounted with ProLong Gold antifade mountant containing DAPI. Images were captured by using Nikon A1 confocal microscope.
  • i-body AM3-1 14 Human fibrocytes were identified by staining with an antibody to CD45. Binding of i- body AM3-1 14 was identified by an anti-FLAG antibody to the C-terminal tag. DAPI was used to stain the nucleus of the cells. The results are presented in Figure 28. The results show that i-body AM3-1 14 was capable of binding to human fibrocytes.
  • the ability of i-bodies to block inflammation was evaluated in an in vivo murine air pouch model.
  • the subcutaneous (s.c.) air pouch is an in vivo model used to study acute and chronic inflammation (Durate et al, Models of Inflammation: Carrageenan Air Pouch, Current Protocols in Pharmacology 5.6.1 -5.6.8, March 2012).
  • Injection of irritants into an air pouch in rats or mice induces an inflammatory response that can be quantified by the volume of exudate produced, the infiltration of cells, and the release of inflammatory mediators.
  • An air pouch is generated by injection of sterile air under the skin of the back of the mouse.
  • the mouse is pretreated with either the anti-inflammatory compound or test article (i-bodies or AMD3100), and secondarily treated with SDF-1 , the inducer of inflammation.
  • Air pouch lavage fluid is then analyzed for cell trafficking and cytokine release.
  • mice were divided in groups and received an intraperitoneal injection of 0.5 ml of PBS containing or not containing the i-body (AM3-1 14, AM4-272, AM3-523, AM4-746 or AM4- 1 121 ) or AMD3100 (10 mg/kg).
  • SDF-1 (6 ⁇ ) was injected into the pouch.
  • mice were killed in a C0 2 chamber and the air pouch was washed. Cells were collected, counted, and characterized by flow cytometry.
  • Example 18 Prevention of idiopathic pulmonary fibrosis (IPF) in a bleomycin mouse model
  • the mouse IPF model is a validated model of inflammation and fibrosis, with initial (within 48 hours) lung injury characterised histologically, by perivascular oedema, capillary congestion and alveolar wall thickening associated with intra-alveolar haemorrhage and inflammatory cell infiltrate in the alveolar walls as well as in the spaces.
  • Focal peribronchial and subpleural collagen deposition usually follows within a week after bleomycin administration in this model.
  • bronchoalvelolar lavage (BAL) fluids were collected for analysis of SDF-1 concentration.
  • One half of the lung tissue was used to make single cell suspensions of the lung and the cells used for flow cytometry and assayed for CD45+, CXCR4+ and Collagen1 +(fibrocytes).
  • the other half of the lung tissue was Sircol stained for the presence of collagen 1 and RNA will be tested for Col-1 , Col-3 and SDF-1 .

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Organic Chemistry (AREA)
  • Molecular Biology (AREA)
  • Biomedical Technology (AREA)
  • Urology & Nephrology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Biochemistry (AREA)
  • Hematology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Virology (AREA)
  • Physics & Mathematics (AREA)
  • Biotechnology (AREA)
  • Cell Biology (AREA)
  • Pathology (AREA)
  • General Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Food Science & Technology (AREA)
  • Microbiology (AREA)
  • Epidemiology (AREA)
  • Endocrinology (AREA)
  • Oncology (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • AIDS & HIV (AREA)
PCT/AU2016/050005 2015-01-09 2016-01-08 Cxcr4 binding molecules Ceased WO2016109872A1 (en)

Priority Applications (16)

Application Number Priority Date Filing Date Title
US15/542,060 US10538596B2 (en) 2015-01-09 2016-01-08 CXCR4 binding molecules and methods of use thereof
SG11201705583XA SG11201705583XA (en) 2015-01-09 2016-01-08 Cxcr4 binding molecules
EP16734863.0A EP3242685B1 (en) 2015-01-09 2016-01-08 Cxcr4 binding molecules
CA2973317A CA2973317C (en) 2015-01-09 2016-01-08 Cxcr4 binding molecules
CN202210051480.9A CN114478773A (zh) 2015-01-09 2016-01-08 Cxcr4结合分子
EP22171019.7A EP4112077A1 (en) 2015-01-09 2016-01-08 Cxcr4 binding molecules
AU2016206191A AU2016206191B2 (en) 2015-01-09 2016-01-08 CXCR4 binding molecules
JP2017536271A JP6863897B2 (ja) 2015-01-09 2016-01-08 Cxcr4結合分子
LTEPPCT/AU2016/050005T LT3242685T (lt) 2015-01-09 2016-01-08 Cxcr4 surišančios molekulės
HRP20220860TT HRP20220860T1 (hr) 2015-01-09 2016-01-08 Cxcr4 vezujuće molekule
DK16734863.0T DK3242685T3 (da) 2015-01-09 2016-01-08 Cxcr4-bindende molekyler
ES16734863T ES2924394T3 (es) 2015-01-09 2016-01-08 Moléculas de unión a CXCR4
CN201680010938.9A CN107427574B (zh) 2015-01-09 2016-01-08 Cxcr4结合分子
AU2017254863A AU2017254863A1 (en) 2015-01-09 2017-10-31 CXCR4 binding molecules
AU2019203511A AU2019203511B2 (en) 2015-01-09 2019-05-20 CXCR4 binding molecules
US16/719,125 US11142588B2 (en) 2015-01-09 2019-12-18 Polypeptides which bind C-X-C chemokine receptor type 4 (CXCR4) and methods of treating or reducing the risk of fibrosis and cancer

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
AU2015900054A AU2015900054A0 (en) 2015-01-09 CXCR4 binding molecules
AU2015900054 2015-01-09

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US15/542,060 A-371-Of-International US10538596B2 (en) 2015-01-09 2016-01-08 CXCR4 binding molecules and methods of use thereof
US16/719,125 Continuation US11142588B2 (en) 2015-01-09 2019-12-18 Polypeptides which bind C-X-C chemokine receptor type 4 (CXCR4) and methods of treating or reducing the risk of fibrosis and cancer

Publications (1)

Publication Number Publication Date
WO2016109872A1 true WO2016109872A1 (en) 2016-07-14

