WO2016073791A1 - Methods of producing two chain proteins in bacteria - Google Patents

Methods of producing two chain proteins in bacteria Download PDF

Info

Publication number
WO2016073791A1
WO2016073791A1 PCT/US2015/059339 US2015059339W WO2016073791A1 WO 2016073791 A1 WO2016073791 A1 WO 2016073791A1 US 2015059339 W US2015059339 W US 2015059339W WO 2016073791 A1 WO2016073791 A1 WO 2016073791A1
Authority
WO
WIPO (PCT)
Prior art keywords
host cell
antibody
protein
seq
production
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2015/059339
Other languages
English (en)
French (fr)
Inventor
James GIULIANOTTI
Dorothea Reilly
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
F Hoffmann La Roche AG
Genentech Inc
Original Assignee
F Hoffmann La Roche AG
Genentech Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to HK18114324.8A priority Critical patent/HK1255201B/zh
Priority to BR112017009152A priority patent/BR112017009152A2/pt
Priority to EP15802233.5A priority patent/EP3215526A1/en
Priority to CN201580059973.5A priority patent/CN108064308B/zh
Priority to MX2017005930A priority patent/MX384534B/es
Priority to CA2966558A priority patent/CA2966558C/en
Priority to AU2015342961A priority patent/AU2015342961B2/en
Priority to RU2017119403A priority patent/RU2705274C2/ru
Application filed by F Hoffmann La Roche AG, Genentech Inc filed Critical F Hoffmann La Roche AG
Priority to JP2017523894A priority patent/JP6875276B2/ja
Priority to KR1020177014850A priority patent/KR102709593B1/ko
Publication of WO2016073791A1 publication Critical patent/WO2016073791A1/en
Priority to IL252027A priority patent/IL252027B/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/24Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
    • C07K16/244Interleukins [IL]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/46Hybrid immunoglobulins
    • C07K16/468Immunoglobulins having two or more different antigen binding sites, e.g. multifunctional antibodies
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/70Vectors or expression systems specially adapted for E. coli
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/10Immunoglobulins specific features characterized by their source of isolation or production
    • C07K2317/14Specific host cells or culture conditions, e.g. components, pH or temperature
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific

Definitions

  • This disclosure relates to methods of producing recombinant polypeptides, such as antibodies. More specifically, this disclosure relates to methods of producing heterologous secretory proteins in bacteria through utilization of optimized expression vectors and culture processes.
  • Monoclonal antibodies represent one of the fastest growing types of recombinant therapeutic agent, with numerous monoclonal antibodies already approved or under review for the treatment of various diseases (Nelson et al., Nature Review Drug Discovery, 9:767,
  • a polypeptide comprising two chains in a prokaryotic host cell comprising: (a) culturing the host cell to express the two chains of the polypeptide, whereby upon expression the two chains fold and assemble to form a biologically active polypeptide in the host cell; wherein the host cell comprises a polynucleotide comprising (1) a first translational unit encoding a first chain of the polypeptide; (2) a second translational unit encoding a second chain of the polypeptide; and (3) a third translational unit encoding at least one chaperone protein selected from the group consisting of peptidyl-prolyl isomerases, protein disulfide oxidoreductases, and combinations thereof; wherein the host cell is cultured in a culture medium under conditions comprising: a growth phase comprising a growth temperature and a growth agitation rate, and a production phase comprising a production temperature and a production agitation rate,
  • Also provided are methods of producing a polypeptide comprising two chains in a prokaryotic host cell comprising: (a) culturing the host cell to express the two chains of the polypeptide in a culture medium under conditions comprising: a growth phase comprising a growth temperature and a growth agitation rate, and a production phase comprising a production temperature and a production agitation rate, whereby upon expression the two chains fold and assemble to form a biologically active polypeptide in the host cell; wherein the host cell comprises a polynucleotide comprising (1) a first translational unit encoding a first chain of the polypeptide; (2) a second translational unit encoding a second chain of the polypeptide; and (3) a third translational unit encoding at least one chaperone protein selected from the group consisting of peptidyl-prolyl isomerases, protein disulfide oxidoreductases, and combinations thereof; wherein the growth temperature is from 2 to 10°C above the production temperature, and
  • Also provided are methods of producing a polypeptide comprising two chains in a prokaryotic host cell comprising: (a) culturing the host cell to express the two chains of the polypeptide, whereby upon expression the two chains fold and assemble to form a
  • the host cell comprises a
  • polynucleotide comprising: (1) a first translational unit encoding a first chain of the polypeptide; (2) a second translational unit encoding a second chain of the polypeptide; (3) a third translational unit encoding a first chaperone protein; (4) a fourth translational unit encoding a second chaperone protein; and (5) a fifth translational unit encoding a third chaperone protein, wherein the first, second and third chaperone proteins are selected from the group consisting of peptidyl-prolyl isomerases, protein disulfide oxidoreductases, and combinations thereof; wherein the host cell is cultured in a culture medium under conditions comprising: a growth phase comprising a growth temperature and a growth agitation rate, and a production phase comprising a production temperature and a production agitation rate, wherein the growth temperature is from 2 to 10°C above the production temperature, and the growth agitation rate is from 50 to 250 rpm above the production agitation rate;
  • Also provided are methods of producing a polypeptide comprising two chains in a prokaryotic host cell comprising: (a) culturing the host cell to express the two chains of the polypeptide in a culture medium under conditions comprising: a growth phase comprising a growth temperature and a growth agitation rate, and a production phase comprising a production temperature and a production agitation rate, whereby upon expression the two chains fold and assemble to form a biologically active polypeptide in the host cell; wherein the host cell comprises a polynucleotide comprising: (1) a first translational unit encoding a first chain of the polypeptide; (2) a second translational unit encoding a second chain of the polypeptide;
  • the first, second and third chaperone proteins are selected from the group consisting of peptidyl-prolyl isomerases, protein disulfide oxidoreductases, and combinations thereof; wherein the growth temperature is from 2 to 10°C above the production temperature, and the growth agitation rate is from 50 to 250 rpm above the production agitation rate; and (b) recovering the biologically active polypeptide from the host cell.
  • the polypeptide comprises three, four or five chains.
  • pH of the culture medium is maintained at a pH in the range of between 6.7 and 7.3 during the production phase.
  • the polynucleotide further comprises three copies of a promoter, wherein a first copy is in operable combination with the first translational unit, a second copy is in operable combination with the second translational unit, and a third copy is in operable combination with the third translational unit to drive transcription of the first chain, the second chain and the chaperone protein.
  • the polynucleotide further comprises a promoter in operable combination with each translational unit.
  • the promoter is an inducible promoter.
  • the inducible promoter is an IPTG-inducible promoter that drives transcription of the first chain, the second chain and the chaperone protein in the absence of IPTG induction.
  • the inducible promoter is a Pho promoter that drives transcription of the first chain, the second chain and the chaperone protein when phosphate in the culture medium has been depleted.
  • the polynucleotide further comprises a selectable marker and the culture medium comprises a selection agent consisting of a single antibiotic to cause the host cell to retain the polynucleotide.
  • the first translational unit comprises a first translation initiation region (TIR) in operable combination with a coding region of the first chain
  • the second translational unit comprises a second translation initiation region (TIR) in operable combination with a coding region of the second chain, wherein the relative translation strength of the first and second TIR is from about 1.0 to about 3.0.
  • the at least one chaperone protein, or the first chaperone protein comprises a peptidyl-prolyl isomerase.
  • the peptidyl-prolyl isomerase is an FkpA protein.
  • the FkpA is E. coli FkpA.
  • the at least one chaperone protein further comprises or one or both of the second chaperone protein and the third chaperone protein comprises a protein disulfide oxidoreductase.
  • the protein disulfide oxidoreductase is one or both of a DsbA protein and a DsbC protein.
  • the at least one protein disulfide oxidoreductase is one or both of E. coli DsbA and E. coli DsbC.
  • the prokaryotic host cell is a gram-negative bacterium.
  • the gram-negative bacterium is E. coli.
  • the E. coli is of a strain deficient in endogenous protease activity.
  • the E. coli is a strain with a degpS210A mutation.
  • the E. coli is a strain with a genotype of W3110 AfliuA AphoA ilvG2096
  • the polypeptide is heterologous to the host cell.
  • the polypeptide is a monomer of a heterodimer (e.g., bi-specific antibody).
  • the two chains of the polypeptide are linked to each other by at least one disulfide bond.
  • the two chains of the polypeptide are linked to each other by a polypeptide linker.
  • the polypeptide is a monovalent antibody in which the first chain and the second chain comprise an immunoglobulin heavy chain and an
  • the immunoglobulin heavy chain is an
  • the monovalent antibody is capable of specifically binding an antigen.
  • the antigen is a cytokine.
  • the cytokine is selected from the group consisting of a chemokine, an interferon, an interleukin, a lymphokine, and tumour necrosis factor.
  • the growth factor is a vascular endothelial growth factor.
  • the antigen is selected from the group consisting of IL-4, IL13, IL-14, IL-17, VEGFA and VEGFC.
  • the polypeptide is a secretory protein.
  • the secretory protein is recovered from the periplasm of the host cell.
  • the antibody is recovered from the periplasm of the host cell.
  • the growth temperature is in the range of about 30°C to about 34°C during the growth phase, and the production temperature in the range of about 25°C to about 29°C during the production phase.
  • the growth agitation rate is in the range of about 600 to 800 rpm during the growth phase, and the production agitation rate is in the range of about 300 to about 500 rpm during the production phase. In some embodiments, the growth agitation rate is sufficient to achieve an oxygen uptake rate in the host cell during the growth phase of from 0.5 to 2.5 mmol/L/min above a peak oxygen uptake rate in the host cell during the production phase. In some embodiments, the peak oxygen uptake rate of the host cell during the growth phase is in the range of 3.5 to 4.5 mmol/L/min, and the oxygen uptake rate of the host cell during the production phase is in the range of 1.0 to 3.0 mmol/L/min. In some embodiments, the growth agitation rate is from about 10% to about 40% higher than the production agitation rate.
  • a half antibody comprising a heavy chain and a light chain in a prokaryotic host cell, the method comprising:
  • first translational unit encoding the heavy chain of the half antibody
  • second translational unit encoding the light chain of the half antibody
  • third translational unit encoding a first chaperone protein
  • fourth translational unit encoding a second chaperone protein
  • fifth translational unit encoding a third chaperone protein
  • the first, second and third chaperone proteins are selected from the group consisting of peptidyl-prolyl isomerases, protein disulfide oxidoreductases, and combinations thereof; wherein the growth temperature is from 2 to 10°C above the production temperature, and the growth agitation rate is from 50 to 250 rpm above the production agitation rate; and(b) recovering the half antibody from the host cell.
  • the half antibody comprises at least one hole-forming mutation or at least one knob-forming mutation.
  • methods of producing an anti-IL13 half antibody comprising a heavy chain and a light chain in a prokaryotic host cell comprising: (a) culturing the host cell to express the heavy chain and the light chain in a culture medium under conditions comprising: a growth phase comprising a growth temperature and a growth agitation rate, and a production phase comprising a production temperature and a production agitation rate, wherein (i) the heavy chain comprises a heavy chain variable domain comprising an HVR-Hl of SEQ ID NO:9, an HVR-H2 of SEQ ID NO: 10, and an HVR-H3 of SEQ ID NO:l l; and (ii) the light chain comprises a light chain variable domain comprising an HVR-L1 of SEQ ID
  • the host cell comprises a polynucleotide comprising: (1) a first translational unit encoding the heavy chain of the half antibody; (2) a second translational unit encoding the light chain of the half antibody; (3) a third translational unit encoding a first chaperone protein; (4) a fourth translational unit encoding a second chaperone protein; and (5) a fifth translational unit encoding a third chaperone protein, wherein the first, second and third chaperone proteins are selected from the group consisting of peptidyl-prolyl isomerases, protein disulfide oxidoreductases, and combinations thereof; wherein the growth temperature is from 2 to 10°C above the production temperature, and the growth agitation rate is from 50 to 250 rpm above the production agitation
  • the heavy chain comprises a heavy chain variable domain comprising an HVR-H1 of SEQ ID NO:20, an HVR-H2 of SEQ ID NO:21, and an HVR-H3 of SEQ ID NO:22; and
  • the light chain comprises a light chain variable domain comprising an HVR-L1 of SEQ ID NO:23, an HVR-L2 of SEQ ID NO:24, and an HVR-L3 of SEQ ID NO:25, whereby upon expression the heavy chain and the light chain assemble to form an anti-IL17 half antibody in the host cell; wherein the host cell comprises a
  • polynucleotide comprising: (1) a first translational unit encoding the heavy chain of the half antibody; (2) a second translational unit encoding the light chain of the half antibody; (3) a third translational unit encoding a first chaperone protein; (4) a fourth translational unit encoding a second chaperone protein; and (5) a fifth translational unit encoding a third chaperone protein, wherein the first, second and third chaperone proteins are selected from the group consisting of peptidyl-prolyl isomerases, protein disulfide oxidoreductases, and combinations thereof; wherein the growth temperature is from 2 to 10°C above the production temperature, and the growth agitation rate is from 50 to 250 rpm above the production agitation rate; and (b) recovering the anti-IL17 half antibody from the host cell.
  • the anti-IL17 half antibody comprises at least one hole-forming mutation.
  • the polynucleotide further comprises three copies of a promoter, wherein a first copy is in operable combination with the first translational unit, a second copy is in operable combination with the second translational unit, and a third copy is in operable combination with the third translational unit to drive transcription of the heavy chain, the light chain and the chaperone protein.
  • the promoter is an inducible promoter.
  • the inducible promoter is an IPTG-inducible promoter that drives transcription of the heavy chain, the light chain and the chaperone protein in the absence of IPTG induction.
  • the inducible promoter is a pho promoter that drives transcription of the heavy chain, the light chain and the chaperone protein when phosphate in the culture medium has been depleted.
  • the promoter is an inducible promoter.
  • the inducible promoter is an IPTG-inducible promoter that drives transcription of the heavy chain, the light chain and the chaperone
  • the polynucleotide further comprises a selectable marker and the culture medium comprises a selection agent consisting of a single antibiotic to cause the host cell to retain the monovalent antibody.
  • the first translational unit comprises a first translation initiation region (TIR) in operable combination with a coding region of the heavy chain variable domain
  • the second translational unit comprises a second translation initiation region (TIR) in operable combination with a coding region of the light chain variable domain, wherein the relative translation strength of the first and second TIR is from about 1.0 to about
  • the at least one chaperone protein, or the first chaperone protein comprises a peptidyl-prolyl isomerase.
  • the peptidyl-prolyl isomerase is an FkpA protein.
  • the FkpA is E. coli FkpA.
  • the at least one chaperone protein further comprises or one or both of the second chaperone protein and the third chaperone protein comprises a protein disulfide oxidoreductase.
  • the protein disulfide oxidoreductase is one or both of a DsbA protein and a
  • the at least one protein disulfide oxidoreductase is one or both of E. coli DsbA and E. coli DsbC.
  • the prokaryotic host cell is a gram- negative bacterium.
  • the gram- negative bacterium is E. coli.
  • the E. coli is of a strain deficient in endogenous protease activity.
  • the E. coli is a strain with a degpS210A mutation.
  • the E. coli is a strain with a genotype of W3110 AfhuA AphoA ilvG2096 (Val r J Aprc spr43Hl
  • the growth temperature is in the range of about 30°C to about 34°C during the growth phase, and the production temperature in the range of about 25°C to about 29°C during the production phase.
  • the growth agitation rate is sufficient to achieve an oxygen uptake rate in the host cell during the growth phase of from 0.5 to 2.5 mmol/L/min above a peak oxygen uptake rate in the host cell during the production phase.
  • the peak oxygen uptake rate of the host cell during the growth phase is in the range of 3.5 to 4.5 mmol/L/min
  • the oxygen uptake rate of the host cell during the production phase is in the range of 1.0 to 3.0 mmol/L/min.
  • the growth agitation rate is from about 10% to about 40% higher than the production agitation rate.
  • the first half antigen and the second half antigen are different antigens.
  • the first half antibody is capable of binding IL-13.
  • the second half antibody is capable of binding IL-17.
  • the method further comprises the step of adding a reducing agent to achieve the reducing condition.
  • the reducing agent is glutathione.
  • methods of producing a bispecific antibody comprising a first half antibody capable of binding IL13 and a second half antibody capable of binding IL17, the method comprising: (a) culturing a first prokaryotic host cell to express a first heavy chain and a first light chain of the first half antibody, wherein (i) the first heavy chain comprises a first heavy chain variable domain comprising an HVR-Hl of SEQ ID NO:9, an HVR-H2 of SEQ ID NO: 10, and an HVR-H3 of
  • the first light chain comprises a first light chain variable domain comprising an HVR-L1 of SEQ ID NO: 12, an HVR-L2 of SEQ ID NO: 13, and an HVR-L3 of SEQ ID NO: 14, whereby upon expression the first heavy chain and the first light chain assemble to form the first half antibody in the host cell; and (a') culturing a second prokaryotic host cell to express a second heavy chain and a second light chain of the second half antibody, wherein (i) the second heavy chain comprises a second heavy chain variable domain comprising an HVR-Hl of SEQ ID NO:20, an HVR-H2 of SEQ ID NO:21, and an
  • the second light chain comprises a second light chain variable domain comprising an HVR-L1 of SEQ ID NO:23, an HVR-L2 of SEQ ID NO:24, and an HVR-L3 of SEQ ID NO:25, whereby upon expression the second heavy chain and the second light chain assemble to form the second half antibody in the host cell;
  • the first host cell comprises a first polynucleotide comprising: (1) a first translational unit encoding the first heavy chain; (2) a second translational unit encoding the first light chain; and the second host cell comprises a second polynucleotide comprising: ( ) a third translational unit encoding the second heavy chain; (2') a fourth translational unit encoding the second light chain; wherein both the first polynucleotide and the second polynucleotide further comprise: (3) a fifth translational unit encoding a first chaperone protein; (4) a sixth translational unit
  • the method further comprises the step of adding a reducing agent to achieve the reducing condition.
  • the reducing agent is glutathione.
  • a composition comprising the bi-specific antibody of any one of the preceding embodiments.
  • the heavy chain variable domain of the anti-IL13 half antibody comprises the amino acid sequence of SEQ ID NO:7 and the light chain variable domain of the anti-IL13 antibody comprises the amino acid sequence of SEQ ID NO: 8.
  • the heavy chain of the anti-IL13 half antibody comprises the amino acid sequence of SEQ ID NO: 15 or SEQ ID NO: 16.
  • the light chain of the anti-IL13 half antibody comprises the amino acid sequence of SEQ ID NO: 17.
  • the heavy chain variable domain of the anti-IL17 half antibody comprises the amino acid sequence of SEQ ID NO: 18 and the light chain variable domain of the anti-IL17 half antibody comprises the amino acid sequence of SEQ ID NO: 19.
  • the heavy chain of the anti IL17 half antibody comprises the amino acid sequence of SEQ ID NO:26 or SEQ ID NO:27.
  • the light chain of the anti-IL17 half antibody comprises the amino acid sequence of SEQ ID NO:28.
  • FIG. 1A-C shows the production of total light chain (LC) and heavy chain (HC) subunits from the xIL13 half-antibody (hAb) production vector.
  • FIG. 1A provides a graph of total subunits for LCs and HCs produced from TIR1,1 (black bars) and TIR2,2 (striped bars) production vectors, as measured by RP-HPLC.
  • FIG. IB provides a graph of total subunits produced for LC and HC (black bars) or soluble LC and HC (gray bars) from the TIR1,1 production vectors.
  • FIG. 1C provides a graph of total subunits produced for total LC and HC (black bars) or soluble LC and HC (gray bars) from the TIR2,2 production vectors.
  • FIG. 2 shows the titer of the xIL13 hAb using TIR1,1 (black bar) or TIR2,2 (striped bar) hAb production vectors as measured by dual column RP-HPLC.
  • FIG. 3A-B illustrates the folding and assembly of proteins in bacterial host cells.
  • FIG. 3A is a schematic depicting bacterial protein production, illustrating the folding and assembly of proteins in the periplasm using chaperones.
  • FIG. 3B is a list of chaperone proteins, including peptidyl-prolyl isomerases ("Ppiases”), oxidoreducatases, and other chaperones.
  • Ppiases peptidyl-prolyl isomerases
  • oxidoreducatases oxidoreducatases
  • FIG. 4A shows the compatible system used to screen FkpA variants.
  • FIG. 4B shows the generation of a single xIL13 plasmid (pxIL13.2.2.FkpAcl3) encoding an antibody LC, HC, and FkpA.
  • FIG. 5A-B shows the production of the xVEGF IgGl hAb upon titration of FkpA expression.
  • FIG. 5A depicts a Western blot showing hAb and soluble monomeric heavy chain accumulation upon expression of different levels of FkpA, while a Coomassie-stained gel shows total soluble protein production under each condition.
  • FIG. 5B A graph shows the titer of hAb produced upon expression of different levels of FkpA.
  • FIG. 6A-B shows the production of the xIL13 IgG4 hAb upon expression of different levels of FkpA.
  • FIG. 6A provides a graph showing the titer of the xIL13 hAb produced using different vector systems, and is accompanied by a Western blot showing hAb and soluble monomeric heavy chain accumulation in each condition.
  • FIG. 6B provides a graph showing the amount of FkpA produced using different vector systems, and is accompanied by a Western blot showing expression of FkpA in each condition.
  • endogenous FkpA levels refers to bacterial host cells that do not contain a plasmid encoding FkpA;
  • compatible FkpA levels refers to expression of xIL13 and FkpA from separate (compatible) plasmids; and
  • single FkpA levels refers to a single vector expressing both xIL13 and FkpA.
  • FIG. 7A-B shows the production of the xIL4 IgG4 hAb upon inducible expression of FkpA.
  • FIG. 7A depicts a Western blot showing hAb and soluble monomeric heavy chain accumulation.
  • FIG. 7B provides a graph showing the titer of the xIL4 hAb produced using inducible expression of FkpA, and is accompanied by a Western blot showing expression of FkpA.
  • sample 1 uses a TIR1,1 vector for the production of the xIL4 hAb and does not overexpress FkpA
  • sample 2 uses a TIR2,2 vector for the production of the xIL4 hAb and does not overexpress FkpA
  • sample 3 uses TIR1,1 to produce the xIL4 hAb and IPTG to induce FkpA expression
  • sample 4 uses TIR2,2 to produce the xIL4 hAb and IPTG to induce FkpA expression.
  • FIG. 8A-C shows the production of the xVEGFC IgGl hAb upon expression of FkpA.
  • FIG. 8A provides a graph showing the titer of the xVEGFC hAb produced using different vector systems.
  • FIG. 8B depicts a gel showing total soluble protein production under both conditions, with FkpA bands as labeled.
  • FIG. 8C depicts a Western blot showing accumulation of the xVEGFC hAb and soluble monomeric heavy chain.
  • sample 1 uses a TIR2,2 vector for the production of the xVEGFC hAb and does not contain a plasmid for expression of FkpA; sample 2 uses a TIR2,2 vector for the production of the xIL4 hAb and IPTG to induce FkpA expression.
  • FIG. 9 shows the compatible plasmid system employing the a first plasmid for expression of the xIL13 hAb (pxIL13.2.2.FkpAcl3) and a second plasmid for expression of DsbA and DsbC (pJJ247).
  • FIG. 10 provides a graph showing the production of the xIL13 hAb over time using the xIL13.2.2.FkpAcl3 production plasmid and a compatible plasmid for expression of DsbA and DsbC, with and without IPTG induction.
  • FIG. 11A shows the xIL14 hAb compatible plasmid system.
  • FIG. 11B shows the generation of a single plasmid encoding the xIL14 hAb LC and HC, FkpA, DsbA, and DsbC.
  • FIG. 12A-B shows the production of the xIL4 hAb with the TIR1 , 1 or TIR2,2 vector in the absence of FkpA, DsbA, and DsbC expression (1 and 2, as labeled); in the presence of IPTG-induced FkpA expression (3 and 4, as labeled); and in the presence of a plasmid with FkpA, DsbA, and DsbC in the absence of IPTG (5 and 6, as labeled).
  • FIG. 12A depicts a Western blot showing accumulation of the xIL4 hAb and soluble monomeric heavy chain under various conditions.
  • FIG. 12B provides a graph showing the titer of the xIL4 hAb produced under various conditions, and is accompanied by a Western blot showing expression of FkpA.
  • FIG. 13 shows the production of the xVEGFC hAb with a TIR2,2 vector in the absence of FkpA, DsbA, and DsbC expression (column 1); in the presence of IPTG-induced FkpA expression (column 2); and in the presence of a plasmid with FkpA, DsbA, and DsbC in the absence of IPTG (column 3).
  • FIG. 14 shows the production of the xVEGFA IgGl hAb with a TIR1 , 1 or TIR2,2 vector in the absence of FkpA, DsbA, and DsbC expression (1 and 3, as labeled); and in the presence of a plasmid with FkpA, DsbA, and DsbC in the absence of IPTG (2 and 4, as labeled).
  • FIG. 15 shows the production of the xIL4 hAb with a TIR2,2 vector when FkpA, DsbA, and DsbC are expressed from the same vector ("Single") and when FkpA, DsbA and DsbC are expressed from a second compatible vector (“Compatible”), along with a negative control without the antibody expression vector and without DsbA, DsbC, and FkpA overexpression ("Control").
  • a Western blot shows expression of DsbA, DsbC, and FkpA.
  • FIG. 16A shows the xIL13 compatible plasmid system utilizing the previously described pxIL13.2.2.FkpAcl3 production plasmid and compatible oxidoreductase plasmid (pJJ247).
  • FIG. 16B shows the generation of a single plasmid (MD157) incorporating the open reading frames (ORFs) from pxIL13.2.2.FkpAcl3 and pJJ247.
  • FIG. 17 shows the production over time of the xIL13 hAb with the TIR2,2 vector when FkpA, DsbA, and DsbC are expressed from the same vector ("Single") and when DsbA and DsbC are expressed from a compatible vector and FkpA is expressed from the xIL13.2.2.FkpAcl3 vector ("Compatible").
  • These vectors use a phoA promoter to drive FkpA expression.
  • FIG. 18 shows the average oxygen uptake rate (OUR) over time in cultures grown under fixed agitation rate of cells bearing two vectors: a TIR2,2 vector expressing the xIL13 hAb and FkpA, and a vector expressing DsbA and DsbC under an IPTG-inducible promoter. OUR is shown for cultures grown in the presence or absence of IPTG. Number of samples used for each condition is provided ("N").
  • FIG. 19 shows the average osmolality in cultures grown under fixed agitation rate of cells bearing two vectors: a TIR2,2 vector expressing the xIL13 hAb and FkpA, and a vector expressing DsbA and DsbC under an IPTG-inducible promoter. Osmolality is shown for cultures grown in the presence or absence of IPTG. Number of samples used for each condition is provided ("N"). [0030] FIG.
  • FIG. 20 shows the average titer of the xIL13 hAb produced over time from cells bearing two vectors: a TIR2,2 vector expressing the xIL13 hAb and FkpA, and a vector expressing DsbA and DsbC under an IPTG-inducible promoter. Titer of antibody produced is shown for cultures grown in the presence or absence of IPTG. Number of samples used for each condition is provided ("N").
  • FIG. 21 shows the average OUR over time in cultures grown under agitation at 650 rpm for 26 hours, then shifted to a lower agitation rate sufficient to achieve the labeled OUR set point.
  • Cells bore two vectors: a TIR2,2 vector expressing the xIL13 hAb and FkpA, and a vector expressing DsbA and DsbC in the absence of IPTG. Number of samples used for each condition is provided ("N").
  • FIG. 22 shows the average osmolality over time in cultures grown under agitation at 650 rpm for 26 hours, then shifted to a lower agitation rate sufficient to achieve the labeled OUR set point.
  • Cells bore two vectors: a TIR2,2 vector expressing the xIL13 hAb and FkpA, and a vector expressing in the absence of IPTG. Number of samples used for each condition is provided ("N").
  • FIG. 23 shows the average titer of the xIL13 hAb production at two time points (54 and 72 hours) in cultures grown under agitation at 650 rpm for 26 hours, then shifted to a lower agitation rate sufficient to achieve the labeled OUR set point.
  • Cells bore two vectors: a TIR2,2 vector expressing the xIL13 hAb and FkpA, and a vector expressing DsbA and DsbC in the absence of IPTG. Number of samples used for each condition is provided ("N").
  • FIG. 24 shows the average cell density (ODsso nm ) over time of cultures producing the xIL13 hAb from a TIR2,2 vector that also encoded FkpA driven by a phoA promoter and DsbA and DsbC driven by a tacll promoter in the absence of IPTG.
  • Cultures were grown at a constant temperature for both growth and production (Tg/Tp) phases of either 28°C or 30°C. An agitation shift was performed 26 hours into the fermentation. Number of samples used for each condition is provided ("N").
  • FIG. 25 shows the average OUR over time of cultures of cells producing the xIL13 hAb from a TIR2,2 vector that also encoded FkpA driven by a phoA promoter and DsbA and DsbC driven by a tacll promoter in the absence of IPTG. Cultures were grown at a constant temperature for both growth and production (Tg/Tp) phases of either 28°C or 30°C. Number of samples used for each condition is provided ("N").
  • FIG. 26 shows the average phosphate concentration over time in cultures of cells producing the xIL13 hAb from a TIR2,2 vector that also encoded FkpA driven by a phoA promoter and DsbA and DsbC driven by a tacll promoter in the absence of IPTG. Cultures were grown at a constant temperature for both growth and production (Tg/Tp) phases of either 28°C or 30°C. Number of samples used for each condition is provided ("N").
  • FIG. 27 shows the average titer of the xIL13 hAb produced in cultures of cells from a TIR2,2 vector that also encoded FkpA driven by a phoA promoter and DsbA and DsbC driven by a tacll promoter in the absence of IPTG. Cultures were grown at a constant temperature for both growth and production (Tg/Tp) phases of either 28°C or 30°C.
  • FIG. 28 shows the average cell density (ODsso nm ) over time of cultures producing the xIL13 hAb from a TIR2,2 vector that also encoded FkpA driven by a phoA promoter and DsbA and DsbC driven by a tacll promoter in the absence of IPTG.
  • Cultures were grown at a constant temperature of 28°C or 30°C (Tg/Tp 28°C or Tg/Tp 30°C, respectively), or grown at 30°C during the growth phase, then shifted to 28°C for the production phase (Tg 30 Tp 28). Number of samples used for each condition is provided ("N").
  • FIG. 29 shows the average phosphate concentration over time in cultures of cells producing the xIL13 hAb from a TIR2,2 vector that also encoded FkpA driven by a phoA promoter and DsbA and DsbC driven by a tacll promoter in the absence of IPTG.
  • Cultures were grown at a constant temperature of 28°C or 30°C (Tg/Tp 28°C or Tg/Tp 30°C, respectively), or grown at 30°C during the growth phase, then shifted to 28°C for the production phase (Tg 30 Tp). Number of samples used for each condition is provided ("N").
  • FIG. 30 shows the OUR over time of cultures of cells producing the xIL13 hAb from a TIR2,2 vector that also encoded FkpA driven by a phoA promoter and DsbA and DsbC driven by a tacll promoter in the absence of IPTG. Cultures were grown at a constant temperature of 28°C or 30°C (Tg/Tp 28°C or Tg/Tp 30°C, respectively), or grown at 30°C during the growth phase, then shifted to 28°C for the production phase (Tg 30 Tp 28).
  • FIG. 31 shows the average titer of xIL13 hAb produced over time from a TIR2,2 vector that also encoded FkpA driven by a phoA promoter and DsbA and DsbC driven by a tacll promoter in the absence of IPTG. Cultures were grown at a constant temperature of 28°C or 30°C, as labeled (Tg/Tp 28°C or Tg/Tp 30°C, respectively), or grown at 30°C during the growth phase, then shifted to 28°C for the production phase (Tg 30 Tp 28).
  • FIG. 32 shows the results of a partial factorial design of experiment (DoE) analysis of the xIL13 hAb titer with a single plasmid (MD157) under different process conditions identified by the pattern in the accompanying table.
  • DoE partial factorial design of experiment
  • FIG. 33 shows the titer of xIL4 hAb produced from a TIR2,2 vector that also encoded FkpA, DsbA and DsbC driven by a tacll promoter in the absence of IPTG. Cultures were grown at a constant temperature of 30°C (Tg/Tp 30°C), or grown at 34°C during the growth phase, then shifted to 25°C for the production phase (Tg 34 Tp 25).
  • FIG. 34 shows the results of a partial factorial design of experiment (DoE) analysis of the xIL17 hAb titer with a single plasmid (MD341) under different process conditions identified by the pattern in the accompanying table.
  • DoE partial factorial design of experiment
  • FIG. 35 shows the effects of first optimizing chaperone protein co-expression and then optimizing the process steps (e.g., agitation rate, Tg, and Tp) on xIL13 hAb titer.
  • FIG. 36A shows the soluble xIL13 hAb titer from fermentations performed in the 66F8 and 67 A6 host strains.
  • FIG. 37A shows the soluble xIL4 hAb titer from fermentations performed in the 66F8 and 67 A6 host strains at a constant fermentation temperature.
  • FIG. 38A shows the xIL4 light chain titer and FIG. 38B shows the xIL4 heavy chain titer from fermentations performed in the 66F8 and 67 A6 host strains under
  • FIG. 39 provides a map of the xIL33 hAb secretion plasmid. LC and HC open reading frames were independently placed in operable combination with TIR2.
  • FIG. 40 illustrates accumulation of xIL33 hAb in fermentations performed in the absence of co-expression of the chaperones DsbA, DsbC, FkpA at a constant temperature of 30°C (base case), and in fermentations performed in the presence of the chaperones DsbA, DsbC and FkpA co-expression under the same process conditions (w/ Chaperones).
  • FIG. 41 shows the aIL33 hAb titer differences from the Design of Experiment (DoE) performed with the xIL33 hAb single plasmid containing the chaperones FkpA, DsbA, DsbC.
  • DoE factors included pH, growth temperature (Tg), production temperature (Tp), and production phase target oxygen uptake rate (OUR).
  • FIG. 42 provides the nucleotide sequence of the TIR1 (SEQ ID NO:42), TIR2 (SEQ ID NO:43) and TIR3 (SEQ ID NO:44) FkpA signal sequence variants. Single nucleotide substitutions were made in the third position of specific codons and represent synonymous codon changes that do not alter the amino acid sequence of the FkpA signal peptide sequence (SEQ ID NO:45).
  • FIG. 43 shows the quantitative strength of the FkpA TIR variants relative to the TIRl FkpA variant (plasmid 19).
  • FIG. 44 shows the accumulation of the xIL13 hAb in fermentations performed with the TIRl, TIR2 and TIR3 FkpA TIR variants. The titer produced in each condition was 1.5, 2.5 and 4.0 g/L for the TIRl, TIR2 and TIR3 variants, respectively.
  • FIG. 45 shows the accumulation of the xIL33 hAb in fermentations performed with the TIRl, TIR2 and TIR3 FkpA TIR variants.
  • FIG. 46 shows a plot of the accumulation of the xIL17 hAb in fermentations performed with the TIRl, TIR2 and TIR3 FkpA variants.
  • FIG. 47A shows a plot of the accumulation of the xIL13 hAb in fermentations performed with FkpA TIR variants.
  • FIG. 47B shows the level of FkpA present in the soluble fraction from the xIL13 hAb process at the end of the fermentation.
  • FIG. 48A shows the oxygen uptake rates (OUR) for the altered oxygen transfer rate (OTR) and control fermentation conditions.
  • the altered OTR and control fermentations achieved a similar peak OUR of about 5 mmol/L/min and similar post agitation shift target OUR of 2.75 mmol/L/min.
  • FIG. 48B shows the growth profiles for the altered OTR and control fermentation conditions.
  • the altered OTR and control fermentations had similar growth profiles and both achieved peak an OD 550 of 250.
  • xIL13 hAb control (Ctrl) best condition 1 bar back pressure (BP), 20 standard liters per minute (SLPM), and an agitation rate shift of 650 to 475 rpm.