Family

ID=56355354

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/AU2016/050005 Ceased WO2016109872A1 (en) 2015-01-09 2016-01-08 Cxcr4 binding molecules

Country Status (11)

Country Link
US (2) US10538596B2 (https=)
EP (2) EP4112077A1 (https=)
JP (3) JP6863897B2 (https=)
CN (2) CN114478773A (https=)
AU (3) AU2016206191B2 (https=)
DK (1) DK3242685T3 (https=)
ES (1) ES2924394T3 (https=)
HR (1) HRP20220860T1 (https=)
LT (1) LT3242685T (https=)
SG (2) SG10202111844VA (https=)
WO (1) WO2016109872A1 (https=)

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017220990A1 (en) 2016-06-20 2017-12-28 Kymab Limited Anti-pd-l1 antibodies
WO2018084712A1 (en) 2016-11-07 2018-05-11 Crossbeta Biosciences B.V. Novel amyloid beta oligomer specific binding molecule
WO2018130702A1 (en) * 2017-01-16 2018-07-19 Fraunhofer-Gesellschaft zur Förderung der angewandten Forschung e.V. Improved multi tyrosine kinase inhibitor therapy
JP2021507925A (ja) * 2017-12-19 2021-02-25 ジーピーシーアール セラピューティクス,インク. Gpcrヘテロマー阻害剤及びその用途
WO2023092177A1 (en) * 2021-11-23 2023-06-01 Adalta Limited Rank-l binding molecules
EP3969007A4 (en) * 2019-05-17 2023-06-07 GPCR Therapeutics, Inc. GPCR HETEROMERIC INHIBITORS AND THEIR USES
WO2025010469A1 (en) * 2023-07-07 2025-01-16 Adalta Limited Linking receptor occupancy to efficacy of cxcr4 antagonists

Families Citing this family (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN114478773A (zh) * 2015-01-09 2022-05-13 阿达尔塔有限公司 Cxcr4结合分子
WO2020205836A1 (en) * 2019-04-02 2020-10-08 Eli Lilly And Company Methods of selecting and detecting binding peptides
JP7365674B2 (ja) * 2019-08-29 2023-10-20 国立大学法人 長崎大学 アスペルギローマモデル非ヒト動物
CN110804100A (zh) * 2019-11-01 2020-02-18 中国人民解放军陆军特色医学中心 融合多肽及其在增强干细胞归巢能力和抗凋亡能力中的应用和药物组合物
CN115776989A (zh) * 2020-03-13 2023-03-10 尤利乌斯·马克西米利安维尔茨堡大学 靶向ror2的亲和力成熟和人源化结合结构域
CN114533884A (zh) * 2022-04-20 2022-05-27 澳门大学 一种联合治疗癌症的药物及s100a9-cxcl12信号抑制剂的应用
JP2023172979A (ja) * 2022-05-24 2023-12-07 国立大学法人京都大学 ポリペプチド

Citations (51)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US196A (en) 1837-05-15 Machine for mowing and heaping grain
US4439A (en) 1846-04-04 Improvement in cleansing fish-oils
US4475A (en) 1846-04-25 Henry johnson
US4447224A (en) 1982-09-20 1984-05-08 Infusaid Corporation Variable flow implantable infusion apparatus
US4447233A (en) 1981-04-10 1984-05-08 Parker-Hannifin Corporation Medication infusion pump
US4486194A (en) 1983-06-08 1984-12-04 James Ferrara Therapeutic device for administering medicaments through the skin
US4487603A (en) 1982-11-26 1984-12-11 Cordis Corporation Implantable microinfusion pump system
US4554101A (en) 1981-01-09 1985-11-19 New York Blood Center, Inc. Identification and preparation of epitopes on antigens and allergens on the basis of hydrophilicity
US4596556A (en) 1985-03-25 1986-06-24 Bioject, Inc. Hypodermic injection apparatus
US4790824A (en) 1987-06-19 1988-12-13 Bioject, Inc. Non-invasive hypodermic injection device
US4941880A (en) 1987-06-19 1990-07-17 Bioject, Inc. Pre-filled ampule and non-invasive hypodermic injection device assembly
US5064413A (en) 1989-11-09 1991-11-12 Bioject, Inc. Needleless hypodermic injection device
US5194594A (en) 1990-09-07 1993-03-16 Techniclone, Inc. Modified antibodies
US5206154A (en) 1985-01-28 1993-04-27 Xoma Corporation Method of producing cecropins by microbiological techniques
US5215896A (en) 1987-03-20 1993-06-01 Creative Biomolecules, Inc. Leader sequences for the production of recombinant proteins
WO1993021232A1 (en) 1992-04-10 1993-10-28 Research Development Foundation IMMUNOTOXINS DIRECTED AGAINST c-erbB-2 (HER-2/neu) RELATED SURFACE ANTIGENS
WO1994004688A2 (en) 1992-08-21 1994-03-03 The University Of British Columbia Cationic peptides and method for production
US5312335A (en) 1989-11-09 1994-05-17 Bioject Inc. Needleless hypodermic injection device
US5383851A (en) 1992-07-24 1995-01-24 Bioject Inc. Needleless hypodermic injection device
US5485277A (en) 1994-07-26 1996-01-16 Physical Optics Corporation Surface plasmon resonance sensor and methods for the utilization thereof
US5492840A (en) 1988-11-10 1996-02-20 Pharmacia Biosensor Ab Surface plasmon resonance sensor unit and its use in biosensor systems
US5567301A (en) 1995-03-01 1996-10-22 Illinois Institute Of Technology Antibody covalently bound film immunobiosensor
US5648244A (en) 1993-09-27 1997-07-15 President And Fellows Of Harvard College Production, purification, cleavage and use of fusion peptides
US5821047A (en) 1990-12-03 1998-10-13 Genentech, Inc. Monovalent phage display
US5972639A (en) 1997-07-24 1999-10-26 Irori Fluorescence-based assays for measuring cell proliferation
WO1999056126A2 (de) 1998-04-27 1999-11-04 Affina Immuntechnik Gmbh Immunadsorptionsmatrix, verfahren zu ihrer herstellung und ihre verwendung
WO1999057134A1 (en) 1998-05-06 1999-11-11 Genentech, Inc. Protein purification by ion exchange chromatography
US6037145A (en) 1994-09-07 2000-03-14 Suntory Limited Process for production of protein
WO2001002551A2 (en) 1999-06-30 2001-01-11 Evotec Oai Ag Virus like particles, preparation and use in screening and functional genomics
US6190908B1 (en) 1998-08-12 2001-02-20 The Scripps Research Institute Modulation of polypeptide display on modified filamentous phage
US6242219B1 (en) 1999-03-18 2001-06-05 Xoma (Us) Llc Methods for recombinant peptide production
US6248516B1 (en) 1988-11-11 2001-06-19 Medical Research Council Single domain ligands, receptors comprising said ligands methods for their production, and use of said ligands and receptors
US6306610B1 (en) 1998-09-18 2001-10-23 Massachusetts Institute Of Technology Biological applications of quantum dots
WO2001081614A2 (en) 2000-04-25 2001-11-01 Chemicon International Cell proliferation assay
WO2002026292A1 (de) 2000-09-28 2002-04-04 Affina Immuntechnik Gmbh Durchflussvorrichtung zum trennen von substanzen in körperflüssigkeiten, insbesondere blut und dessen verwendung
US6613548B1 (en) 1998-07-31 2003-09-02 Pierce Biotechnology, Inc. Fusion products containing insoluble proteinaceous tag
WO2005042695A2 (en) 2003-07-30 2005-05-12 Integral Molecular, Inc. Lipoparticles comprising proteins, methods of making, and using the same
US20050221444A1 (en) 2002-05-24 2005-10-06 Williams James A Methods and DNA constructs for high yield production of polypeptides
WO2005118629A1 (en) 2004-06-02 2005-12-15 Diatech Pty Ltd BINDING MOIETIES BASED ON SHARK IgNAR DOMAINS
US20060228364A1 (en) 1999-12-24 2006-10-12 Genentech, Inc. Serum albumin binding peptides for tumor targeting
WO2007115231A2 (en) 2006-03-30 2007-10-11 Chemocentryx, Inc. Cxcr4 modulators
WO2007115232A2 (en) 2006-03-30 2007-10-11 Chemocentryx, Inc. Cxcr4 modulators
WO2008048519A2 (en) 2006-10-18 2008-04-24 Chemocentryx, Inc. Antibodies that bind cxcr7 epitopes
WO2008109154A1 (en) 2007-03-08 2008-09-12 Altiris Therapeutics, Inc. Chemokine receptor modulators
US20080260757A1 (en) 2004-06-01 2008-10-23 Domantis Limited Bispecific Fusion Antibodies With Enhanced Serum Half-Life
US20100104588A1 (en) 2002-06-28 2010-04-29 Dennis Mark S Serum albumin binding peptides for tumor targeting
WO2010054006A1 (en) 2008-11-04 2010-05-14 Chemocentryx, Inc. Modulators of cxcr7
US20100136584A1 (en) * 2008-09-22 2010-06-03 Icb International, Inc. Methods for using antibodies and analogs thereof
US20110044988A1 (en) * 2008-03-20 2011-02-24 Carolus Therpeutics, Inc. Methods of treatment using anti-mif antibodies
WO2011083141A2 (en) 2010-01-08 2011-07-14 Ablynx Nv Method for generation of immunoglobulin sequences by using lipoprotein particles
US8283127B2 (en) 2006-11-10 2012-10-09 Dimerix Bioscience Pty Ltd. Detection system and uses therefor

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2005108415A2 (en) * 2004-04-30 2005-11-17 Biogen Idec Ma Inc. Membrane associated molecules
KR101722261B1 (ko) * 2006-10-02 2017-04-03 메다렉스, 엘.엘.시. Cxcr4에 결합하는 인간 항체 및 이의 용도
US20100092470A1 (en) * 2008-09-22 2010-04-15 Icb International, Inc. Antibodies, analogs and uses thereof
SG11201401386XA (en) * 2011-11-09 2014-10-30 Bristol Myers Squibb Co Treatment of hematologic malignancies with an anti-cxcr4 antibody
JP2016514954A (ja) * 2013-03-08 2016-05-26 クロンズ ホールディングズ カンパニー リミテッドCuronz Holdings Company Limited 神経再生ペプチドおよびその使用
CN114478773A (zh) * 2015-01-09 2022-05-13 阿达尔塔有限公司 Cxcr4结合分子