  • the xIL13 hAb altered OTR condition 0.3 bar back pressure, 13 SLPM, and an agitation rate shift of 880 to 650 rpm.
  • FIG. 49 shows the xIL13 hAb accumulation profiles for the altered OTR and control conditions.
  • the altered and control conditions had similar accumulation profiles during fermentation and both achieved maximum average titers at 72 hours of 4.1 and 4.2 g/L, respectively.
  • the examples provided herein demonstrate that co-expression of one or more specific chaperone proteins in combination with translational units encoding each chain of a multiple chain protein (e.g., light chain and heavy chain of a half-antibody) increases the production of an assembled multiple chain protein in a prokaryotic host cell system.
  • the examples further demonstrate that subsequent process improvements, such as specific temperatures and agitation rates for certain phases of the fermentation, result in significant enhancements in production and robustness beyond the expression vector improvements.
  • exemplary two chain polypeptides e.g., half antibody.
  • methods of producing a polypeptide containing two chains in a prokaryotic host cell by culturing the host cell to express the two chains of the polypeptide, where upon expression the two chains fold and assemble to form a biologically active polypeptide in the host cell; where the host cell contains a polynucleotide including (1) a first translational unit encoding a first chain of the polypeptide; (2) a second
  • the translational unit encoding a second chain of the polypeptide; and (3) a third translational unit encoding at least one chaperone protein selected from peptidyl-prolyl isomerases, protein disulfide oxidoreductases, and combinations thereof; where the host cell is cultured in a culture medium under conditions including: a growth phase including a growth temperature and a growth agitation rate, and a production phase including a production temperature and a production agitation rate, where the growth temperature is from 2 to 10°C above the production temperature, and the growth agitation rate is from 50 to 250 rpm above the production agitation rate; and (b) recovering the biologically active polypeptide from the host cell.
  • the polypeptide consists of two chains, while in another aspect the polypeptide comprises three, four, five or more chains.
  • a polypeptide containing two chains in a prokaryotic host cell by culturing the host cell to express the two chains of the polypeptide, where upon expression the two chains fold and assemble to form a biologically active polypeptide in the host cell; where the host cell contains a polynucleotide including (1) a first translational unit encoding a first chain of the polypeptide; (2) a second translational unit encoding a second chain of the polypeptide; (3) a third translational unit encoding a first chaperone protein; (4) a fourth translational unit encoding a second chaperone protein; and (5) a fifth translational unit encoding a third chaperone protein, where the first, second, and third chaperone proteins are selected from peptidyl-prolyl isomerases, protein disulfide oxidoreductases, and combinations thereof; where the host cell is cultured in a culture medium under conditions including: a growth phase including
  • polypeptide comprising two chains is intended to refer to any polypeptide containing more than one distinct polypeptide chain.
  • a two chain protein may include a macromolecular complex of two or more polypeptides linked together through one or more intermolecular linkages, including without limitation a disulfide bond.
  • a two chain protein may include a single polypeptide with amino acid sequences belonging to two distinct polypeptide chains (e.g., an antibody heavy chain and an antibody light chain) linked by a polypeptide linker.
  • a two chain protein may physically represent a single chain, but two or more portions of the single chain may functionally behave as if they are two separate protein chains.
  • a single chain antibody may include a functional heavy chain and a functional light chain that, while joined by a polypeptide linker, nonetheless fold and assemble as if they were separate polypeptides associated only by intermolecular linkages (e.g., one or more disulfide bonds).
  • vector is intended to refer to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
  • plasmid refers to a circular double stranded DNA loop into which additional DNA segments may be ligated.
  • phage vector Another type of vector.
  • viral vector Another type of vector is a viral vector, wherein additional DNA segments may be ligated into the viral genome.
  • vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors).
  • Other vectors e.g., non-episomal mammalian vectors
  • certain vectors are capable of directing the expression of genes to which they are operatively linked. Such vectors are referred to herein as
  • recombinant expression vectors (or simply, “recombinant vectors”).
  • expression vectors of utility in recombinant DNA techniques are often in the form of plasmids.
  • plasmid and “vector” may be used interchangeably as the plasmid is the most commonly used form of vector.
  • cistron is intended to refer to a genetic element broadly equivalent to a translational unit comprising the nucleotide sequence coding for a polypeptide chain and adjacent control regions.
  • a “cistron” may include, for example, one or more open- reading frames, a translational initiation region (TIR; as defined herein below), a signal sequence and a termination region.
  • TIR translational initiation region
  • a "polycistronic" expression vector refers to a single vector that contains and expresses multiple cistrons under the regulatory control of one single promoter.
  • a common example of polycistronic vector is a "dicistronic" vector that contains and expresses two different polypeptides under the control of one promoter.
  • a “transcriptional unit” refers to a polynucleotide that is transcribed as a single RNA transcript.
  • a “translational unit” refers to a polynucleotide that encodes and, when translated, produces a polypeptide. As described above, a polycistronic polynucleotide may contain a single transcriptional unit with multiple translational units.
  • a "separate cistron" expression vector refers to a single vector comprising at least two separate promoter-cistron pairs, wherein each cistron is under the control of its own promoter. Upon expression of a separate cistron expression vector, both transcription and translation processes of different genes are separate and independent.
  • a "chaperone protein” as used herein refers to any protein that aids in the folding or assembly of other macromolecules, including without limitation two chain proteins.
  • chaperone proteins may act by many different mechanisms to promote protein folding or assembly.
  • chaperone proteins may promote protein folding and/or assembly, catalyze the formation of intrachain disulfide bonds, promote protein un-folding and/or disassembly (e.g., of aggregated or misfolded proteins or multiprotein complexes), prevent aggregation, aid in protein degradation, and so forth.
  • the "translation initiation region” or TIR or translational initiation region or translational initiation sequence refers to a nucleic acid region providing the efficiency of translational initiation of a gene of interest.
  • a TIR within a particular cistron encompasses the ribosome binding site (RBS) and sequences 5' and 3' to RBS.
  • the RBS is defined to contain, minimally, the Shine-Dalgarno region and the start codon (AUG). Accordingly, a TIR also includes at least a portion of the nucleic acid sequence to be translated.
  • a TIR of the disclosure includes a secretion signal sequence encoding a signal peptide that precedes the sequence encoding for the light or heavy chain within a cistron.
  • a TIR variant contains sequence variants (particularly substitutions) within the TIR region that alter the property of the TIR, such as its translational strength as defined herein below.
  • a TIR variant of the disclosure contains sequence substitutions within the first 2 to about 14, preferably about 4 to 12, more preferably about 6 codons of the secretion signal sequence that precedes the sequence encoding for the light or heavy chain within a cistron.
  • translational strength refers to a measurement of a secreted polypeptide in a control system wherein one or more variants of a TIR is used to direct secretion of a polypeptide and the results compared to the wild-type TIR or some other control under the same culture and assay conditions.
  • “translational strength” as used herein can include, for example and without limitation, a measure of mRNA stability, efficiency of ribosome binding to the ribosome binding site, and so forth.
  • “Secretion signal sequence” or “signal sequence” refers to a nucleic acid sequence encoding for a short signal peptide that can be used to direct a newly synthesized protein of interest through a cellular membrane, usually the inner membrane or both inner and outer membranes of prokaryotes.
  • the protein of interest such as the immunoglobulin light or heavy chain polypeptide is secreted into the periplasm of the prokaryotic host cells or into the culture medium.
  • the signal peptide encoded by the secretion signal sequence may be endogenous to the host cells, or they may be exogenous, including signal peptides native to the polypeptide to be expressed.
  • Secretion signal sequences are typically present at the amino terminus of a polypeptide to be expressed, and are typically removed enzymatically between biosynthesis and secretion of the polypeptide from the cytoplasm. Thus, the signal peptide is usually not present in a mature protein product.
  • operably linked refers to a juxtaposition of two or more components, wherein the components so described are in a relationship permitting them to function in their intended manner.
  • a promoter is operably linked to a coding sequence if it acts in cis to control or modulate the transcription of the linked sequence.
  • the DNA sequences that are "operably linked” are contiguous and, where necessary to join two protein coding regions or in the case of a secretory leader, contiguous and in the reading frame.
  • an operably linked promoter is generally located upstream of the coding sequence, it is not necessarily contiguous with it.
  • Operably linked enhancers can be located upstream, within or downstream of coding sequences and at considerable distances from the promoter. Linking is accomplished by recombinant methods known in the art, e.g., using PCR methodology, by annealing, or by ligation at convenient restriction sites. If convenient restriction sites do not exist, then synthetic oligonucleotide adaptors or linkers are used in accord with conventional practice.
  • transcriptional regulatory elements refer to nucleotide sequences present in cis, necessary for transcription and translation of a polynucleotide encoding a heterologous polypeptide into polypeptides.
  • the transcriptional regulatory elements normally comprise a promoter 5' of the gene sequence to be expressed, transcriptional initiation and termination sites, and polyadenylation signal sequence.
  • transcriptional initiation site refers to the nucleic acid in the construct corresponding to the first nucleic acid incorporated into the primary transcript, i.e., the mRNA precursor; the transcriptional initiation site may overlap with the promoter sequences.
  • a "promoter” refers to a polynucleotide sequence that controls transcription of a gene or sequence to which it is operably linked.
  • a promoter includes signals for RNA polymerase binding and transcription initiation. The promoters used will be functional in the cell type of the host cell in which expression of the selected sequence is contemplated.
  • a large number of promoters including constitutive, inducible and repressible promoters from a variety of different sources, are well known in the art (and identified in databases such as GenBank) and are available as or within cloned polynucleotides (from, e.g., depositories such as ATCC as well as other commercial or individual sources).
  • host cell (or "recombinant host cell”), as used herein, is intended to refer to a cell that has been genetically altered, or is capable of being genetically altered by introduction of an exogenous polynucleotide, such as a recombinant plasmid or vector. It should be understood that such terms are intended to refer not only to the particular subject cell but to the progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term "host cell” as used herein.
  • composition refers to a preparation which is in such form as to permit the biological activity of the active ingredient to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the formulation would be administered. Such formulations are sterile.
  • “Pharmaceutically acceptable” excipients are those which can reasonably be administered to a subject mammal to provide an effective dose of the active ingredient employed.
  • a "subject" or an “individual” for purposes of treatment refers to any animal classified as a mammal, including humans, domestic and farm animals, and zoo, sports, or pet animals, such as dogs, horses, cats, cows, etc.
  • the mammal is human.
  • antibody herein is used in the broadest sense and specifically covers monoclonal antibodies (including full length monoclonal antibodies), polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments so long as they exhibit the desired biological activity.
  • An "isolated" antibody is one which has been identified and separated and/or recovered from a component of its natural environment. Contaminant components of its natural environment are materials which would interfere with research, diagnostic or therapeutic uses for the antibody, and may include enzymes, hormones, and other materials.
  • an antibody is purified (1) to greater than 95% by weight of antibody as determined by, for example, the Lowry method, and in some embodiments, to greater than 99% by weight; (2) to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence by use of, for example, a spinning cup sequenator, or (3) to homogeneity by SDS-PAGE under reducing or
  • Isolated antibody includes the antibody in situ within recombinant cells since at least one component of the antibody's natural environment will not be present. Ordinarily, however, isolated antibody will be prepared by at least one purification step.
  • "Native antibodies” are usually heterotetrameric glycoproteins of about 150,000 daltons, composed of two identical light (L) chains and two identical heavy (H) chains. Each light chain is linked to a heavy chain by one covalent disulfide bond, while the number of disulfide linkages varies among the heavy chains of different immunoglobulin isotypes. Each heavy and light chain also has regularly spaced intrachain disulfide bridges.
  • Each heavy chain has at one end a variable domain (V R ) followed by a number of constant domains.
  • Each light chain has a variable domain at one end (V L ) and a constant domain at its other end; the constant domain of the light chain is aligned with the first constant domain of the heavy chain, and the light chain variable domain is aligned with the variable domain of the heavy chain.
  • Particular amino acid residues are believed to form an interface between the light chain and heavy chain variable domains.
  • constant domain refers to the portion of an immunoglobulin molecule having a more conserved amino acid sequence relative to the other portion of the
  • variable domain which contains the antigen binding site.
  • the constant domain contains the C H I, C H 2 and C H 3 domains (collectively, CH) of the heavy chain and the CHL (or CL) domain of the light chain.
  • variable region or “variable domain” of an antibody refers to the amino- terminal domains of the heavy or light chain of the antibody.
  • variable domain of the heavy chain may be referred to as "V H .”
  • variable domain of the light chain may be referred to as "V L .” These domains are generally the most variable parts of an antibody and contain the antigen-binding sites.
  • variable refers to the fact that certain portions of the variable domains differ extensively in sequence among antibodies and are used in the binding and specificity of each particular antibody for its particular antigen. However, the variability is not evenly distributed throughout the variable domains of antibodies. It is concentrated in three segments called hypervariable regions (HVRs) both in the light-chain and the heavy-chain variable domains. The more highly conserved portions of variable domains are called the framework regions (FR).
  • the variable domains of native heavy and light chains each comprise four FR regions, largely adopting a beta-sheet configuration, connected by three HVRs, which form loops connecting, and in some cases forming part of, the beta-sheet structure.
  • the HVRs in each chain are held together in close proximity by the FR regions and, with the HVRs from the other chain, contribute to the formation of the antigen-binding site of antibodies (see
  • the constant domains are not involved directly in the binding of an antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody-dependent cellular toxicity.
  • the "light chains" of antibodies (immunoglobulins) from any mammalian species can be assigned to one of two clearly distinct types, called kappa (" ⁇ ") and lambda (“ ⁇ "), based on the amino acid sequences of their constant domains.
  • IgG immunoglobulins defined by the chemical and antigenic characteristics of their constant regions.
  • antibodies can be assigned to different classes.
  • immunoglobulins There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), e.g., IgGi, IgG 2 , IgG 3 , IgG 4 , IgAi, and IgA 2 .
  • the heavy chain constant domains that correspond to the different classes of immunoglobulins are called ⁇ , ⁇ , ⁇ , ⁇ , and ⁇ , respectively.
  • An antibody may be part of a larger fusion molecule, formed by covalent or non-covalent association of the antibody with one or more other proteins or peptides.
  • full length antibody “intact antibody” and “whole antibody” are used herein interchangeably to refer to an antibody in its substantially intact form, not antibody fragments as defined below.
  • a "naked antibody” for the purposes herein is an antibody that is not conjugated to a cytotoxic moiety or radiolabel.
  • Antibody fragments comprise a portion of an intact antibody, preferably comprising the antigen binding region thereof.
  • the antibody fragment described herein is an antigen-binding fragment. Examples of antibody fragments include
  • Fab, Fab', F(ab') 2 , and Fv fragments diabodies; linear antibodies; single-chain antibody molecules; and multispecific antibodies formed from antibody fragments.
  • Papain digestion of antibodies produces two identical antigen-binding fragments, called “Fab” fragments, each with a single antigen-binding site, and a residual "Fc” fragment, whose name reflects its ability to crystallize readily. Pepsin treatment yields an F(ab') 2 fragment that has two antigen-combining sites and is still capable of cross-linking antigen.
  • Fv is the minimum antibody fragment which contains a complete antigen-binding site.
  • a two-chain Fv species consists of a dimer of one heavy- and one light-chain variable domain in tight, non-covalent association.
  • one heavy- and one light-chain variable domain can be covalently linked by a flexible peptide linker such that the light and heavy chains can associate in a "dimeric" structure analogous to that in a two-chain Fv species. It is in this configuration that the three HVRs of each variable domain interact to define an antigen-binding site on the surface of the VH-VL dimer. Collectively, the six HVRs confer antigen-binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three HVRs specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site.
  • the Fab fragment contains the heavy- and light-chain variable domains and also contains the constant domain of the light chain and the first constant domain (CHI) of the heavy chain.
  • Fab' fragments differ from Fab fragments by the addition of a few residues at the carboxy terminus of the heavy chain CHI domain including one or more cysteines from the antibody hinge region.
  • Fab'-SH is the designation herein for Fab' in which the cysteine residue(s) of the constant domains bear a free thiol group.
  • F(ab') 2 antibody fragments originally were produced as pairs of Fab' fragments which have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
  • Single-chain Fv or “scFv” antibody fragments comprise the VH and VL domains of antibody, wherein these domains are present in a single polypeptide chain.
  • the scFv polypeptide further comprises a polypeptide linker between the VH and VL domains which enables the scFv to form the desired structure for antigen binding.
  • diabodies refers to antibody fragments with two antigen-binding sites, which fragments comprise a heavy-chain variable domain (VH) connected to a light-chain variable domain (VL) in the same polypeptide chain (VH-VL).
  • VH heavy-chain variable domain
  • VL light-chain variable domain
  • linker that is too short to allow pairing between the two domains on the same chain, the domains are forced to pair with the complementary domains of another chain and create two antigen-binding sites.
  • Diabodies may be bivalent or bispecific. Diabodies are described more fully in, for example,
  • the term "monoclonal antibody” as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, e.g., the individual antibodies comprising the population are identical except for possible mutations, e.g., naturally occurring mutations, that may be present in minor amounts.
  • the modifier "monoclonal" indicates the character of the antibody as not being a mixture of discrete antibodies.
  • a monoclonal antibody typically includes an antibody comprising a polypeptide sequence that binds a target, wherein the target-binding polypeptide sequence was obtained by a process that includes the selection of a single target binding polypeptide sequence from a plurality of polypeptide sequences.
  • the selection process can be the selection of a unique clone from a plurality of clones, such as a pool of hybridoma clones, phage clones, or recombinant DNA clones.
  • a selected target binding sequence can be further altered, for example, to improve affinity for the target, to humanize the target binding sequence, to improve its production in cell culture, to reduce its immunogenicity in vivo, to create a multispecific antibody, etc., and that an antibody comprising the altered target binding sequence is also a monoclonal antibody of this disclosure.
  • an antibody comprising the altered target binding sequence is also a monoclonal antibody of this disclosure.
  • polyclonal antibody preparations typically include different antibodies directed against different determinants (epitopes)
  • each monoclonal antibody of a monoclonal antibody preparation is directed against a single determinant on an antigen.