Patent Citations (54)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4439A (en) 1846-04-04 Improvement in cleansing fish-oils
US4475A (en) 1846-04-25 Henry johnson
US196A (en) 1837-05-15 Machine for mowing and heaping grain
US4554101A (en) 1981-01-09 1985-11-19 New York Blood Center, Inc. Identification and preparation of epitopes on antigens and allergens on the basis of hydrophilicity
US4447233A (en) 1981-04-10 1984-05-08 Parker-Hannifin Corporation Medication infusion pump
US4447224A (en) 1982-09-20 1984-05-08 Infusaid Corporation Variable flow implantable infusion apparatus
US4487603A (en) 1982-11-26 1984-12-11 Cordis Corporation Implantable microinfusion pump system
US4486194A (en) 1983-06-08 1984-12-04 James Ferrara Therapeutic device for administering medicaments through the skin
US5206154A (en) 1985-01-28 1993-04-27 Xoma Corporation Method of producing cecropins by microbiological techniques
US4596556A (en) 1985-03-25 1986-06-24 Bioject, Inc. Hypodermic injection apparatus
US5215896A (en) 1987-03-20 1993-06-01 Creative Biomolecules, Inc. Leader sequences for the production of recombinant proteins
US5330902A (en) 1987-03-20 1994-07-19 Creative Biomolecules, Inc. Leader sequences for the production of recombinant proteins
US5302526A (en) 1987-03-20 1994-04-12 Creative Biomolecules, Inc. Recombinant DNA enclosed amphiphilic leader sequences for the production and purification of fusion proteins
US4941880A (en) 1987-06-19 1990-07-17 Bioject, Inc. Pre-filled ampule and non-invasive hypodermic injection device assembly
US4790824A (en) 1987-06-19 1988-12-13 Bioject, Inc. Non-invasive hypodermic injection device
US5492840A (en) 1988-11-10 1996-02-20 Pharmacia Biosensor Ab Surface plasmon resonance sensor unit and its use in biosensor systems
US6248516B1 (en) 1988-11-11 2001-06-19 Medical Research Council Single domain ligands, receptors comprising said ligands methods for their production, and use of said ligands and receptors
US5312335A (en) 1989-11-09 1994-05-17 Bioject Inc. Needleless hypodermic injection device
US5064413A (en) 1989-11-09 1991-11-12 Bioject, Inc. Needleless hypodermic injection device
US5194594A (en) 1990-09-07 1993-03-16 Techniclone, Inc. Modified antibodies
US5821047A (en) 1990-12-03 1998-10-13 Genentech, Inc. Monovalent phage display
WO1993021232A1 (en) 1992-04-10 1993-10-28 Research Development Foundation IMMUNOTOXINS DIRECTED AGAINST c-erbB-2 (HER-2/neu) RELATED SURFACE ANTIGENS
US5383851A (en) 1992-07-24 1995-01-24 Bioject Inc. Needleless hypodermic injection device
US5399163A (en) 1992-07-24 1995-03-21 Bioject Inc. Needleless hypodermic injection methods and device
WO1994004688A2 (en) 1992-08-21 1994-03-03 The University Of British Columbia Cationic peptides and method for production
US5648244A (en) 1993-09-27 1997-07-15 President And Fellows Of Harvard College Production, purification, cleavage and use of fusion peptides
US5485277A (en) 1994-07-26 1996-01-16 Physical Optics Corporation Surface plasmon resonance sensor and methods for the utilization thereof
US6037145A (en) 1994-09-07 2000-03-14 Suntory Limited Process for production of protein
US5567301A (en) 1995-03-01 1996-10-22 Illinois Institute Of Technology Antibody covalently bound film immunobiosensor
US5972639A (en) 1997-07-24 1999-10-26 Irori Fluorescence-based assays for measuring cell proliferation
WO1999056126A2 (de) 1998-04-27 1999-11-04 Affina Immuntechnik Gmbh Immunadsorptionsmatrix, verfahren zu ihrer herstellung und ihre verwendung
WO1999057134A1 (en) 1998-05-06 1999-11-11 Genentech, Inc. Protein purification by ion exchange chromatography
US6613548B1 (en) 1998-07-31 2003-09-02 Pierce Biotechnology, Inc. Fusion products containing insoluble proteinaceous tag
US6190908B1 (en) 1998-08-12 2001-02-20 The Scripps Research Institute Modulation of polypeptide display on modified filamentous phage
US6306610B1 (en) 1998-09-18 2001-10-23 Massachusetts Institute Of Technology Biological applications of quantum dots
US6242219B1 (en) 1999-03-18 2001-06-05 Xoma (Us) Llc Methods for recombinant peptide production
WO2001002551A2 (en) 1999-06-30 2001-01-11 Evotec Oai Ag Virus like particles, preparation and use in screening and functional genomics
US20060228364A1 (en) 1999-12-24 2006-10-12 Genentech, Inc. Serum albumin binding peptides for tumor targeting
WO2001081614A2 (en) 2000-04-25 2001-11-01 Chemicon International Cell proliferation assay
WO2002026292A1 (de) 2000-09-28 2002-04-04 Affina Immuntechnik Gmbh Durchflussvorrichtung zum trennen von substanzen in körperflüssigkeiten, insbesondere blut und dessen verwendung
US20050221444A1 (en) 2002-05-24 2005-10-06 Williams James A Methods and DNA constructs for high yield production of polypeptides
US20100104588A1 (en) 2002-06-28 2010-04-29 Dennis Mark S Serum albumin binding peptides for tumor targeting
WO2005042695A2 (en) 2003-07-30 2005-05-12 Integral Molecular, Inc. Lipoparticles comprising proteins, methods of making, and using the same
US20080260757A1 (en) 2004-06-01 2008-10-23 Domantis Limited Bispecific Fusion Antibodies With Enhanced Serum Half-Life
WO2005118629A1 (en) 2004-06-02 2005-12-15 Diatech Pty Ltd BINDING MOIETIES BASED ON SHARK IgNAR DOMAINS
WO2007115232A2 (en) 2006-03-30 2007-10-11 Chemocentryx, Inc. Cxcr4 modulators
WO2007115231A2 (en) 2006-03-30 2007-10-11 Chemocentryx, Inc. Cxcr4 modulators
WO2008048519A2 (en) 2006-10-18 2008-04-24 Chemocentryx, Inc. Antibodies that bind cxcr7 epitopes
US8283127B2 (en) 2006-11-10 2012-10-09 Dimerix Bioscience Pty Ltd. Detection system and uses therefor
WO2008109154A1 (en) 2007-03-08 2008-09-12 Altiris Therapeutics, Inc. Chemokine receptor modulators
US20110044988A1 (en) * 2008-03-20 2011-02-24 Carolus Therpeutics, Inc. Methods of treatment using anti-mif antibodies
US20100136584A1 (en) * 2008-09-22 2010-06-03 Icb International, Inc. Methods for using antibodies and analogs thereof
WO2010054006A1 (en) 2008-11-04 2010-05-14 Chemocentryx, Inc. Modulators of cxcr7
WO2011083141A2 (en) 2010-01-08 2011-07-14 Ablynx Nv Method for generation of immunoglobulin sequences by using lipoprotein particles

Non-Patent Citations (173)

* Cited by examiner, † Cited by third party
Title
"Remington's Pharmaceutical Sciences", 1980, MACK PUBLISHING COMPANY
"Uniprot", Database accession no. P61073-1
ABU EL-ASAR ET AL., BR J OPHTHALMOL, vol. 92, 2008, pages 699 - 704
ACHOUR L ET AL., METHODS MOL BIOL, vol. 756, 2011, pages 183 - 200
ALTSCHUL ET AL., J. MO. BIOL., vol. 215, 1990, pages 403 - 10
ALTSCHUL ET AL., NUC ACIDS RES., vol. 25, no. 17, 1997, pages 3389 - 3402
ANGEW. CHEM. INT. ED., vol. 53, 2014, pages 1 - 6
ASSAY DRUG DEV TECHNOL, vol. 9, no. 1, pages 21 - 30
AVNIEL ET AL., JOURNAL OF INVESTIGATIVE DERMATOLOGY, vol. 126, 2006, pages 468 - 476
BANIK ET AL., DRUG DISCOVERY & DEVELOPMENT, vol. 12, no. 9, 2009, pages 14 - 17
BIOPHYS J, vol. 73, pages 2791 - 2197
BOGANTHORN, J. MOL. BIOL., vol. 280, 1998, pages 1 - 9
BOUJEDIDI ET AL., CLINICAL SCIENCE, vol. 128, 2015, pages 257 - 267
BRENNAN ET AL., SCIENCE, vol. 229, 1985, pages 81 - 83
BROXMEYER, H E ET AL., J. EXP. MED, vol. 201, 2005, pages 1307 - 1318
BUTLER ET AL., J CLIN INVEST, vol. 115, 2005, pages 86 - 93
BUTLER ET AL., THE JOURNAL OF CLIN INVEST, vol. 115, 2005, pages 86 - 93
BYEONG-CHEL LEE ET AL., MOL CANCER RES, vol. 2, 2004, pages 327
CAI X ET AL., PLOS ONE, vol. 9, no. 2, 2014, pages e88176
CAREVIC ET AL., EUR RESPIR J, vol. 46, 2015, pages 395 - 404
CARNEC, X ET AL., J VIROL, vol. 79, 2005, pages 1930 - 1938
CHEM. PHYS. LIPIDS, vol. 96, pages 69 - 80
CHEUNG ET AL., LANCET, vol. 376, 2010, pages 124 - 36
CHU ET AL., CIRC HEART FAIL., vol. 4, 2011, pages 651 - 658
COGGINS ET AL., PLOS ONE, vol. 9, 2014, pages e98328
COPER MA ET AL., NATURE BIOTECHNOLOGY, vol. 19, 2001, pages 833 - 837
DAVID ET AL., BIOCHEMISTRY, vol. 13, 1974, pages 1014
DECAILLOT FM ET AL., J BIOL CHEM, vol. 286, no. 37, 2011, pages 32188 32197 - 97
DENNIS MS ET AL., J. BIOL. CHEM., vol. 277, 2002, pages 35035 - 35043
DEVINE, S M ET AL., J. CLIN. ONCOL, vol. 22, no. 102, 2004, pages 1095 - 1
DICKINSON ET AL., NATURE, vol. 382, 1996, pages 697 - 700
DING ET AL., CRIT CARE MED, vol. 34, 2006, pages 3011 - 3017
DING ET AL., WOUND REP AND REG, vol. 22, 2014, pages 622 - 630
DYKES ET AL., EUR. J. BIOCHEM., vol. 174, 1988, pages 411
EDGE, NATURE, vol. 292, 1981, pages 756
EGLEN RM ET AL., ASSAY DRUG DEV TECHNOL, vol. 6, 2008, pages 659 - 71
FARKAS ET AL., PLOSONE, vol. 9, 2014, pages e89810
FERNANDIS ET AL., ONCOGENE, vol. 23, 2004, pages 157 - 167
FERRARA ET AL., NATURE, vol. 438, 2005, pages 967 - 74
FLETCHER EL ET AL., PROG MOL BIOL TRANSL SCI, vol. 100, 2011, pages 211 - 286
FLOMENBERG, N ET AL., BLOOD, vol. 106, 2005, pages 1867 - 1874
FREI ET AL., J. CELL BIOL., vol. 118, 1992, pages 177 - 194
FRIEDMAN ET AL., SCI TRANSL MED., vol. 5, 2013, pages 167sr1
GAZITT, Y., J HEMATOTHER. STEM CELL RES., vol. 10, 2001, pages 229 - 236
GENG Y ET AL., SCIENCE, vol. 272, 1996, pages 872 - 877
GLENNIE ET AL., J IMMUNOL, vol. 39, 1987, pages 2367 - 2375
GOLDMACHER ET AL., THERAPEUTIC DELIVERY, vol. 2, 2011, pages 397 - 416
GONZALO ET AL., J IMMUNOL., vol. 165, 2000, pages 499 - 508
GONZALO, J A ET AL., J. IMMUNOL, vol. 165, 2000, pages 499 - 508
GOODMANRO: "BURGER'S MEDICINAL CHEMISTRY AND DRUG DISCOVERY", vol. 1, 1995, JOHN WILEY & SONS, article "Peptidomimetics for Drug Design", pages: 803 - 861
GRAMM ET AL., BIO/TECHNOLOGY, vol. 12, 1994, pages 1017
GRUNEWALD M ET AL., CELL, vol. 124, no. 1, 2006, pages 175 - 89
GULENG, B. ET AL., CANCER RES., vol. 65, 2005, pages 5864 - 58
HAJISHENGALLIS ET AL., PNAS, vol. 105, 2008, pages 13532 - 13537
HANES ET AL., JBC, vol. 290, no. 37, 2015, pages 22385 - 22397
HASTE ET AL., MOLECULAR PHARMACOLOGY, vol. 60, 2001, pages 164 - 173
HATSE ET AL., BIOCHEM PHARMACOL., vol. 70, 2005, pages 752 - 761
HAWKINS ET AL., J. MOL. BIOL., vol. 226, 1992, pages 889 - 896
HEELEY, R. P, ENDOCR. RES., vol. 28, 2002, pages 217 - 229
HENDERSON ET AL., STRUCTURE, vol. 15, 2007, pages 1452 - 66
HENG B ET AL., ASSAY AND DRUG DEVELOPMENT TECHNOLOGIES, vol. 9, no. 1, 2011, pages 21 - 30
HERMES ET AL., GENE, vol. 84, 1989, pages 143 - 1514
HOFFMAN ET AL., PROC NATL ACAD SCI, vol. 97, 2000, pages 11215 - 11220
HOLMAN ET AL., BIOCHIMICA ET BIOPHYSICA ACTA, 2011
HOSOKAWA, Y ET AL., CLIN. EXP. IMMUNOL, vol. 4, 2005, pages 467 - 474
HOSSE RJ ET AL., ANAL BIOCHEM 15, vol. 385, no. 2, 2009, pages 346 - 57
HOU, T ET AL., J IMMUNOL, vol. 160, 1998, pages 180 - 188
HUNTER ET AL., NATURE, vol. 144, 1962, pages 945
IRVING ET AL., IMMUNOTECHNOLOGY, vol. 2, 1996, pages 127 - 433
JAHNICHEN, S. ET AL.: "CXCR4 nanobodies (VHH-based single variable domains) potently inhibit chemotaxis and HIV-1 replication and mobilize stem cells", PNAS, vol. 107, no. 47, 2010, pages 2065 - 20570, XP002611004 *
JAY ET AL., J. BIOL. CHEM., vol. 259, 1984, pages 6311
JIN, D. K. ET AL., NAT MED., vol. 12, 2006, pages 557 - 567
KAHN ET AL.: "Overexpression of CXCR4 on human CD34+ progenitors increases their proliferation, migration, and NOD/SCID repopulation", BLOOD, vol. 103, 2004, pages 2942 - 2949
KAIGHN ET AL., INVEST UROL., vol. 17, no. 1, 1979, pages 16 - 23
KARPOVSKY, J. EXP. MED, vol. 160, 1984, pages 1686
KASHIMA ET AL., CANCER SCI, vol. 105, 2014, pages 1343 - 1350
KEMPE ET AL., GENE, vol. 39, 1985, pages 239
KIM ET AL., BMB REP., vol. 42, 2009, pages 212 - 216
KOHLER ET AL., BRAIN PATHOLOGY, vol. 18, 2008, pages 504 - 516
KOPSIDAS ET AL., IMMUNOLOGY LETTERS, vol. 107, 2006, pages 163 - 168
KREMER ET AL., J. IMMUNOL., vol. 187, 2011, pages 1440 - 1447
KROOK ET AL., MOL CANCER RES, vol. 12, 2014, pages 953 - 964
KUHNE ET AL., CLIN CANCER RES, vol. 19, no. 2, 2013, pages 357 - 66
KULIOPULOS ET AL., J. AM. CHEM. SOC., vol. 116, 1994, pages 4599
LA ROCCA ET AL., J CARDIOVASC PHARMACOL., vol. 56, 2010, pages 548 - 559
LAI ET AL., ANTIMICROB. AGENTS & CHEMO., vol. 37, pages 1614
LAPTEVA, CANCER GENE THERAPY, vol. 12, 2005, pages 84 - 89
LEVOYE A ET AL., BLOOD, vol. 113, no. 24, 2009, pages 6085 - 6093
LI ET AL., CANCER LETT, vol. 322, 2012, pages 169 - 176
LIANG ET AL., BIOCHEM BIOPHYS RES COMMUN, vol. 359, no. 3, 2007, pages 716 - 722
LIANG ET AL., BIOCHEM BIOPHYS RES COMMUN., vol. 359, no. 3, 3 August 2007 (2007-08-03), pages 716 - 722