  • monoclonal antibody preparations are advantageous in that they are typically uncontaminated by other immunoglobulins.
  • the modifier "monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
  • the monoclonal antibodies to be used in accordance with the disclosure may be made by a variety of techniques, including, for example, expression in a prokaryotic host cell, the hybridoma method (e.g., Kohler and Milstein, Nature, 256:495-97 (1975); Hongo et al, Hybridoma, 14
  • Hybridomas 563-681 (Elsevier, N.Y., 1981)
  • recombinant DNA methods see, e.g., U.S. Pat.
  • the monoclonal antibodies herein specifically include “chimeric” antibodies in which a portion of the heavy and/or light chain is identical with or homologous to
  • Chimeric antibodies include PRIMATTZED ® antibodies wherein the antigen-binding region of the antibody is derived from an antibody produced by, e.g., immunizing macaque monkeys with the antigen of interest.
  • Humanized forms of non-human (e.g., murine) antibodies are chimeric antibodies that contain minimal sequence derived from non-human immunoglobulin.
  • a humanized antibody is a human immunoglobulin (recipient antibody) in which residues from a HVR of the recipient are replaced by residues from a HVR of a non- human species (donor antibody) such as mouse, rat, rabbit, or nonhuman primate having the desired specificity, affinity, and/or capacity.
  • donor antibody such as mouse, rat, rabbit, or nonhuman primate having the desired specificity, affinity, and/or capacity.
  • FR residues of the human immunoglobulin are replaced by corresponding non-human residues.
  • humanized antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody.
  • a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin, and all or substantially all of the FRs are those of a human immunoglobulin sequence.
  • the humanized antibody optionally will also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
  • Fc immunoglobulin constant region
  • a "human antibody” is one which possesses an amino acid sequence which corresponds to that of an antibody produced by a human and/or has been made using any of the techniques for making human antibodies as disclosed herein. This definition of a human antibody specifically excludes a humanized antibody comprising non-human antigen-binding residues.
  • Human antibodies can be produced using various techniques known in the art, including phage-display libraries. Hoogenboom and Winter, J. Mol. Biol, 227:381 (1991); Marks et al, J. Mol. Biol, 222:581 (1991). Also available for the preparation of human monoclonal antibodies are methods described in Cole et al. , Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p.
  • Human antibodies can be prepared by administering the antigen to a transgenic animal that has been modified to produce such antibodies in response to antigenic challenge, but whose endogenous loci have been disabled, e.g., immunized xenomice (see, e.g., U.S. Pat. Nos. 6,075,181 and 6,150,584 regarding XENOMOUSETM technology). See also, for example, Li et al, Proc. Natl. Acad. Sci. USA, 103:3557-3562 (2006) regarding human antibodies generated via a human B-cell hybridoma technology.
  • a "species-dependent antibody” is one which has a stronger binding affinity for an antigen from a first mammalian species than it has for a homologue of that antigen from a second mammalian species.
  • the species-dependent antibody "binds specifically" to a human antigen (e.g., has a binding affinity (Kd) value of no more than about 1x10 " M, preferably no more than about 1x10 - " 8 M and preferably no more than about 1x10 - " 9 M) but has a binding affinity for a homologue of the antigen from a second nonhuman mammalian species which is at least about 50 fold, or at least about 500 fold, or at least about 1000 fold, weaker than its binding affinity for the human antigen.
  • the species-dependent antibody can be any of the various types of antibodies as defined above, but preferably is a humanized or human antibody.
  • hypervariable region when used herein refers to the regions of an antibody variable domain which are hypervariable in sequence and/or form structurally defined loops.
  • antibodies comprise six HVRs; three in the VH (HI, H2, H3), and three in the VL (LI, L2, L3).
  • H3 and L3 display the most diversity of the six HVRs, and H3 in particular is believed to play a unique role in conferring fine specificity to antibodies.
  • HVR delineations are in use and are encompassed herein.
  • the Kabat Complementarity Determining Regions are based on sequence variability and are the most commonly used (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)). Chothia refers instead to the location of the structural loops (Chothia and Lesk J. Mol. Biol. 196:901-917 (1987)).
  • the AbM HVRs represent a compromise between the Kabat HVRs and Chothia structural loops, and are used by Oxford Molecular's AbM antibody modeling software.
  • the "contact" HVRs are based on an analysis of the available complex crystal structures. The residues from each of these HVRs are noted below.
  • HVRs may comprise "extended HVRs” as follows: 24-36 or 24-34 (LI), 46-56 or 50-56 (L2) and 89-97 or 89-96 (L3) in the VL and 26-35 (HI), 50-65 or 49-65 (H2) and 93- 102, 94-102, or 95-102 (H3) in the VH.
  • the variable domain residues are numbered according to Kabat et al., supra, for each of these definitions.
  • variable domain residue numbering as in Kabat or "amino acid position numbering as in Kabat,” and variations thereof, refers to the numbering system used for heavy chain variable domains or light chain variable domains of the compilation of antibodies in Kabat et al., supra. Using this numbering system, the actual linear amino acid sequence may contain fewer or additional amino acids corresponding to a shortening of, or insertion into, a FR or HVR of the variable domain.
  • a heavy chain variable domain may include a single amino acid insert (residue 52a according to Kabat) after residue 52 of H2 and inserted residues (e.g. residues 82a, 82b, and 82c, etc. according to Kabat) after heavy chain FR residue 82.
  • the Kabat numbering of residues may be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a "standard" Kabat numbered sequence.
  • the Kabat numbering system is generally used when referring to a residue in the variable domain (approximately residues 1-107 of the light chain and residues 1-113 of the heavy chain) (e.g., Kabat et al., Sequences of Immunological Interest. 5th Ed. Public Health
  • linear antibodies refers to the antibodies described in Zapata et al. (1995 Protein Eng, 8(10):1057-1062). Briefly, these antibodies comprise a pair of tandem Fd segments (VH-CH1-VH-CH1) which, together with complementary light chain polypeptides, form a pair of antigen binding regions. Linear antibodies can be bispecific or monospecific.
  • a polypeptide containing two chains in a prokaryotic host cell by culturing the host cell to express the two chains of the polypeptide, where upon expression the two chains fold and assemble to form a biologically active polypeptide in the host cell; where the host cell contains a polynucleotide including
  • translational unit encoding a second chain of the polypeptide; and (3) a third translational unit encoding at least one chaperone protein selected from peptidyl-prolyl isomerases, protein disulfide oxidoreductases, and combinations thereof.
  • a host cell is cultured to express the two chains of a polypeptide, where upon expression the two chains fold and assemble to form a biologically active polypeptide in the host cell.
  • two chain folding and assembly may refer to any or all steps that promote the ultimate adoption of proper three-dimensional two chain protein conformation, two chain protein assembly, or both.
  • Folding and assembly may refer to the folding and assembly of each chain into its proper conformation and folding, or it may refer to the folding and assembly of the complex created by the intermolecular linkage of two protein chains.
  • each chain may fold and assemble to form a biologically active polypeptide, or the complex created by the intermolecular linkage of two protein chains may fold and assemble to form, as a whole, a biologically active polypeptide.
  • a biologically active polypeptide may refer to any polypeptide that is able to carry out a function ascribed to the polypeptide. Functions of biologically active polypeptides may include, without limitation, proper folding or assembly, binding or other interaction with another macromolecule, and enzymatic activity.
  • a biologically active antibody may refer to an antibody that is able to carry out at least one function ascribed to antibodies, including without limitation binding to an epitope or possessing a property of an antibody Fc region, as described in further detail below.
  • a polynucleotide of the present disclosure contains a translational unit encoding at least one chaperone protein.
  • a chaperone protein may refer to any protein that aids in the folding or assembly of other macromolecules, including without limitation two chain proteins.
  • chaperone proteins may include without limitation peptidyl-prolyl isomerases, protein disulfide oxidoreductases, and heat shock proteins (such as Hsp60, Hsp70, Hsp90, and HsplOO proteins). Chaperone proteins may also aid in transporting proteins across membranes, e.g., translocation of polypeptide chains across the plasma membrane or endoplasmic reticulum membrane.
  • a chaperone protein may be a peptidyl-prolyl isomerase.
  • Peptidyl-prolyl isomerase (the terms “prolyl isomerase,” “rotamase,” and “PPiase” may be used interchangeably herein) may refer to any enzyme catalyzing the interconversion of cis and trans isomers of proline or prolyl-iminopeptide bonds.
  • the EC number for this reaction is EC 5.2.1.8. Any protein known or predicted to catalyze the reaction described by this EC number may be a peptidyl-prolyl isomerase of the present disclosure.
  • Peptidyl-prolyl isomerase activity may also be described by the GO term ID GO:0003755. Any protein known or predicted to possess the molecular function described by this GO term ID may be a peptidyl-prolyl isomerase of the present disclosure.
  • Peptidyl-prolyl isomerase activity is known in the art to promote protein folding and assembly.
  • peptidyl-prolyl isomerases may aid in protein folding and assembly by converting trans prolyl bonds to cis prolyl bonds for proteins whose properly folded structure includes a cis prolyl bond.
  • Some peptidyl-prolyl isomerases are also known to enhance the folding and assembly of proteins that lack cis prolyl bonds (Bothmann H and Pluckthun A 2000 J. Biol. Chem. 275:17100).
  • peptidyl-prolyl isomerases may aid in protein folding and assembly of proteins that lack cis prolyl bonds.
  • peptidyl-prolyl isomerase activity may serve as a functional characteristic to identify a chaperone protein useful for the methods described herein, the utility of a peptidyl- prolyl isomerase is not necessarily limited to its catalytic activity per se.
  • the peptidyl-prolyl isomerase is an FkpA protein.
  • the FkpA protein is E. coli FkpA.
  • An E. coli FkpA may refer to any polypeptide encoded by anflpA gene in any strain or isolate of bacteria belonging to the species E. coli.
  • E. coli FkpA refers a protein encoded by anfkpA gene described by EcoGene Accession Number EG12900.
  • E. coli FkpA refers a protein having the sequence described by the NCBI RefSeq Accession Number NP_417806.
  • FkpA proteins are known in the art.
  • FkpA proteins may include, without limitation, S. boydii peptidyl-prolyl isomerase (NCBI RefSeq No. WP_000838252), C. youngae peptidyl-prolyl isomerase (NCBI RefSeq No. WP_006687366), K. oxytoca peptidyl-prolyl isomerase (NCBI RefSeq No. WP_004125943), S. enterica peptidyl-prolyl isomerase (NCBI RefSeq No. WP_000838233), K.
  • pneumoniae peptidyl-prolyl isomerase NCBI RefSeq No. WP_019704642
  • S. cerevisiae FPR3p NCBI RefSeq No. NP_013637
  • M. musculus Fkpbla NCBI RefSeq No. NPJB2045
  • M. musculus Fkpb2 NCBI RefSeq No. NPJB2046
  • H. sapiens FKBP2 NCBI RefSeq No. NP_001128680
  • D D.
  • an FkpA protein of the present disclosure has at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% identity to E. coli FkpA.
  • a chaperone protein may be a protein disulfide
  • Protein disulfide oxidoreductase may refer to any enzyme catalyzing the rearrangement of disulfide bonds in proteins.
  • a protein disulfide oxidoreductase may catalyze the oxidation of cysteines to form disulfide bonds in proteins.
  • a protein disulfide oxidoreductase may also catalyze the isomerization of mispaired disulfide bonds in proteins. The EC number for this reaction is EC 5.3.4.1.
  • Any protein known or predicted to catalyze the reaction described by this EC number may be a protein disulfide oxidoreductase of the present disclosure.
  • Protein disulfide oxidoreductase activity may also be described by the GO term ID GO:0015035.
  • Any protein known or predicted to possess the molecular function described by this GO term ID may be a protein disulfide oxidoreductase of the present disclosure.
  • Protein disulfide oxidoreductase activity is known in the art to promote protein folding and assembly.
  • protein disulfide oxidoreductase activity promotes the formation of proper intramolecular and intermolecular disulfide bonds during protein folding and assembly.
  • protein disulfide oxidoreductase activity is important for proteins with disulfide bonds that are expressed in the periplasm of prokaryotic cells.
  • the protein disulfide oxidoreductase is a DsbA protein.
  • the DsbA protein is E. coli DsbA.
  • An E. coli DsbA may refer to any polypeptide encoded by a dsbA gene in any strain or isolate of bacteria belonging to the species E. coli.
  • E. coli DsbA refers a protein encoded by a dsbA gene described by EcoGene Accession Number EG11297.
  • E. coli DsbA refers a protein having the sequence described by the NCBI RefSeq Accession Number NP_418297.
  • DsbA proteins are known in the art. Examples of DsbA proteins may include, without limitation, S. flexneri thiol-disulfide isomerase (NCBI RefSeq No. WP_000725335), S. dysenteriae thiol-disulfide isomerase (NCBI RefSeq No. WP_000725348), C. youngae thiol-disulfide isomerase (NCBI RefSeq No. WP_006686108), and S. enterica thiol-disulfide isomerase (NCBI RefSeq No. WP_023240584).
  • S. flexneri thiol-disulfide isomerase NCBI RefSeq No. WP_000725335
  • S. dysenteriae thiol-disulfide isomerase NCBI RefSeq No. WP_000725348
  • a DsbA protein of the present disclosure has at least about 80%, at least about 81 , at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% identity to E. coli DsbA.
  • the protein disulfide oxidoreductase is a DsbC protein.
  • the DsbC protein is E. coli DsbC.
  • An E. coli DsbC may refer to any polypeptide encoded by a dsbC gene in any strain or isolate of bacteria belonging to the species E. coli.
  • E. coli DsbC refers a protein encoded by a dsbC gene described by EcoGene Accession Number EG11070.
  • E. coli DsbC refers a protein having the sequence described by the NCBI RefSeq Accession Number NP_417369.
  • DsbC proteins are known in the art.
  • DsbC proteins may include, without limitation, S. sonnei protein-disulfide isomerase (NCBI RefSeq No.
  • WP_000715206 S. dysenteriae protein-disulfide isomerase (NCBI RefSeq No. WP_000715209), E. fergusonii protein-disulfide isomerase (NCBI RefSeq No. WP_000715225), S. bongori thiohdisulfide interchange protein DsbC (NCBI RefSeq No. WP_020845161), and S. enterica protein disulfide isomerase DsbC (NCBI RefSeq No.
  • a DsbC protein of the present disclosure has at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% identity to E. coli DsbC.
  • the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes).
  • the length of a reference sequence aligned for comparison purposes is at least 50%, typically at least 75%, and even more typically at least 80%, 85%, 90%, 95% or 100% of the length of the reference sequence.
  • the amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared.
  • amino acid or nucleic acid “identity” is equivalent to amino acid or nucleic acid “homology”
  • the percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences.
  • sequence comparison typically one sequence acts as a reference sequence, to which test sequences are compared.
  • test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated.
  • the sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
  • a “comparison window”, as used herein, includes reference to a segment of any one of the number of contiguous positions selected from the group consisting of from 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned.
  • Methods of alignment of sequences for comparison are well-known in the art.
  • Optimal alignment of sequences for comparison can be conducted using known algorithms (e.g., by the local homology algorithm of Smith and Waterman, Adv
  • FASTDB Intelligents
  • BLAST National Center for Biomedical Information
  • GAP GAP
  • a preferred example of an algorithm that is suitable for determining percent sequence identity and sequence similarity is the FASTA algorithm (Pearson and Lipman,
  • Another preferred example of algorithms suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms (Altschul et al.,
  • BLAST and BLAST 2.0 are used, with the parameters described herein, to determine percent sequence identity for the nucleic acids and proteins of the disclosure.
  • HSPs high scoring sequence pairs
  • Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached.
  • the BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment.
  • the BLAST algorithm also performs a statistical analysis of the similarity between two sequences (See, e.g., Karlin and Altschul, Proc Natl Acad Sci USA, 90:5873-5787, 1993).
  • One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance.
  • P(N) the smallest sum probability
  • a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.2, more preferably less than about 0.01, and most preferably less than about 0.001.
  • PILEUP creates a multiple sequence alignment from a group of related sequences using progressive, pairwise alignments to show relationship and percent sequence identity. It also plots a tree or dendogram showing the clustering relationships used to create the alignment. PILEUP uses a simplification of the progressive alignment method (Feng and Doolittle, J Mol Evol, 35:351-360, 1987), employing a method similar to a published method (Higgins and Sharp, CABIOS 5:151-153,
  • the program can align up to 300 sequences, each of a maximum length of 5,000 nucleotides or amino acids.
  • the multiple alignment procedure begins with the pairwise alignment of the two most similar sequences, producing a cluster of two aligned sequences.
  • This cluster is then aligned to the next most related sequence or cluster of aligned sequences.
  • Two clusters of sequences are aligned by a simple extension of the pairwise alignment of two individual sequences.
  • the final alignment is achieved by a series of progressive, pairwise alignments.
  • the program is run by designating specific sequences and their amino acid or nucleotide coordinates for regions of sequence comparison and by designating the program parameters.
  • PILEUP a reference sequence is compared to other test sequences to determine the percent sequence identity relationship using the following parameters: default gap weight (3.00), default gap length weight (0.10), and weighted end gaps.
  • PILEUP can be obtained from the GCG sequence analysis software package, e.g., version 7.0 (Devereaux et al., Nuc Acids Res, 12:387-395, 1984).
  • Another preferred example of an algorithm that is suitable for multiple DNA and amino acid sequence alignments is the CLUSTALW program (Thompson et al., Nucl Acids. Res, 22:4673-4680, 1994).
  • ClustalW performs multiple pairwise comparisons between groups of sequences and assembles them into a multiple alignment based on homology. Gap open and Gap extension penalties were 10 and 0.05 respectively.
  • the BLOSUM algorithm can be used as a protein weight matrix (Henikoff and Henikoff, Proc Natl Acad Sci USA, 89:10915-10919, 1992).