LIANG ET AL., PLOS ONE, vol. 7, no. 4, 2012, pages e34038
LIANG ZHONGXING ET AL., PLOS ONE, vol. 7, no. 4, 2012, pages e34038
LILJEBLAD ET AL., GLYCO. J., vol. 17, 2000, pages 323 - 329
LIMASILVA ET AL., FASEB J, vol. 21, 2007, pages 3219 - 30
LIU, MA ET AL., PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 8648
LO CONTE ET AL., J. MOL. BIOL., vol. 285, 1999, pages 2177 - 2198
LOVGREN ET AL., SCI TRANSL MED, vol. 3, 2011, pages 74ra23
LUKACS ET AL., AJP, vol. 160, 2012, pages 1353 - 1360
LUKACS ET AL., AM J PATHOL., vol. 160, 2002, pages 1353 - 60
LUPPI ET AL., CURR RESPIR CARE REP, vol. 1, 2012, pages 216 - 223
LUTTRELL ET AL., JOURNAL OF CELL SCIENCE, vol. 115, 2002, pages 455 - 465
MATTHYS, P ET AL., J. IMMUNOL, vol. 167, 2001, pages 4686 - 4692
MAYNARD JA ET AL., BIOTECHNOL J, vol. 4, no. 11, 2009, pages 1542 - 1558
MISHRA M ET AL., J CELL MOL MED, vol. 15, no. 11, 2011, pages 2462 - 77
MURPHY PM, N. ENG. J. MED., vol. 345, pages 833 - 835
MURRAY ET AL., AMERICAN JOURNAL OF RESPIRATORY CELL AND MOLECULAR BIOLOGY, vol. 50, no. 5, May 2014 (2014-05-01)
NAGASE ET AL., J IMMUNOL, vol. 164, 2000, pages 5935 - 5943
NAGASHIMA ET AL., J BIOCHEM., vol. 149, 2011, pages 337 - 346
NAMBAIR ET AL., SCIENCE, vol. 223, 1984, pages 1299
NATURE REVIEWS CANCER, vol. 1, 2001, pages 118 - 129
NAUGHT ET AL., BIOTECHNOL. BIOENGINEER., vol. 57, 1998, pages 55 - 61
NEOTE ET AL., CELL, vol. 72, 1993, pages 415 - 425
NYGREN, J., HISTOCHEM. AND CYTOCHEM., vol. 30, 1982, pages 407
PAIN ET AL., J. IMMUNOL. METH., vol. 40, 1981, pages 219
PAULUS, BEHRING INS MITT, vol. 1, no. 78, 1985, pages 18 - 132
PAYNE, CANCER CELL, vol. 3, 2003, pages 207 - 212
PELLO ET AL., EUR. J. IMMUNOL., vol. 38, 2008, pages 537 - 549
PETERS ET AL., BLOOD, vol. 115, no. 10, 2010, pages 2057 - 2064
PHILLIPS RJBURDICK MDHONG KLUTZ MAMURRAY LA ET AL.: "Circulating fibrocytes traffic to the lungs in response to CXCL12 and mediate fibrosis", J CLIN INVEST, vol. 114, 2004, pages 438 - 446, XP002579900, DOI: 10.1172/JCI200420997
PILON ET AL., BIOTECHNOL. PROG., vol. 13, 1997, pages 374 - 79
RAJAGOPAL ET AL., PNAS, vol. 107, 2010, pages 628 - 632
RAMSEY, D.M. ET AL.: "Halting metastasis through CXCR4 inhibition", BIOORGANIC & MEDICINAL CHEMISTRY LETTERS, vol. 23, no. 1, 2013, pages 20 - 25, XP028961557, DOI: doi:10.1016/j.bmcl.2012.10.138 *
RAY ET AL., BIO/TECHNOLOGY, vol. 11, 1993, pages 64
REICHERT ET AL., NATURE REVIEWS DRUG DISCOVERY, vol. 6, 2007, pages 349 - 356
ROSENFELD ET AL., N ENGL J MED, vol. 355, 2006, pages 1432 - 44
ROZENFELD R ET AL., BIOCHEM J, vol. 433, pages 11 - 8
SALAMON ET AL., COUPLED PLASMON-WAVELENGTH RESONANCE (CPWR) SPECTROSCOPY, 1997
SCHELLENBERGER ET AL., INT. J. PEPTIDE PROTEIN RES., vol. 41, 1993, pages 326
SCHELLENBERGER ET AL., NATURE BIOTECH, vol. 27, no. 12, 2009, pages 1186 - 1190
SCHELLENBERGER ET AL., NATURE BIOTECHNOLOGY, vol. 27, no. 12, 2009, pages 1186 - 1192
SCHLAPSCHY ET AL., PROTEIN ENG DES SEL, vol. 26, 2013, pages 489
SCHLAPSCHY ET AL., PROTEIN ENGINEERING, DESIGN & SELECTION, vol. 26, no. 8, 2013, pages 489 - 501
SCHRAMA ET AL., NATURE REV. DRUG DISCOV., vol. 5, 2006, pages 147 - 159
SCOPES: "Protein purification: principles and practice", 1994, SPRINGER VERLAG
SCOTTI ET AL., RETINA, vol. 34, 2014, pages 1802 - 10
SHARON MCGONIGLEVICTOR SHIFRIN: "Models of Inflammation: Carrageenan Air Pouch", CURRENT PROTOCOLS IN PHARMACOLOGY, March 2012 (2012-03-01)
SHEN ET AL., PROC. NAT. ACAD. SCI. USA, vol. 281, 1984, pages 4627
SHU ET AL., PLOS ONE, vol. 8, no. 11, 2013, pages e79768
SHU ET AL., PLOSONE, vol. 8, 2013, pages e79768
SOHY ET AL., J BIOL CHEM., vol. 282, 2007, pages 30062 - 30069
SOHY ET AL., J BIOL CHEM., vol. 284, 2009, pages 31270 - 31279
SONMEZ ET AL., OPHTHALMOLOGY, vol. 115, 2008, pages 1065 - 1070
STEMMER, PROC NATL ACAD SCI U S A., vol. 91, no. 22, 1994, pages 10747 - 10751
STENLUND P ET AL., ANAL BIOCHEM, vol. 316, no. 2, 2003, pages 243 - 50
STRIETER RMKEELEY ECBURDICK MDMEHRAD B: "The Role of Circulating Mesenchymal Progenitor Cells, Fibrocytes, in Promoting Pulmonary Fibrosis", TRANS AM CLIN CLIMATOL ASSOC, vol. 120, 2009, pages 49 - 59
SUNDBERG ET AL., CURRENT OPIN IN BIOTECH, vol. 11, pages 47 - 53
TACHIBANA K ET AL., NATURE, vol. 393, no. 6685, 1998, pages 591 - 594
TAMAYO ET AL.: "Microcantilevers", ULTRAMICROSCOPY, vol. 86, 2001, pages 167 - 173, XP002511824, DOI: 10.1016/S0304-3991(00)00082-6
TERADA, R ET AL., LAB. INVEST, vol. 83, 2003, pages 665 - 672
TOURKINA ET AL., FIBROGENESIS & TISSUE REPAIR, vol. 4, 2011
TRUJILLO ET AL., SCI TRANSL MED, vol. 2, 2010, pages 57ra82
TSUTSUMI ET AL., BIOPOLYMERS., vol. 88, 2007, pages 279 - 289
VAN RIPER ET AL., J. EXP. MED, vol. 177, 1993, pages 851 - 856
VILLALVILLA ET AL., LIFE SCIENCES, vol. 91, 2012, pages 264 - 270
W. R. PEARSON: "Rapid and Sensitive Sequence Comparison with FASTP and FASTA", METHODS IN ENZYMOLOGY, vol. 183, 1990, pages 63 - 98, XP000670614, DOI: 10.1016/0076-6879(90)83007-V
W. R. PEARSOND. J. LIPMAN: "Improved Tools for Biological Sequence Analysis", PNAS, vol. 85, 1988, pages 2444 - 2448
WALT ET AL., SCIENCE, vol. 287, pages 451 - 52
WEEKS BL, SCANNING, vol. 25, no. 6, 2003, pages 297 - 9
WILLIS S ET AL., BIOCHEMISTRY, vol. 47, 2008, pages 6988 - 90
WU ET AL., SCIENCE, vol. 330, 2010, pages 1066 - 1071
WYNN ET AL., NAT MED, vol. 18, 2012, pages 1028 - 1040
XU ET AL., CELL MOL BIOL., vol. 37, 2007, pages 291 - 299
XU Y ET AL., PROC NATL ACAD SCI, vol. 96, 1999, pages 151 - 6
YONEDA ET AL., CANCER, vol. 88, 2000, pages 2979 - 88
YOON Y ET AL., CANCER RES, vol. 67, 2007, pages 7518 - 7524
YUAN ET AL., AM J PHYSIOL RENAL PHYSIOL., vol. 308, 2014, pages 459 - 472
ZERNECKE ET AL., CIRCULATION RESEARCH, vol. 102, 2008, pages 09 - 217
ZHANG ET AL., EXPERIMENTAL EYE RESEARCH, vol. 89, 2009, pages 522 - 531
ZHANG Z ET AL., INVEST OPHTHALMOL VIS SCI, vol. 46, 2005, pages 4062 - 4071
ZHU ET AL., MOLECULAR CANCER RESEARCH, vol. 11, no. 1, 2013, pages 86 - 94
ZOLA: "Monoclonal Antibodies: A Manual of Techniques", 1987, CRC PRESS, INC, pages: 147 - 158
ZUK ET AL., AM J PHYSIOL RENAL PHYSIOL, vol. 307, no. 7, 2014, pages F783 - 97