  • a host cell contains a polynucleotide including (1) a first translational unit encoding a first chain of the polypeptide; (2) a second translational unit encoding a second chain of the polypeptide; and (3) a third translational unit encoding at least one chaperone protein selected from peptidyl-prolyl isomerases, protein disulfide
  • a host cell contains a polynucleotide including (1) a first translational unit encoding a first chain of the
  • polypeptide (2) a second translational unit encoding a second chain of the polypeptide; (3) a third translational unit encoding a first chaperone protein; (4) a fourth translational unit encoding a second chaperone protein; and (5) a fifth translational unit encoding a third chaperone protein, where the first, second, and third chaperone proteins are selected from peptidyl-prolyl isomerases, protein disulfide oxidoreductases, and combinations thereof.
  • a single plasmid system i.e., a single polynucleotide containing translational units encoding each chain of the two chain protein and one or more translational units encoding one or more chaperone proteins
  • a compatible plasmid system i.e., a first polynucleotide containing translational units encoding each chain of the two chain protein and a second polynucleotide containing one or more translational units encoding one or more chaperone proteins.
  • the polynucleotide further contains three copies of a promoter, where a first copy is in operable combination with the first translational unit, a second copy is in operable combination with the second translational unit, and a third copy is in operable combination with the third translational unit to drive transcription of the first chain, the second chain and the chaperone protein.
  • two of the translational units encoding two of the three chaperone proteins are part of a single translational unit.
  • the polynucleotide further contains a promoter in operable combination with each translational unit.
  • the promoter is an inducible promoter.
  • the activity of an inducible promoter increases or decreases in response to a signal.
  • an inducible promoter may promote transcription in response to the presence of a signal, such as IPTG.
  • An inducible promoter may promote transcription in response to the absence of a signal, such as phosphate. In either of these scenarios, the amount of
  • transcription may or may not be proportional to the amount of signal, or the deficiency thereof.
  • inducible promoters suitable for prokaryotic host cells are known in the art. These may include, without limitation, lac, tac, trc, trp, pho, recA, tetA, nar, phage P L , cspA, T7, and P BAD promoters (see Terpe K. 2006 Appl. Microbiol. Biotechnol. 72:211 for more detailed description).
  • three copies of an inducible promoter are used to drive expression of separate translational units, e.g., both chains of a two chain protein and a chaperone protein, in a coordinated manner.
  • the inducible promoter is an IPTG-inducible promoter.
  • An IPTG-inducible promoter may refer to any polynucleotide sequence that promotes transcription in a manner responsive to isopropyl ⁇ -D-l-thiogalactopyranoside (IPTG) or any other lactose derivative that is able to promote transcription from the lac operon (e.g., allolactose).
  • IPTG-inducible promoters are known in the art, including without limitation tac (e.g, tacl, tacll, etc.) promoters, lac promoters, and derivatives thereof (e.g., lacUV5, taclac, and so forth).
  • the inducible promoter is an IPTG-inducible promoter that drives transcription of the first chain, the second chain and the chaperone protein. It is a surprising discovery of the present disclosure that an IPTG-inducible promoter regulating expression of a chaperone protein may, without induction by IPTG, promote expression of the chaperone protein at a level that promotes a higher product titer, as compared to expression of the chaperone protein when the IPTG-inducible promoter is induced by IPTG.
  • the inducible promoter is a pho promoter that drives transcription of the first chain, the second chain and the chaperone protein when phosphate in the culture medium has been depleted.
  • a pho promoter may refer to any polynucleotide sequence that promotes transcription in a manner responsive to extracellular phosphate (for example, inorganic phosphate).
  • the phosphate (Pho) regulon in E. coli includes protein components that sense extracellular phosphate and, in response to phosphate levels, regulate the expression of numerous downstream genes through Pho promoters (see Hsieh YJ and Wanner BL 2010 Curr. Opin. Microbiol. 13(2): 198 for more detailed description).
  • Pho regulon When bacteria are grown in a culture medium, expression of this Pho regulon is known to be repressed when phosphate ⁇ e.g., inorganic phosphate, Pi) is available in the medium and induced when phosphate has been depleted.
  • phosphate ⁇ e.g., inorganic phosphate, Pi
  • a pho promoter used in the methods described herein is the E. coli phoA promoter. This promoter is widely known and used in the art to regulate recombinant protein expression in prokaryotic host cells in a manner dependent upon the concentration of phosphate in the cell culture medium (see Lubke C et al. 1995 Enzyme Microb. Technol. 17(10):923 for more detailed description).
  • the polynucleotide further contains a selectable marker and the culture medium includes a selection agent with a single antibiotic to cause the host cell to retain the polynucleotide.
  • the methods described herein allow the production of the chains of a two chain protein with co-expression of one or more chaperone proteins such that the translational units encoding each of these components are all included in a single polynucleotide (e.g., an expression plasmid or a single plasmid system as described herein).
  • a single polynucleotide e.g., an expression plasmid or a single plasmid system as described herein.
  • the advantage of such a system is that since all of these components are encoded by the same plasmid, only one selectable marker is required for the maintenance of these polynucleotides in a prokaryotic host cell.
  • a selectable marker may refer to any polynucleotide that encodes a protein that promotes the survival of a host cell when the cell undergoes selection, i.e., any condition used to preferentially increase the abundance of cell(s) bearing a selectable marker relative to the abundance of cell(s) lacking the selectable marker.
  • selectable markers are genes that promote host cell survival in the presence of an antibiotic. Numerous selectable markers and corresponding selection agents with single antibiotics are known in the art. For example and without limitation, many selectable markers and corresponding antibiotics are described and cited in Jang CW and Magnuson T 2013 PLoS ONE 8(2):e57075.
  • a selectable marker may refer to a gene (e.g., a gene expressed from a plasmid) that complements a gene deletion present within the host cell's genome.
  • a gene e.g., a gene expressed from a plasmid
  • the copy of the gene supplied by the plasmid when the cell undergoes selection (i.e., growth under a condition that requires the activity of the gene deleted from the host genome), the copy of the gene supplied by the plasmid
  • genes may include auxotrophic markers or genes required to produce a specific nutrient lacking in a cell medium, examples of which are further described herein. Several exemplary selectable markers and antibiotics are further described below.
  • the first translational unit includes a first translation initiation region (TIR) in operable combination with a coding region of the first chain
  • the second translational unit includes a second translation initiation region (TIR) in operable combination with a coding region of the second chain.
  • TIRs translational initiation regions
  • a TIR may determine the efficiency of translation of a translational unit.
  • a TIR typically includes translational unit features such as the initiation codon, Shine-Dalgarno (SD) sequence, and translational enhancers.
  • a TIR may further include a secretion signal sequence that encodes a signal peptide. The sequence and spacing between features of a TIR may regulate translational initiation efficiency.
  • the relative translation strength of the first and second TIR is from about 1.0 to about 3.0.
  • vectors that include translational units encoding each chain of a two chain protein, and each translational unit may include a TIR.
  • translational strength may refer to the production of a polypeptide through translation of a translational unit. This production may depend upon a number of features, including without limitation mRNA translation, mRNA stability, efficiency of ribosomal binding to an mRNA, and the folding, assembly, and/or translocation of a polypeptide encoded thereby.
  • Relative translational strength may refer to the production of a polypeptide encoded by a translational unit with a specific or experimental TIR, as compared to the production of a polypeptide encoded by a translational unit with a wild-type or control TIR, when both the experimental TIR and the control TIR are expressed by a similar prokaryotic host cell (e.g., same genus and species) cultured under the same conditions. Further description of TIRs may be found in U.S. Patent Number 8,361,744.
  • Certain aspects of the present disclosure relate to methods of producing polypeptides with two chains.
  • the methods described herein may be useful for promoting the expression, folding and assembly of many different types of proteins, particularly those with disulfide bonds, such as two chain proteins as described above.
  • two chain proteins may include proteins containing more than one distinct polypeptide chain. Although many embodiments described herein involve two chain proteins with two polypeptide chains, two chain proteins with more than two polypeptide chains (e.g., three or more polypeptides) are contemplated and may be produced by the methods described herein. As described above, two chain proteins made of a single polypeptide chain that otherwise associate as they would if they were two distinct polypeptide chains (e.g., single chain antibodies, single chain variable fragments, and the like) are also contemplated and may be produced by the methods described herein.
  • the two chains of a two chain polypeptide of the present disclosure are linked to each other by at least one disulfide bond.
  • Disulfide bonds may refer to any covalent bond linking two thiol groups.
  • Disulfide bonds in polypeptides typically form between the thiol groups of cysteine residues.
  • Polypeptide disulfide bonds are known in the art to be important for the folding and assembly of many polypeptides, such as two chain proteins of the present disclosure.
  • Polypeptide disulfide bonds may include disulfide bonds between cysteine residues in a single polypeptide chain (i.e., intramolecular or intra-chain disulfide bonds).
  • Polypeptide disulfide bonds may also include disulfide bonds between cysteine residues found on separate polypeptide chains (i.e., intermolecular or inter-chain disulfide bonds). Therefore, in some embodiments, two chains of a two chain polypeptide are linked to each other by at least one disulfide bond.
  • Disulfide bonds are known in the art to be important for the folding and assembly of antibodies and antibody fragments. Different antibody isotopes, and different subclasses within an isotope, are known to possess different patterns of disulfide bonds. For example, IgG antibodies may contain 12 intra-chain disulfide bonds, one inter-chain disulfide bond between each light chain and its corresponding heavy chain, and between 2 and 11 interchain disulfide bonds between heavy chains, depending upon the particular IgG subclass (see Liu H and May K 2012 MAbs. 4(1): 17 for more detailed description). IgM (see, e.g.,
  • IgE see, e.g., Helm BA et al.
  • IgA see, e.g., Chintalacharuvu KR et al. 2002 J. Immunol. 169(9):5072
  • IgD see, e.g., Shin SU et al. 1992 Hum. Antibodies Hybridomas 3(2):65
  • disulfide bonds during folding and assembly.
  • a two chain polypeptide of the present disclosure is heterologous to the host cell.
  • a heterologous polypeptide when used in reference to a host cell may refer to any polypeptide that is not endogenously expressed in the host cell, i.e., when the host cell is isolated from nature.
  • a heterologous polypeptide may also refer to a polypeptide that may be expressed endogenously by the host cell, but is expressed under different regulation than when the host cell is isolated from nature. Examples of different regulation may include without limitation a different amount of expression, expression in response to a different stimulus, or any other altered context of expression, such as by use of a heterologous promoter, such as an inducible promoter.
  • a two chain polypeptide of the present disclosure is a monomer of a heterodimer.
  • a heterodimer may refer to any polypeptide complex that contains two distinct polypeptides or polypeptide complexes in operable linkage.
  • a non-limiting example of a heterodimer is a bispecific or bivalent antibody composed of two distinct antibody monomers ⁇ i.e., a light chain-heavy chain pair in operable linkage).
  • the folding and assembly of a first heavy chain-light chain pair recognizing a first antigen produces a first antibody monomer.
  • the folding and assembly of a second heavy chain-light chain pair recognizing a second antigen produces a second antibody monomer.
  • a two chain polypeptide of the present disclosure is a monovalent antibody in which the first chain and the second chain represent an
  • a monovalent antibody may refer to any polypeptide complex made from an antibody heavy chain and an antibody light chain operably linked together to form a heavy chain-light chain pair in which the heavy chain-light chain pair is not operably linked to a second heavy chain- light chain pair.
  • the term "half-antibody (hAb)" may be used interchangeably herein.
  • a monovalent antibody of the present disclosure is capable of specifically binding an antigen.
  • the term “binds”, “specifically binding an,” or is “specific for” refers to measurable and reproducible interactions such as binding between a target ⁇ i.e., and an antibody, which is determinative of the presence of the target in the presence of a heterogeneous population of molecules including biological molecules.
  • an antibody that binds to or specifically binds to a target is an antibody that binds this target with greater affinity, avidity, more readily, and/or with greater duration than it binds to other targets.
  • the extent of binding of an antibody to an unrelated target is less than about 10% of the binding of the antibody to the target as measured, e.g., by a radioimmunoassay (RIA).
  • an antibody that specifically binds to a target has a dissociation constant (Kd) of ⁇ ⁇ ⁇ , ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM, or ⁇ 0.1 nM.
  • Kd dissociation constant
  • an antibody specifically binds to an epitope on a protein that is conserved among the protein from different species.
  • specific binding can include, but does not require, exclusive binding.
  • a two chain polypeptide of the present disclosure is a secretory protein.
  • a secretory protein may refer to any protein that is secreted by a host cell into the host cell periplasm or extracellular milieu.
  • a secretory protein may be a protein that is endogenously secreted by a host cell, or a secretory protein may be a protein that is not endogenously secreted by a host cell but is modified in such a way as to promote its secretion.
  • the presence of a signal sequence typically found at the N- terminus of a polypeptide, may direct a polypeptide to the secretory pathway for secretion.
  • a signal sequence is a heat stable enterotoxin II (STII) signal sequence.
  • a secretory protein of the present disclosure is recovered from the periplasm of the host cell.
  • Periplasm is known in the art to refer to the space between the inner or cytoplasmic membrane and the outer membrane of a Gram-negative bacterial cell. Without wishing to be bound to theory, it is thought that the periplasm is an oxidizing environment that favors the formation of disulfide bonds. Therefore, it may be advantageous to localize a polypeptide with disulfide bonds as part of its properly folded and assembled structure (e.g., a two chain protein of the present disclosure) to the periplasm (see
  • Periplasmic proteins may be recovered by extracting a periplasmic fraction from a spheroblast preparation (see, e.g., Schlapschy M et al. 2006 Protein Eng. Des. Sel. 19(8):385). Once a periplasmic extract has been generated, periplasmic proteins may be purified by any standard protein purification technique known in the art, such as affinity purification, chromatography, and the like.
  • the two chain proteins described herein may be prepared by any suitable techniques known in the art.
  • One exemplary class of two chain proteins is the antibody.
  • antibodies are prepared using techniques available in the art for generating antibodies, exemplary methods of which are described in more detail in the following sections.
  • One of skill in the art will recognize that many of the methods described below may be applied to two chain proteins other than antibodies.
  • the antibody is directed against an antigen of interest (e.g., and without limitation, PD-L1 (such as a human PD-L1), HER2, or CD3 (such as a human CD3), IL13, IL4, VEGFC, VEGFA, and VEGF).
  • an antigen of interest e.g., and without limitation, PD-L1 (such as a human PD-L1), HER2, or CD3 (such as a human CD3), IL13, IL4, VEGFC, VEGFA, and VEGF.
  • the antigen is a biologically important polypeptide and administration of the antibody to a mammal suffering from a disorder can result in a therapeutic benefit in that mammal.
  • the antibody of the present disclosure is directed against interleukin-13 (referred to herein as IL-13 or IL13).
  • the antibody may be a monovalent antibody or "half-antibody" directed against IL13, a full antibody comprising two monovalent heavy chain-light chain pairs directed against IL13 (e.g., two identical monovalent heavy chain-light chain pairs; two monovalent heavy chain-light chain pairs, each comprising different HVRs or CDRs that recognize identical epitopes of IL13; or two monovalent heavy chain-light chain pairs, each comprising different HVRs or CDRs that recognize non- overlapping or partially overlapping epitopes of IL13), or a bispecific antibody comprising a heavy chain-light chain pair directed against IL13 and a heavy chain-light chain pair directed against a different antigen.
  • IL13 polypeptides are known in the art.
  • the IL13 polypeptide is a human IL13 polypeptide.
  • the IL13 polypeptide is a precursor form of IL13.
  • a non-limiting example of a precursor form of an IL13 polypeptide is a human IL13 precursor, as represented by Swiss-Prot Accession No.
  • the IL13 polypeptide comprises the sequence: MALLLTTVIA LTCLGGFASP GPVPPSTALRELIEEL VNITQNQKAP LCNGSMVWSI NLTAGMYCAA LESLINVSGC SAIEKTQRML SGFCPHKVSA GQFSSLHVRD TKIEVAQFVK DLLLHLKKLF REGRFN (SEQ ID NO : 1 ) .
  • the IL13 is a mature form of IL13 (e.g., lacking a signal sequence).
  • the IL13 polypeptide comprises the sequence:
  • the antibody of the present disclosure is directed against interleukin-17 (referred to herein as IL-17 or IL17).
  • the antibody may be a monovalent antibody or "half-antibody" directed against IL17, a full antibody comprising two monovalent heavy chain-light chain pairs directed against IL17 (e.g., two identical monovalent heavy chain-light chain pairs; two monovalent heavy chain-light chain pairs, each comprising different HVRs or CDRs that recognize identical epitopes of IL17; or two monovalent heavy chain-light chain pairs, each comprising different HVRs or CDRs that recognize non- overlapping or partially overlapping epitopes of IL17), or a bispecific antibody comprising a heavy chain-light chain pair directed against IL17 and a heavy chain-light chain pair directed against a different antigen.
  • IL17A There are six members in the IL17 family: IL17A, IL17B, IL17C, IL7D, IL17E and IL17F.
  • IL17 is sometimes used in the field to refer to IL17A, the prototype of the IL17 family.
  • IL17A and IL17F share the highest sequence homology among all IL17 family members.
  • Members of the IL17 family form homodimers, e.g., IL17AA and IL17FF.
  • IL17A and IL17F form heterodimers (e.g., IL17AF). See e.g., Gaffen, S. L., 2009, Nature Review 9:556-567; Hymowitz et ah, 2001, EMBO J. 20:5332-41; and
  • the antibody of the present disclosure is directed against IL17A. In certain embodiments, the antibody of the present disclosure is directed against IL17F. In certain embodiments, the anti- IL17 antibody or antibody that binds IL17 refers to an antibody that binds IL17AA, FF and AF (or IL17A F cross reactive antibody). In certain embodiments, the antibody of the present disclosure cross-reacts with both IL17A and IL17F (e.g., anti-IL17AA, AF, and FF). For a further description of IL17AA, IL17FF, and IL17AF antibodies see, e.g., U.S. Patent No. 8,715,669.
  • IL17 polypeptides e.g., IL17A or IL17F
  • the IL17A polypeptide is a human IL17A polypeptide.
  • the IL17A polypeptide is a precursor form of IL17A.
  • a non-limiting example of a precursor form of an IL17A polypeptide is a human IL17A precursor, as represented by Swiss-Prot Accession No. Q16552.1.
  • the IL17A polypeptide comprises the sequence:
  • the IL17A is a mature form of IL17A (e.g., lacking a signal sequence).
  • the IL17A polypeptide comprises the sequence:
  • the IL17F polypeptide is a human IL17F polypeptide.
  • the IL17F polypeptide is a precursor form of IL17F.
  • a non-limiting example of a precursor form of an IL17F polypeptide is a human IL17F precursor, as represented by Swiss-Prot Accession No. Q96PD4.3.
  • the IL17F polypeptide comprises the sequence:
  • the IL17F is a mature form of IL17F (e.g., lacking a signal sequence).
  • the IL17F polypeptide comprises the sequence:
  • an anti-IL13 antibody comprising a heavy chain variable domain and a light chain variable domain, wherein:
  • the heavy chain variable domain comprises an HVR-H1, HVR-H2 and an HVR-H3 sequence having at least 85% sequence identity to AYSVN(SEQ ID NO:9), MIWGDGKIVYNSALKS (SEQ ID NO: 10) and DGYYPYAMDN (SEQ ID NO: 11), respectively, and/or
  • the light chain variable domain comprises an HVR-L1, HVR-L2 and an HVR- L3 sequence having at least 85% sequence identity to RASKSVDSYGNSFMH (SEQ ID NO: 12), LASNLES (SEQ ID NO: 13) and QQNNEDPRT (SEQ ID NO: 14), respectively.
  • sequence identity is at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% as compared to a reference sequence.
  • the anti-IL13 antibody comprises a heavy chain variable domain sequence of SEQ ID NO:7 and/or a light chain variable domain sequence of SEQ ID NO: 8.
  • an isolated anti-IL13 antibody comprising a heavy chain and/or a light chain sequence, wherein:
  • the heavy chain variable domain sequence has at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or 100% sequence identity to the reference heavy chain sequence: EVTLRESGPALVKPTQTLTLTCTVSGFSLSAYSVNWIRQPPGKALEWLAMIWGDGKI VYNSALKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCAGDGYYPYAMDNWGQG SLVTVSS (SEQ ID NO:7), and/or
  • the light chain variable domain sequence has at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or 100% sequence identity to the reference light chain sequence: DIVLTQSPDSLSVSLGERATINCRASKSVDSYGNSFMHWYQQKPGQPPKLLIYLASNL ESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQNNEDPRTFGGGTKVEIKR (SEQ ID NO:8).
  • an anti-IL17A F cross reactive antibody comprising a heavy chain variable domain and a light chain variable domain, wherein:
  • the heavy chain variable domain comprises an HVR-H1, HVR-H2 and an HVR-H3 sequence having at least 85% sequence identity to DYAMH (SEQ ID NO:20), GINWSSGGIGYADSVKG (SEQ ID NO:21) and DIGGFGEFYWNFGL (SEQ ID NO:22), respectively, and/or
  • the light chain variable domain comprises an HVR-L1, HVR-L2 and an HVR- L3 sequence having at least 85% sequence identity to RASQSVRSYLA (SEQ ID NO:23), DASNRAT (SEQ ID NO:24) and QQRSNWPPAT (SEQ ID NO:25), respectively.
  • sequence identity is at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% as compared to a reference sequence.
  • the anti-IL17A F cross reactive antibody comprises a heavy chain variable domain sequence of SEQ ID NO: 18 and/or a light chain variable domain sequence of SEQ ID NO: 19.
  • an isolated anti-IL17A F cross reactive antibody comprising a heavy chain and/or a light chain sequence, wherein: (a) the heavy chain sequence has at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or 100% sequence identity to the reference heavy chain sequence:
  • the light chain sequences has at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or 100% sequence identity to the reference light chain sequence:
  • multispecific antibodies comprise a first monovalent or half antibody and a second monovalent or half antibody, wherein the first half-antibody comprises a first VH/VL unit that binds IL-17 and the second half antibody comprises a second VH/VL unit that binds IL-13.
  • the first half antibody does not bind IL-13
  • the second half antibody does not bind IL-17.
  • the multispecific antibody provided herein binds to IL-17 AA, IL-17AF and IL-17FF, inhibits IL-17AA- , IL-17AF, and IL-17FF - induced activity, and inhibits IL-13-induced activity.
  • the anti- IL-13/IL-17AA, AF and FF bispecific antibody advantageously blocks activities induced by all of IL-17A and F cytokines as opposed to activities induced by IL-17A or IL-17F alone.
  • a multispecific antibody provided herein binds to IL-17AA, IL-17AF, and IL-17FF.
  • the IL-17AA-induced activity is IL-17AA-induced gene expression and/or proliferation of cells in vivo or in vitro.
  • the IL- 17 AF- induced activity is IL-17AF-induced gene expression and/or proliferation of cells in vivo or in vitro.
  • the IL-17FF-induced activity is IL-17FF-induced gene expressing and/or proliferation of cells in vivo or in vitro.
  • the IL- 13-induced activity is IL-13-induced gene expression and/or proliferation of cells in vivo or in vitro.
  • a multispecific antibody provided herein does not inhibit binding of IL-13 to IL-13Ral.
  • the anti-IL13/IL17AA AF FF bispecific antibody or anti-
  • IL13/IL17 bispecific antibody comprises a first half antibody and a second half antibody, wherein the first half-antibody comprises a first VH/VL unit that binds IL-17AA, AF and FF and the second half antibody comprises a second VH/VL unit that binds IL-13, wherein the first VH/VL unit comprises HVR-H1 comprising the amino acid sequence of SEQ ID NO: 20, HVR-H2 comprising the amino acid sequence of SEQ ID NO: 21, HVR-H3 comprising the amino acid sequence of SEQ ID NO: 22, HVR-Ll comprising the amino acid sequence of SEQ ID NO: 23, HVR-L2 comprising the amino acid sequence of SEQ ID NO: 24, and HVR-L3 comprising the amino acid sequence of SEQ ID NO: 25, and wherein the second VH/VL unit comprises HVR-H1 comprising the amino acid sequence of SEQ ID NO:9, HVR-H2 comprising the amino acid sequence of SEQ ID NO: 10, HVR-H3 comprising the
  • the first half antibody does not bind IL-13
  • the second half antibody does not bind IL-17. See U.S. Pat. No. 8,715,669; U.S. Pat. No. 8,771,697; U.S. Pat. No. 8,088,618; and
  • the first VH/VL unit comprises a VH sequence having at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the amino acid sequence of SEQ ID NO:18 and a VL sequence having at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the amino acid sequence of
  • the second VH/VL unit comprises a VH sequence having at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the amino acid sequence of SEQ ID NO:7 and a VL sequence having at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the amino acid sequence of
  • a multispecific antibody is provided, wherein the first
  • VH/VL unit comprises a VH sequence having the amino acid sequence of SEQ ID NO: 18 and a VL sequence having the amino acid sequence of SEQ ID NO: 19, and wherein the second VH/VL unit comprises a VH sequence having the amino acid sequence of SEQ ID NO:
  • the first half antibody that binds IL17AA AF and FF comprises a heavy chain comprising the amino acid sequence of SEQ ID NO:26 and a light chain comprising the amino acid sequence of SEQ ID NO:28; and the second half antibody that binds IL13 comprises a heavy chain comprising the amino acid sequence of SEQ ID NO:
  • the first half antibody that binds IL17AA AF and FF comprises a heavy chain comprising the amino acid sequence of SEQ ID NO:27 and a light chain comprising the amino acid sequence of SEQ ID NO:28; and the second half antibody that binds IL13 comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 16 and a light chain comprising the amino acid sequence of SEQ ID NO: 17.
  • the CH3 and/or CH2 domains of an antibody of the present disclosure are from an IgG (e.g., IgGl subtype, IgG2 subtype, IgG2A subtype, IgG2B subtype, IgG3, subtype, or IgG4 subtype).
  • the CH3 and/or CH2 domains of an antibody of the present disclosure may comprise one or more knob- or hole- forming mutations, such as those described in Table 2 below.
  • the CH3 and/or CH2 domains of an antibody of the present disclosure are from an IgG4 subtype.
  • the IgG4 CH3 and/or CH2 domains of an antibody of the present disclosure may comprise one or more additional mutations, including without limitation an S228P mutation (EU numbering).
  • an anti-IL13 antibody of the present disclosure e.g., a half antibody that binds
  • IL13 comprises a heavy chain variable domain encoded by a polynucleotide sequence comprising SEQ ID NO:29 and/or a light chain variable domain encoded by a polynucleotide sequence comprising SEQ ID NO:30.
  • an anti-IL13 antibody of the present disclosure e.g., a half antibody that binds IL13
  • an anti-IL17A F cross reactive antibody of the present disclosure (e.g., a half antibody that binds IL17AA, AF, and FF) comprises a heavy chain variable domain encoded by a polynucleotide sequence comprising SEQ ID NO:34 and/or a light chain variable domain encoded by a polynucleotide sequence comprising SEQ ID NO:35.
  • an anti-IL17A F cross reactive antibody of the present disclosure e.g., a half antibody that binds IL17AA, AF, and FF
  • polynucleotide sequence comprising SEQ ID NO:36 or SEQ ID NO:37 and/or a light chain variable domain encoded by a polynucleotide sequence comprising SEQ ID NO:38.
  • an antibody of the present disclosure may contain a polypeptide sequence that is codon optimized for expression in a particular host cell, e.g., a prokaryotic host cell such as E. coli.
  • an anti-IL17AF antibody of the present disclosure e.g., a half antibody that binds IL17AA, AF, and FF
  • an antibody provided herein has a dissociation constant (Kd) of ⁇ ⁇ , ⁇ 150 nM, ⁇ 100 nM, ⁇ 50 nM, ⁇ 10 nM, ⁇ 1 nM, ⁇ 0.1 nM, ⁇ 0.01 nM, or ⁇ 0.001 nM (e.g. 10 ⁇ 8 M or less, e.g. from 10 ⁇ 8 M to 10 "13 M, e.g., from 10 "9 M to 10 "13 M).
  • Kd dissociation constant
  • Kd is measured by a radiolabeled antigen binding assay (RIA) performed with the Fab version of an antibody of interest and its antigen as described by the following assay.
  • RIA radiolabeled antigen binding assay
  • Fab with a minimal concentration of ( 125 I)-labeled antigen in the presence of a titration series of unlabeled antigen, then capturing bound antigen with an anti-Fab antibody-coated plate (see, e.g., Chen et al., J. Mol. Biol. 293:865-881(1999)).
  • MICROTITER ® multi-well plates (Thermo Scientific) are coated overnight with 5 ⁇ g/ml of a capturing anti-Fab antibody (Cappel Labs) in 50 mM sodium carbonate (pH 9.6), and subsequently blocked with 2% (w/v) bovine serum albumin in PBS for two to five hours at room temperature (approximately 23°C).
  • a non-adsorbent plate (Nunc #269620) 100 pM or 26 pM r 125 J I]-anti gen are mixed with serial dilutions of a Fab of interest. The Fab of interest is then incubated overnight; however, the incubation may continue for a longer period (e.g., about 65 hours) to ensure that equilibrium is reached. Thereafter, the mixtures are transferred to the capture plate for incubation at room temperature (e.g., for one hour). The solution is then removed and the plate washed eight times with 0.1% polysorbate 20 (TWEEN-20 ® ) in PBS.
  • TWEEN-20 ® 0.1% polysorbate 20
  • Kd is measured using surface plasmon resonance assays using a BIACORE ® -2000 or a BIACORE ® -3000 (BIAcore, Inc.,
  • carboxymethylated dextran biosensor chips CM5, BIACORE, Inc.
  • EDC N-ethyl-N'- (3-dimethylaminopropyl)-carbodiimide hydrochloride
  • NHS N- hydroxysuccinimide
  • association rates (k on ) and dissociation rates (k 0 ff) are calculated using a simple one-to-one Langmuir binding model (BIACORE ® Evaluation Software version 3.2) by simultaneously fitting the association and dissociation sensorgrams.
  • the equilibrium dissociation constant (Kd) is calculated as the ratio k 0 ff/k on See, e.g., Chen et al., J. Mol. Biol. 293:865-881 (1999).
  • Soluble antigens or fragments thereof, optionally conjugated to other molecules, can be used as immunogens for generating antibodies.
  • immunogens for transmembrane molecules, such as receptors, fragments of these (e.g. the extracellular domain of a receptor) can be used as the immunogen.
  • transmembrane molecules such as receptors
  • fragments of these e.g. the extracellular domain of a receptor
  • cells expressing the transmembrane molecule can be used as the immunogen.
  • Such cells can be derived from a natural source (e.g. cancer cell lines) or may be cells which have been transformed by recombinant techniques to express the transmembrane molecule.
  • Other antigens and forms thereof useful for preparing antibodies will be apparent to those in the art.
  • Polyclonal antibodies are preferably raised in animals by multiple subcutaneous (sc) or intraperitoneal (ip) injections of the relevant antigen and an adjuvant. It may be useful to conjugate the relevant antigen to a protein that is immunogenic in the species to be immunized, e.g., keyhole limpet hemocyanin, serum albumin, bovine thyroglobulin, or soybean trypsin inhibitor using a bifunctional or derivatizing agent, for example,
  • the animals are boosted with 1/5 to 1/10 the original amount of peptide or conjugate in Freund's complete adjuvant by subcutaneous injection at multiple sites. Seven to 14 days later the animals are bled and the serum is assayed for antibody titer. Animals are boosted until the titer plateaus. Preferably, the animal is boosted with the conjugate of the same antigen, but conjugated to a different protein and/or through a different cross-linking reagent. Conjugates also can be made in recombinant cell culture as protein fusions. Also, aggregating agents such as alum are suitably used to enhance the immune response.
  • Monoclonal antibodies of the disclosure can be made using the hybridoma method first described by Kohler et al., Nature, 256:495 (1975), and further described, e.g., in Hongo et al., Hybridoma, 14 (3): 253-260 (1995), Harlow et al., Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, 2nd ed. 1988); Hammerling et al., in: Monoclonal Antibodies and T-Cell Hybridomas 563-681 (Elsevier, N.Y., 1981), and Ni, Xiandai
  • Human hybridoma technology (Trioma technology) is described in Vollmers and Brandlein, Histology and Histopathology, 20(3):927-937 (2005) and Vollmers and Brandlein, Methods and Findings in Experimental and Clinical Pharmacology, 27(3):185-91 (2005).
  • polynucleotides encoding them may be subcloned into a prokaryotic expression vector, and antibodies may be produced by expression in a prokaryotic host cell by any of the methods described herein.
  • Antibodies of the disclosure may be isolated by screening combinatorial libraries for antibodies with the desired activity or activities. For example, a variety of methods are known in the art for generating phage display libraries and screening such libraries for antibodies possessing the desired binding characteristics such as the methods described in Example 3. Additional methods are reviewed, e.g., in Hoogenboom et al. in Methods in Molecular Biology 178:1-37 (O'Brien et al., ed., Human Press, Totowa, NJ, 2001) and further described, e.g., in the McCafferty et al., Nature 348:552-554; Clackson et al., Nature 352: 624-628 (1991); Marks et al., J.
  • phage display methods repertoires of VH and VL genes are separately cloned by polymerase chain reaction (PCR) and recombined randomly in phage libraries, which can then be screened for antigen-binding phage as described in Winter et al., Ann. Rev. Immunol, 12: 433-455 (1994). Phage typically display antibody fragments, either as single- chain Fv (scFv) fragments or as Fab fragments. Libraries from immunized sources provide high-affinity antibodies to the immunogen without the requirement of constructing hybridomas.
  • PCR polymerase chain reaction
  • naive repertoire can be cloned (e.g., from human) to provide a single source of antibodies to a wide range of non-self and also self-antigens without any immunization as described by Griffiths et al., EMBO J, 12: 725-734 (1993).
  • naive libraries can also be made synthetically by cloning unrearranged V-gene segments from stem cells, and using PCR primers containing random sequence to encode the highly variable CDR3 regions and to accomplish rearrangement in vitro, as described by Hoogenboom and Winter, J. Mol. Biol, 227: 381-388 (1992).
  • Patent publications describing human antibody phage libraries include, for example: US Patent No. 5,750,373, and US Patent Publication Nos. 2005/0079574, 2005/0119455, 2005/0266000, 2007/0117126, 2007/0160598,
  • Antibodies or antibody fragments isolated from human antibody libraries are considered human antibodies or human antibody fragments herein.
  • an antibody provided herein is a chimeric antibody.
  • Certain chimeric antibodies are described, e.g., in U.S. Patent No. 4,816,567; and Morrison et al., Proc. Natl. Acad. Sci. USA, 81:6851-6855 (1984)).
  • a chimeric antibody comprises a non-human variable region (e.g., a variable region derived from a mouse, rat, hamster, rabbit, or non-human primate, such as a monkey) and a human constant region.
  • a chimeric antibody is a "class switched" antibody in which the class or subclass has been changed from that of the parent antibody.
  • Chimeric antibodies include antigen-binding fragments thereof.
  • a chimeric antibody is a humanized antibody.
  • a non-human antibody is humanized to reduce immunogenicity to humans, while retaining the specificity and affinity of the parental non-human antibody.
  • a humanized antibody comprises one or more variable domains in which HVRs, e.g., CDRs, (or portions thereof) are derived from a non-human antibody, and FRs (or portions thereof) are derived from human antibody sequences.
  • a humanized antibody optionally will also comprise at least a portion of a human constant region.
  • some FR residues in a humanized antibody are substituted with corresponding residues from a non-human antibody (e.g., the antibody from which the HVR residues are derived), e.g., to restore or improve antibody specificity or affinity.
  • a non-human antibody e.g., the antibody from which the HVR residues are derived
  • Human framework regions that may be used for humanization include but are not limited to: framework regions selected using the "best-fit" method (see, e.g., Sims et al. J. Immunol. 151:2296 (1993)); framework regions derived from the consensus sequence of human antibodies of a particular subgroup of light or heavy chain variable regions (see, e.g., Carter et al. Proc. Natl. Acad. Sci. USA, 89:4285 (1992); and Presta et al. J. Immunol, 151:2623 (1993)); human mature (somatically mutated) framework regions or human germline framework regions (see, e.g., Almagro and Fransson, Front. Biosci.