Cited By (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017220990A1 (en) 2016-06-20 2017-12-28 Kymab Limited Anti-pd-l1 antibodies
WO2017220989A1 (en) 2016-06-20 2017-12-28 Kymab Limited Anti-pd-l1 and il-2 cytokines
WO2017220988A1 (en) 2016-06-20 2017-12-28 Kymab Limited Multispecific antibodies for immuno-oncology
WO2018084712A1 (en) 2016-11-07 2018-05-11 Crossbeta Biosciences B.V. Novel amyloid beta oligomer specific binding molecule
WO2018130702A1 (en) * 2017-01-16 2018-07-19 Fraunhofer-Gesellschaft zur Förderung der angewandten Forschung e.V. Improved multi tyrosine kinase inhibitor therapy
AU2018388302B2 (en) * 2017-12-19 2024-10-31 Gpcr Therapeutics, Inc. GPCR heteromer inhibitors and uses thereof
EP3727371A4 (en) * 2017-12-19 2021-10-27 GPCR Therapeutics, Inc. GPCR HETEROMER INHIBITORS AND THEIR USES
US11857600B2 (en) 2017-12-19 2024-01-02 Gpcr Therapeutics, Inc. GPCR heteromer inhibitors and uses thereof
JP7517986B2 (ja) 2017-12-19 2024-07-17 ジーピーシーアール セラピューティクス,インク. Gpcrヘテロマー阻害剤及びその用途
JP2024109616A (ja) * 2017-12-19 2024-08-14 ジーピーシーアール セラピューティクス,インク. Gpcrヘテロマー阻害剤及びその用途
JP2021507925A (ja) * 2017-12-19 2021-02-25 ジーピーシーアール セラピューティクス,インク. Gpcrヘテロマー阻害剤及びその用途
JP7818648B2 (ja) 2017-12-19 2026-02-20 ジーピーシーアール セラピューティクス,インク. Gpcrヘテロマー阻害剤及びその用途
EP3969007A4 (en) * 2019-05-17 2023-06-07 GPCR Therapeutics, Inc. GPCR HETEROMERIC INHIBITORS AND THEIR USES
AU2020278977B2 (en) * 2019-05-17 2025-05-01 Gpcr Therapeutics, Inc. GPCR heteromer inhibitors and uses thereof
WO2023092177A1 (en) * 2021-11-23 2023-06-01 Adalta Limited Rank-l binding molecules
WO2025010469A1 (en) * 2023-07-07 2025-01-16 Adalta Limited Linking receptor occupancy to efficacy of cxcr4 antagonists