  • an antibody provided herein is a human antibody.
  • Human antibodies can be produced using various techniques known in the art. Human antibodies are described generally in van Dijk and van de Winkel, Curr. Opin. Pharmacol. 5: 368-74 (2001) and Lonberg, Curr. Opin. Immunol. 20:450-459 (2008). Human antibodies can be made, for example and without limitation, by expression in a prokaryotic host cell from a prokaryotic expression vector by any of the methods described herein.
  • Human antibodies may also be generated by isolating Fv clone variable domain sequences selected from human-derived phage display libraries. Such variable domain sequences may then be combined with a desired human constant domain. Techniques for selecting human antibodies from antibody libraries are described below.
  • Antibody fragments may be generated by traditional means, such as enzymatic digestion, or by recombinant techniques. In certain circumstances there are advantages of using antibody fragments, rather than whole antibodies. The smaller size of the fragments allows for rapid clearance, and may lead to improved access to solid tumors. For a review of certain antibody fragments, see Hudson et al. (2003) Nat. Med. 9:129-134.
  • F(ab') 2 fragments can be isolated directly from recombinant host cell culture.
  • Fab and F(ab') 2 fragment with increased in vivo half-life comprising salvage receptor binding epitope residues are described in U.S. Pat. No.
  • an antibody is a single chain Fv fragment (scFv). See WO 93/16185; U.S. Pat. Nos. 5,571,894; and 5,587,458.
  • Fv and scFv are the only species with intact combining sites that are devoid of constant regions; thus, they may be suitable for reduced nonspecific binding during in vivo use.
  • scFv fusion proteins may be constructed to yield fusion of an effector protein at either the amino or the carboxy terminus of an scFv. See Antibody Engineering, ed. Borrebaeck, supra.
  • the antibody fragment may also be a "linear antibody", e.g., as described in U.S. Pat. No. 5,641,870, for example. Such linear antibodies may be monospecific or bispecific.
  • Multispecific antibodies have binding specificities for at least two different epitopes, where the epitopes are usually from different antigens. While such molecules normally will only bind two different epitopes (i.e. bispecific antibodies, BsAbs), antibodies with additional specificities such as trispecific antibodies are encompassed by this expression when used herein.
  • Bispecific antibodies can be prepared as full length antibodies or antibody fragments (e.g. F(ab') 2 bispecific antibodies).
  • immunoglobulin heavy chain-light chain pairs where the two chains have different specificities (Millstein et al., Nature, 305:537-539 (1983)). Because of the random assortment of immunoglobulin heavy and light chains, these hybridomas (quadromas) produce a potential mixture of 10 different antibody molecules, of which only one has the correct bispecific structure. Purification of the correct molecule, which is usually done by affinity chromatography steps, is rather cumbersome, and the product yields are low. Similar procedures are disclosed in WO 93/08829, and in Traunecker et al., EMBO J, 10:3655-3659 (1991).
  • immunoglobulin polypeptides to associate may be engineered such that a "knob” or “protuberance” (these terms may be used interchangeably herein) located in the interface of one immunoglobulin polypeptide corresponds with a "hole” or “cavity” (these terms may be used interchangeably herein) located in the interface of the other
  • the hole is of identical or similar size to the knob and suitably positioned such that when the two interfaces interact, the knob of one interface is positionable in the corresponding hole of the other interface. Without wishing to be bound to theory, this is thought to stabilize the heteromultimer and favor formation of the heteromultimer over other species, for example homomultimers. In some embodiments, this approach may be used to promote the heteromultimerization of two different immunoglobulin polypeptides, creating a bispecific antibody comprising two immunoglobulin polypeptides with binding specificities for different epitopes.
  • a knob may be constructed by replacing a small amino acid side chain with a larger side chain.
  • a hole may be constructed by replacing a large amino acid side chain with a smaller side chain.
  • Knobs or holes may exist in the original interface, or they may be introduced synthetically.
  • knobs or holes may be introduced synthetically by altering the nucleic acid sequence encoding the interface to replace at least one "original" amino acid residue with at least one "import” amino acid residue. Methods for altering nucleic acid sequences may include standard molecular biology techniques well known in the art. The side chain volumes of various amino acid residues are shown in the following table.
  • original residues have a small side chain volume (e.g., alanine, asparagine, aspartic acid, glycine, serine, threonine, or valine), and import residues for forming a knob are naturally occurring amino acids and may include arginine, phenylalanine, tyrosine, and tryptophan.
  • original residues have a large side chain volume (e.g., arginine, phenylalanine, tyrosine, and tryptophan), and import residues for forming a hole are naturally occurring amino acids and may include alanine, serine, threonine, and valine.
  • Threonine (Thr) T 101.11 116.1 140 One-letter Mass a Volume Accessible
  • Trp Tryptophan
  • original residues for forming a knob or hole are identified based on the three-dimensional structure of the heteromultimer.
  • Techniques known in the art for obtaining a three-dimensional structure may include X-ray crystallography and NMR.
  • the interface is the CH3 domain of an immunoglobulin constant domain.
  • the CH3/CH3 interface of human IgGi involves sixteen residues on each domain located on four anti-parallel ⁇ -strands.
  • mutated residues are preferably located on the two central anti-parallel ⁇ -strands to minimize the risk that knobs can be accommodated by the surrounding solvent, rather than the compensatory holes in the partner CH3 domain.
  • the mutations forming corresponding knobs and holes in two immunoglobulin polypeptides correspond to one or more pairs provided in the following table.
  • an immunoglobulin polypeptide comprises a CH3 domain comprising one or more amino acid substitutions listed in Table 2 above.
  • a bispecific antibody comprises a first immunoglobulin polypeptide comprising a CH3 domain comprising one or more amino acid substitutions listed in the left column of Table 2, and a second immunoglobulin polypeptide comprising a CH3 domain comprising one or more corresponding amino acid substitutions listed in the right column of Table 2.
  • a bispecific antibody comprises a first immunoglobulin polypeptide comprising a CH3 domain comprising a T366W mutation, and a second immunoglobulin polypeptide comprising a CH3 domain comprising T366S, L368A, and Y407V mutations.
  • polynucleotides encoding modified immunoglobulin polypeptides with one or more corresponding knob- or hole- forming mutations may be expressed and purified using standard recombinant techniques and cell systems known in the art. See, e.g., U.S. Pat. Nos. 5,731,168; 5,807,706; 5,821,333; 7,642,228; 7,695,936; 8,216,805; U.S. Pub. No. 2013/0089553; and Spiess et al., Nature Biotechnology 31: 753-758, 2013.
  • Modified immunoglobulin polypeptides may be produced using prokaryotic host cells, such as E. coli.
  • Corresponding knob- and hole -bearing immunoglobulin polypeptides may be expressed in host cells in co-culture and purified together as a heteromultimer, or they may be expressed in single cultures, separately purified, and assembled in vitro.
  • two strains of bacterial host cells one expressing an immunoglobulin polypeptide with a knob, and the other expressing an immunoglobulin polypeptide with a hole
  • the two strains may be mixed in a specific ratio, e.g., so as to achieve equal expression levels in culture.
  • the two strains may be mixed in a 50:50, 60:40, or 70:30 ratio.
  • each modified immunoglobulin polypeptide is expressed separately using standard recombinant techniques, recovered, and assembled together in vitro. As described in greater detail below, assembly may be achieved, for example, by purifying each modified immunoglobulin polypeptide, mixing and incubating them together in equal mass, reducing disulfides ⁇ e.g., by treating with dithiothreitol), concentrating, and reoxidizing the polypeptides.
  • bispecific antibodies may be purified using standard techniques including cation-exchange chromatography and measured using standard techniques including size exclusion chromatography. For a more detailed description of these methods, see Speiss et al., Nat Biotechnol 31:753-8, 2013.
  • Each half-antibody can have either a knob (protuberance) or a hole (cavity) engineered into the heavy chain as described in U.S. Patent No. 7,642,228. Briefly, a CH3 knob mutant can be generated first. A library of CH3 hole mutants can be then created by randomizing residues 366, 368 and 407 that are in proximity to the knob on the partner CH3 domain.
  • the knob mutation comprises T366W
  • the hole mutations comprise T366S, L368A and Y407V in an IgGlor IgG4 backbone.
  • Equivalent mutations in other immunoglobulin isotypes can be made by one skilled in the art. Further, the skilled artisan will readily appreciate that it is preferred that the two half-antibodies used for the bispecific antibody be of the same isotype.
  • Half-antibodies containing either the knob or hole mutations are generated in separate cultures by expressing the heavy and light chains constructs in a bacterial host cell, ⁇ e.g., E. coli). Each half-antibody can be purified separately by Protein A affinity
  • Clarified cell extracts from the knob and hole half-antibody can be purified by a HiTrap MABSELECT SURETM column. Protein A purified half antibodies with different specificity can be assembled to form a bispecific antibody in a redox reaction in vitro in the presence of a reducing agent.
  • a desired reducing condition can be prepared by adding a reductant/reducing agent to the reaction (such as an assembly mixture of the invention).
  • Suitable reductants include without limitation dithiothreitol (DTT), in ' 5 , (2-carboxyethyl)phosphine (TCEP), thioglycolic acid, ascorbic acid, thiol acetic acid, glutathione (GSH), Beta- MercaptoEthyl Amine, cysteine/cystine, GSH/glutathione disulfide (GSSG), cysteamine/cystamine, glycylcysteine, and beta-mercaptoethanol, preferably GSH.
  • DTT dithiothreitol
  • TCEP (2-carboxyethyl)phosphine
  • thioglycolic acid ascorbic acid
  • thiol acetic acid glutathione
  • GSH glutathione
  • the reductant is a weak reductant including without limitation GSH, Beta-MercaptoEthylAmine, cysteine/cystine, GSH/GSSG, cysteamine/cystamine, glycylcysteine, and beta- mercaptoethanol, preferably GSH.
  • the reductant is GSH.
  • the reductant is not DTT. It is within the ability of one of ordinary skill in the art to select suitable reductants at suitable concentrations and under suitable experimental conditions to achieve in a reaction the desired reducing condition.
  • the reducing condition can be measured using a resazurin indicator (discolorization from blue to colorless in reducing conditions).
  • a redox-potential meter such as an ORP Electrode made by BROADLEY JAMES®
  • BROADLEY JAMES® BROADLEY JAMES
  • the reducing condition is a weak reducing condition.
  • the term "weak reductant" or "weak reducing condition” as used herein refers to a reducing agent or a reducing condition prepared by the reducing agent having a negative oxidation potential at 25°C.
  • the oxidation potential of the reductant is preferably between -50 to -600 mV, -100 to -600 mV, -200 to -600 mV, -100 to -500 mV, -150 to -300 mV, more preferably between about -300 to -500 mV, most preferably about -400mV, when the pH is between 7 and 9, and the temperature is between 15°C and 39°C.
  • a strong reductant i.e., one that has a more negative oxidation potential than above mentioned reductants for the same concentration, pH and temperature
  • the proteins will be able to form disulfide bonds in the presence of the reductant when incubated under the above -recited conditions.
  • a weak reductant include without limitation glutathione, Beta- MercaptoEthylAmine, cystine/cysteine, GSH/GSSG, cysteamine/cystamine, glycylcysteine, and beta-mercaptoethanol.
  • an oxidation potential similar to that of 200X molar ratio of GSH:Antibody can be used as a point of reference for a weakly reducing condition at which efficient assembly using other reductants can be expected.
  • Glutathione concentrations can be expressed in terms of molarity or in terms of molar ratio or molar excess with respect to the amount of the half-antibodies present in the assembly mixture. Using a target molar ratio of reductant controls for the protein
  • the reductant is added to the assembly mixture in 2-600X, 2-200X, 2-300X, 2-400X, 2-500X, 2-20X, 2-8X, 20-50X, 50-600X, 50-200X, or 100-300X molar excess, preferably 50-400X, more preferably 100- 300X, and most preferably 200X, molar excess with respect to the total amount of the half antibodies.
  • the assembly mixture has a pH of between 7 and 9, preferably pH 8.5.
  • the cultures of the first half antibody and second half antibody can be combined and subsequently lysed in the combined cultures. The released first half antibody and second half antibody in the combination can form a bispecific antibody in a reducing condition. See WO 2011/133886, incorporated herein by reference in its entirety.
  • antibody variable domains with the desired binding specificities are fused to immunoglobulin constant domain sequences.
  • the fusion preferably is with an immunoglobulin heavy chain constant domain, comprising at least part of the hinge, CH2, and CH3 regions. It is typical to have the first heavy-chain constant region (CHI) containing the site necessary for light chain binding, present in at least one of the fusions.
  • CHI first heavy-chain constant region
  • the bispecific antibodies are composed of a hybrid immunoglobulin heavy chain with a first binding specificity in one arm, and a hybrid immunoglobulin heavy chain-light chain pair (providing a second binding specificity) in the other arm. It was found that this asymmetric structure facilitates the separation of the desired bispecific compound from unwanted immunoglobulin chain combinations, as the presence of an immunoglobulin light chain in only one half of the bispecific molecule provides for a facile way of separation. This approach is disclosed in WO 94/04690. For further details of generating bispecific antibodies see, for example, Suresh et al., Methods in Enzymology, 121:210 (1986).
  • the interface between a pair of antibody molecules can be engineered to maximize the percentage of heterodimers which are recovered from recombinant cell culture.
  • One interface comprises at least a part of the C H 3 domain of an antibody constant domain.
  • one or more small amino acid side chains from the interface of the first antibody molecule are replaced with larger side chains (e.g. tyrosine or tryptophan).
  • Compensatory "cavities" of identical or similar size to the large side chain(s) are created on the interface of the second antibody molecule by replacing large amino acid side chains with smaller ones (e.g. alanine or threonine). This provides a mechanism for increasing the yield of the heterodimer over other unwanted end- products such as homodimers.
  • Bispecific antibodies include cross-linked or "heteroconjugate" antibodies.
  • one of the antibodies in the heteroconjugate can be coupled to avidin, the other to biotin.
  • Such antibodies have, for example, been proposed to target immune system cells to unwanted cells (U.S. Pat. No. 4,676,980), and for treatment of HIV infection (WO 91/00360, WO 92/200373, and EP 03089).
  • Heteroconjugate antibodies may be made using any convenient cross-linking methods. Suitable cross-linking agents are well known in the art, and are disclosed in U.S. Pat. No. 4,676,980, along with a number of cross-linking techniques.
  • bispecific antibodies can be prepared using chemical linkage.
  • Brennan et al., Science, 229: 81 (1985) describe a procedure wherein intact antibodies are proteolytically cleaved to generate F(ab') 2 fragments. These fragments are reduced in the presence of the dithiol complexing agent sodium arsenite to stabilize vicinal dithiols and prevent intermolecular disulfide formation.
  • the Fab' fragments generated are then converted to thionitrobenzoate (TNB) derivatives.
  • One of the Fab'-TNB derivatives is then reconverted to the Fab'-thiol by reduction with mercaptoethylamine and is mixed with an equimolar amount of the other Fab'-TNB derivative to form the bispecific antibody.
  • the bispecific antibodies produced can be used as agents for the selective immobilization of enzymes.
  • bispecific antibodies have been produced using leucine zippers. Kostelny et al., J. Immunol, 148(5): 1547-1553
  • the leucine zipper peptides from the Fos and Jun proteins were linked to the Fab' portions of two different antibodies by gene fusion.
  • the antibody homodimers were reduced at the hinge region to form monomers and then re-oxidized to form the antibody
  • the "diabody” technology described by Hollinger et al., Proc. Natl. Acad. Sci. USA, 90:6444- 6448 (1993) has provided an alternative mechanism for making bispecific antibody fragments.
  • the fragments comprise a heavy-chain variable domain (V H ) connected to a light- chain variable domain (V L ) by a linker which is too short to allow pairing between the two domains on the same chain. Accordingly, the V H and V L domains of one fragment are forced to pair with the complementary V L and V H domains of another fragment, thereby forming two antigen-binding sites.
  • Another strategy for making bispecific antibody fragments by the use of single-chain Fv (sFv) dimers has also been reported. See Gruber et al, J. Immunol, 152:5368 (1994).
  • bispecific T cell engager or BiTE® approach (see, e.g., WO2004/106381, WO2005/061547,
  • a single polypeptide chain includes two single chain Fv (scFv) fragments, each having a variable heavy chain (V H ) and a variable light chain (V L ) domain separated by a polypeptide linker of a length sufficient to allow intramolecular association between the two domains.
  • This single polypeptide further includes a polypeptide spacer sequence between the two scFv fragments.
  • Each scFv recognizes a different epitope, and these epitopes may be specific for different cell types, such that cells of two different cell types are brought into close proximity or tethered when each scFv is engaged with its cognate epitope.
  • One particular embodiment of this approach includes a scFv recognizing a cell-surface antigen expressed by an immune cell, e.g., a CD3 polypeptide on a T cell, linked to another scFv that recognizes a cell-surface antigen expressed by a target cell, such as a malignant or tumor cell.
  • the bispecific T cell engager may be expressed using any prokaryotic cell expression system known in the art.
  • specific purification techniques see, e.g., EP1691833 may be necessary to separate monomeric bispecific T cell engagers from other multimeric species, which may have biological activities other than the intended activity of the monomer.
  • a solution containing secreted polypeptides is first subjected to a metal affinity chromatography, and polypeptides are eluted with a gradient of imidazole concentrations. This eluate is further purified using anion exchange chromatography, and polypeptides are eluted using with a gradient of sodium chloride concentrations.
  • the two chain protein is a part of a multispecific antibody or a bispecific antibody.
  • a multispecific antibody or a bispecific antibody may contain two or more monovalent antibodies of the present disclosure.
  • the first antigen binding domain of the bispecific antibody comprises one or more heavy chain constant domains, wherein the one or more heavy chain constant domains are selected from a first CHI (CHI ;) domain, a first CH2 (CH2;) domain, a first CH3 (CH3;) domain; and the second antigen binding domain of the bispecific antibody comprises one or more heavy chain constant domains, wherein the one or more heavy chain constant domains are selected from a second CHI (CHI 2 ) domain, second CH2 (CH2 2 ) domain, and a second CH3 (CH3 2 ) domain.