Also Published As

Publication number Publication date
US20180072816A1 (en) 2018-03-15
JP6863897B2 (ja) 2021-04-21
CA2973317A1 (en) 2016-07-14
AU2017254863A1 (en) 2017-11-16
DK3242685T3 (da) 2022-07-25
US10538596B2 (en) 2020-01-21
JP2020182479A (ja) 2020-11-12
EP3242685A4 (en) 2018-07-11
AU2019203511A1 (en) 2019-06-06
AU2016206191B2 (en) 2017-08-03
AU2016206191A1 (en) 2016-12-15
ES2924394T3 (es) 2022-10-06
US20200231708A1 (en) 2020-07-23
SG10202111844VA (en) 2021-12-30
EP4112077A1 (en) 2023-01-04
AU2019203511B2 (en) 2021-08-12
CN107427574B (zh) 2022-02-08
CN114478773A (zh) 2022-05-13
US11142588B2 (en) 2021-10-12
EP3242685A1 (en) 2017-11-15
JP2023015277A (ja) 2023-01-31
LT3242685T (lt) 2022-08-25
SG11201705583XA (en) 2017-08-30
EP3242685B1 (en) 2022-05-04
AU2016206191A9 (en) 2017-01-19
JP7212009B2 (ja) 2023-01-24
HRP20220860T1 (hr) 2022-10-14
JP2018504112A (ja) 2018-02-15
CN107427574A (zh) 2017-12-01

Similar Documents

Publication Publication Date Title
US11142588B2 (en) Polypeptides which bind C-X-C chemokine receptor type 4 (CXCR4) and methods of treating or reducing the risk of fibrosis and cancer
US11827712B2 (en) IL13Rα2 binding agents and use thereof
CN105518028B (zh) 与dll4和vegf特异性结合的新型双靶向蛋白及其用途
JP2022043040A (ja) 抗gpc-1抗体
US20140200179A1 (en) Wnt compositions and methods of use thereof
CN115427057A (zh) 靶向突变ras蛋白的分子
CN111378040A (zh) 检测多种恶性肿瘤细胞的抗体及其应用
CA2973317C (en) Cxcr4 binding molecules
HK40066087A (zh) Cxcr4结合分子
CN115484971A (zh) 靶向蛋白的分子
JP2025533403A (ja) 標的化pd-l1分解
AU2024286934A1 (en) Recombinant cd2 binding proteins and their use

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16734863

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2016206191

Country of ref document: AU

Date of ref document: 20160108

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 11201705583X

Country of ref document: SG

ENP Entry into the national phase

Ref document number: 2973317

Country of ref document: CA

Ref document number: 2017536271

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

REEP Request for entry into the european phase

Ref document number: 2016734863

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 15542060

Country of ref document: US