  • At least one of the one or more heavy chain constant domains of the first antigen binding domain is paired with another heavy chain constant domain of the second antigen binding domain.
  • the CH3i and CH3 2 domains each comprise a protuberance or cavity, and wherein the protuberance or cavity in the CH3i domain is positionable in the cavity or protuberance, respectively, in the CH3 2 domain.
  • the CH3i and CH3 2 domains meet at an interface between said protuberance and cavity. Examplary sets of amino acid substitutions in CH3i and CH3 2 domains are shown in Table 2 herein.
  • the CH2i and CH2 2 domains each comprise a protuberance or cavity, and wherein the protuberance or cavity in the CH2i domain is positionable in the cavity or protuberance, respectively, in the CH2 2 domain.
  • the CH2i and CH2 2 domains meet at an interface between said protuberance and cavity.
  • CH3 2 domain of an IgG contain one or more amino acid substitutions at residues selected from the group consisting of 347, 349, 350, 351, 366, 368, 370, 392, 394, 395, 398, 399, 405,
  • the protuberance comprises one or more introduced residues selected from the group consisting of arginine (R) residue, phenylalanine (F) residue, tyrosine (Y) residue, and tryptophan (W) residue.
  • the cavity comprises one or more introduced residues selected from the group consisting of alanine (A) residue, serine (S) residue, threonine (T) residue, and valine (V) residue.
  • the protuberance comprises one or more introduced residues selected from the group consisting of arginine (R) residue, phenylalanine (F) residue, tyrosine (Y) residue, and tryptophan (W) residue.
  • the cavity comprises one or more introduced residues selected from the group consisting of alanine (A) residue, serine (S) residue, threonine (T) residue, and valine (V) residue.
  • the protuberance comprises one or more introduced residues selected from the group consisting of arginine (R) residue, pheny
  • CH3 and/or CH2 domains are from an IgG (e.g., IgGl subtype, IgG2 subtype, IgG2A subtype, IgG2B subtype, IgG3, subtype, or IgG4 subtype).
  • one CH3 domain of the bispecific antibody comprises amino acid substitution T366Y
  • the other CH3 domain comprises amino acid substitution Y407T.
  • one CH3 domain comprises amino acid substitution T366W
  • the other CH3 domain comprises amino acid substitution Y407A.
  • one CH3 domain comprises amino acid substitution F405A
  • the other CH3 domain comprises amino acid substitution T394W.
  • one CH3 domain comprises amino acid substitutions T366Y and F405A, and the other CH3 domain comprises amino acid substitutions T394W and Y407T. In some embodiments, one CH3 domain comprises amino acid substitutions T366W and F405W, and the other CH3 domain comprises amino acid substitutions T394S and Y407A. In some embodiments, one CH3 domain comprises amino acid substitutions F405W and Y407A, and the other CH3 domain comprises amino acid substitutions T366W and T394S. In some embodiments, one CH3 domain comprises amino acid substitution F405W, and the other CH3 domain comprises amino acid substitution T394S.
  • the mutations are denoted by the original residue, followed by the position using the Kabat numbering system, and then the import residues. See also numbering in FIG. 5 of U.S. Pat. No. 8,216,805.
  • an antibody of the disclosure is a single-domain antibody.
  • a single-domain antibody is a single polypeptide chain comprising all or a portion of the heavy chain variable domain or all or a portion of the light chain variable domain of an antibody.
  • a single-domain antibody is a human single-domain antibody
  • a single-domain antibody consists of all or a portion of the heavy chain variable domain of an antibody.
  • amino acid sequence modification(s) of the antibodies described herein are contemplated.
  • Amino acid sequence variants of the antibody may be prepared by introducing appropriate changes into the nucleotide sequence encoding the antibody, or by peptide synthesis. Such modifications include, for example, deletions from, and/or insertions into and/or substitutions of, residues within the amino acid sequences of the antibody. Any combination of deletion, insertion, and substitution can be made to arrive at the final construct, provided that the final construct possesses the desired characteristics.
  • the amino acid alterations may be introduced in the subject antibody amino acid sequence at the time that sequence is made.
  • antibody variants having one or more amino acid substitutions are provided.
  • Sites of interest for substitutional mutagenesis include the HVRs and FRs.
  • Conservative substitutions are shown in Table 1 under the heading of "conservative substitutions.” More substantial changes are provided in Table 1 under the heading of "exemplary substitutions,” and as further described below in reference to amino acid side chain classes.
  • Amino acid substitutions may be introduced into an antibody of interest and the products screened for a desired activity, e.g., retained/improved antigen binding, decreased immunogenicity, or improved ADCC or CDC.
  • Amino acids may be grouped according to common side-chain properties: a. hydrophobic: Norleucine, Met, Ala, Val, Leu, He;
  • Non-conservative substitutions will entail exchanging a member of one of these classes for another class.
  • substitutional variant involves substituting one or more hypervariable region residues of a parent antibody (e.g. a humanized or human antibody).
  • a parent antibody e.g. a humanized or human antibody
  • the resulting variant(s) selected for further study will have modifications (e.g., improvements) in certain biological properties (e.g., increased affinity, reduced immunogenicity) relative to the parent antibody and/or will have substantially retained certain biological properties of the parent antibody.
  • An exemplary substitutional variant is an affinity matured antibody, which may be conveniently generated, e.g., using phage display-based affinity maturation techniques such as those described herein. Briefly, one or more HVR residues are mutated and the variant antibodies displayed on phage and screened for a particular biological activity (e.g. binding affinity).
  • Alterations may be made in HVRs, e.g., to improve antibody affinity. Such alterations may be made in HVR "hotspots," i.e., residues encoded by codons that undergo mutation at high frequency during the somatic maturation process (see, e.g.,
  • affinity maturation diversity is introduced into the variable genes chosen for maturation by any of a variety of methods (e.g., error-prone PCR, chain shuffling, or oligonucleotide-directed mutagenesis).
  • a secondary library is then created. The library is then screened to identify any antibody variants with the desired affinity.
  • Another method to introduce diversity involves HVR-directed approaches, in which several HVR residues (e.g., 4-6 residues at a time) are randomized. HVR residues involved in antigen binding may be specifically identified, e.g., using alanine scanning mutagenesis or modeling. CDR-H3 and CDR-L3 in particular are often targeted.
  • substitutions, insertions, or deletions may occur within one or more HVRs so long as such alterations do not substantially reduce the ability of the antibody to bind antigen.
  • conservative alterations e.g., conservative substitutions as provided herein
  • Such alterations may be outside of HVR "hotspots" or SDRs.
  • each HVR either is unaltered, or contains no more than one, two or three amino acid substitutions.
  • a useful method for identification of residues or regions of an antibody that may be targeted for mutagenesis is called "alanine scanning mutagenesis" as described by
  • a residue or group of target residues e.g., charged residues such as arg, asp, his, lys, and glu
  • a neutral or negatively charged amino acid e.g., alanine or polyalanine
  • Further substitutions may be introduced at the amino acid locations demonstrating functional sensitivity to the initial substitutions.
  • a crystal structure of an antigen-antibody complex to identify contact points between the antibody and antigen. Such contact residues and neighboring residues may be targeted or eliminated as candidates for substitution.
  • Variants may be screened to determine whether they contain the desired properties.
  • Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues.
  • terminal insertions include an antibody with an N-terminal methionyl residue.
  • Other insertional variants of the antibody molecule include the fusion to the N- or C-terminus of the antibody to an enzyme (e.g., for ADEPT) or a polypeptide which increases the serum half-life of the antibody.
  • one or more amino acid modifications may be introduced into the Fc region of an antibody provided herein, thereby generating an Fc region variant.
  • the Fc region variant may comprise a human Fc region sequence (e.g., a human IgGl, IgG2, IgG3 or IgG4 Fc region) comprising an amino acid modification (e.g. a substitution) at one or more amino acid positions.
  • the disclosure contemplates an antibody variant that possesses some but not all effector functions, which make it a desirable candidate for applications in which the half life of the antibody in vivo is important yet certain effector functions (such as complement and ADCC) are unnecessary or deleterious.
  • In vitro and/or in vivo cytotoxicity assays can be conducted to confirm the reduction/depletion of CDC and/or ADCC activities.
  • Fc receptor (FcR) binding assays can be conducted to ensure that the antibody lacks FcyR binding (hence likely lacking ADCC activity), but retains FcRn binding ability.
  • NK cells express Fc(RIII only, whereas monocytes express Fc(RI, Fc(RII and Fc(RIII.
  • FcR expression on hematopoietic cells is summarized in Table 3 on page 464 of Ravetch and Kinet, Annu. Rev. Immunol.
  • non-radioactive assays methods may be employed (see, for example, ACTITM non-radioactive cytotoxicity assay for flow cytometry
  • PBMC peripheral blood mononuclear cells
  • NK Natural Killer
  • ADCC activity of the molecule of interest may be assessed in vivo, e.g., in an animal model such as that disclosed in Clynes et al. Proc. Nat'lAcad. Sci. USA 95:652-656 (1998).
  • Clq binding assays may also be carried out to confirm that the antibody is unable to bind Clq and hence lacks CDC activity.
  • a CDC assay may be performed (see, for example, Gazzano-Santoro et al., J. Immunol. Methods 202:163 (1996); Cragg, M.S. et al., Blood 101:1045-1052 (2003); and Cragg, M.S. and M.J. Glennie, Blood 103:2738-2743 (2004)).
  • FcRn binding and in vivo clearance/half life determinations can also be performed using methods known in the art (see, e.g., Petkova, S.B. et al., Int'l. Immunol. 18(12):1759- 1769 (2006)).
  • Antibodies with reduced effector function include those with substitution of one or more of Fc region residues 238, 265, 269, 270, 297, 327 and 329 (U.S. Patent No. 6,737,056).
  • Fc mutants include Fc mutants with substitutions at two or more of amino acid positions 265, 269, 270, 297 and 327, including the so-called "DANA" Fc mutant with substitution of residues 265 and 297 to alanine (US Patent No. 7,332,581).
  • an antibody variant comprises an Fc region with one or more amino acid substitutions which improve ADCC, e.g., substitutions at positions 298, 333, and/or 334 of the Fc region (EU numbering of residues).
  • the antibody comprising the following amino acid substitutions in its Fc region: S298A, E333A, and K334A.
  • alterations are made in the Fc region that result in altered (i.e., either improved or diminished) Clq binding and/or Complement Dependent
  • Cytotoxicity e.g., as described in US Patent No. 6,194,551, WO 99/51642, and Idusogie et al. J. Immunol. 164: 4178-4184 (2000).
  • Such Fc variants include those with substitutions at one or more of Fc region residues: 238, 256, 265, 272, 286, 303, 305, 307, 311, 312, 317, 340, 356, 360, 362, 376, 378, 380, 382, 413, 424 or 434, e.g., substitution of Fc region residue 434 (US Patent No. 7,371,826). See also Duncan & Winter, Nature 322:738-40 (1988); U.S. Patent No. 5,648,260; U.S. Patent No. 5,624,821; and WO 94/29351 concerning other examples of Fc region variants.
  • the antibodies of the disclosure can be further modified to contain additional nonproteinaceous moieties that are known in the art and readily available.
  • the moieties suitable for derivatization of the antibody are water soluble polymers.
  • water soluble polymers include, but are not limited to, polyethylene glycol (PEG), copolymers of ethylene glycol/propylene glycol,
  • polyethylene glycol propionaldehyde may have advantages in manufacturing due to its stability in water.
  • the polymer may be of any molecular weight, and may be branched or unbranched.
  • the number of polymers attached to the antibody may vary, and if more than one polymer are attached, they can be the same or different molecules. In general, the number and/or type of polymers used for derivatization can be determined based on considerations including, but not limited to, the particular properties or functions of the antibody to be improved, whether the antibody derivative will be used in a therapy under defined conditions, etc.
  • Antibodies may also be produced using recombinant methods.
  • nucleic acid encoding the antibody is isolated and inserted into a replicable vector for further cloning (amplification of the DNA) or for expression.
  • DNA encoding the antibody may be readily isolated and sequenced using conventional procedures (e.g. , by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the antibody).
  • Many vectors are available.
  • the vector components generally include, but are not limited to, one or more of the following: a signal sequence, an origin of replication, one or more marker genes, an enhancer element, a promoter, and a transcription termination sequence.
  • An antibody of the disclosure may be produced recombinantly not only directly, but also as a fusion polypeptide with a heterologous polypeptide, which is preferably a signal sequence or other polypeptide having a specific cleavage site at the N-terminus of the mature protein or polypeptide.
  • a heterologous polypeptide which is preferably a signal sequence or other polypeptide having a specific cleavage site at the N-terminus of the mature protein or polypeptide.
  • the heterologous signal sequence selected preferably is one that is recognized and processed (e.g. , cleaved by a signal peptidase) by the host cell.
  • the signal sequence is substituted by a prokaryotic signal sequence selected, for example, from the group of the alkaline phosphatase, penicillinase, lpp, or heat-stable enterotoxin II leaders.
  • Both expression and cloning vectors contain a nucleic acid sequence that enables the vector to replicate in one or more selected host cells. Generally, in cloning vectors this sequence is one that enables the vector to replicate independently of the host chromosomal DNA, and includes origins of replication or autonomously replicating sequences. Such sequences are well known for a variety of prokaryotic host cells. For example, the origin of replication from the plasmid pBR322 is suitable for most Gram-negative bacteria. (c) Selection Gene Component
  • Expression and cloning vectors may contain a selection gene, also termed a selectable marker.
  • selection genes encode proteins that (a) confer resistance to antibiotics or other toxins, e.g., ampicillin, neomycin, methotrexate, or tetracycline, (b) complement auxotrophic deficiencies, or (c) supply critical nutrients not available from complex media, e.g., the gene encoding D-alanine racemase for Bacilli.
  • One example of a selection scheme utilizes a drug to arrest growth of a host cell. Those cells that are successfully transformed with a heterologous gene produce a protein conferring drug resistance and thus survive the selection regimen. Examples of such dominant selection use the drugs neomycin, mycophenolic acid and hygromycin.
  • Another selection scheme uses a prokaryotic host cell with a chromosomal deletion removing a gene whose gene product is essential for growth in a particular culture medium.
  • those cells that are successfully transformed with a heterologous gene that complements the chromosomal deletion of the host cell will survive when grown in the particular culture medium. Examples of genes useful in this schemes may include
  • auxotrophic marker genes or other genes that are required to generate an essential nutrient when the host cell is grown in a particular culture medium.
  • Expression and cloning vectors generally contain a promoter that is recognized by the host organism and is operably linked to nucleic acid encoding an antibody.
  • Promoters suitable for use with prokaryotic hosts include the phoA promoter, ⁇ -lactamase and lactose promoter systems, alkaline phosphatase promoter, a tryptophan (trp) promoter system, and hybrid promoters such as the tac promoter.
  • trp tryptophan
  • Other known bacterial promoters are suitable. Promoters for use in bacterial systems also will contain a Shine-Dalgarno (S.D.) sequence operably linked to the DNA encoding an antibody.
  • S.D. Shine-Dalgarno
  • TIRs translational initiation regions
  • a TIR may determine the efficiency of translation of a translational unit.
  • a TIR typically includes translational unit features such as the initiation codon, Shine-Dalgarno (SD) sequence, and translational enhancers.
  • SD Shine-Dalgarno
  • a TIR may further include a secretion signal sequence that encodes a signal peptide. The sequence and spacing between features of a TIR may regulate translational initiation efficiency.
  • TIR translation initiation region
  • Expression vectors used in prokaryotic host cells may also contain sequences necessary for the termination of transcription and for stabilizing the mRNA.
  • terminators may include Rho-dependent or Rho-independent terminators.
  • a terminator useful in prokaryotic host cells includes without limitation the ⁇ terminator (Scholtissek and Grosse, Nucleic Acids Res. 15:3185, 1987).
  • a polypeptide containing two chains in a prokaryotic host cell by culturing the host cell to express the two chains of the polypeptide, where upon expression the two chains fold and assemble to form a biologically active polypeptide in the host cell, wherein the host cell is cultured in a culture medium under conditions including: a growth phase including a growth temperature and a growth agitation rate, and a production phase including a production temperature and a production agitation rate, where the growth temperature is from 2 to 10°C above the production temperature, and the growth agitation rate is from 50 to 250 rpm above the production agitation rate. It is a surprising discovery of the present disclosure that certain production process optimizations have a dramatic increase in the yield of two chain proteins, as demonstrated by the data described herein.
  • Suitable prokaryotes for cloning or expressing the DNA in the vectors herein include eubacteria, such as Gram-negative or Gram-positive organisms, for example, Enterobacteriaceae such as Escherichia, e.g., E. coli, Enterobacter, Erwinia, Klebsiella, Proteus, Salmonella, e.g., Salmonella typhimurium, Serratia, e.g., Serratia marcescans, and Shigella, as well as Bacilli such as B. subtilis and B. licheniformis (e.g., B.
  • Enterobacteriaceae such as Escherichia, e.g., E. coli, Enterobacter, Erwinia, Klebsiella, Proteus
  • Salmonella e.g., Salmonella typhimurium
  • Serratia e.g., Serratia marcescans
  • Shigella Shigella
  • Bacilli such
  • E. coli 294 ATCC 31,446
  • E. coli B E. coli X1776
  • E. coli W3110 ATCC 27,325
  • the prokaryotic host cell is a gram-negative bacterium.
  • Gram-negative bacterium refers to any bacterium that contains an outer membrane surrounding the peptidoglycan layer detected by Gram staining.
  • Many gram-negative bacterial host cells are known in the art.
  • gram-negative bacteria are known to include without limitation proteobacteria, such as Alphapwteobacteria, Betapwteobacteria, Gammaproteobacteria, Zetaproteobacteria, Epsilonproteobacteria, Deltaproteobacteria, and Acidobacteria; cyanobacteria; and spirochaetes.
  • Well known gram-negative bacteria may include species from genera such as Eschericia, Salmonella, Shigella, Pseudomonas, Heliobacter, Legionella, Neisseria, and Klebsiella.
  • a gram-negative bacterium of the present disclosure is E. coli.
  • E. coli may refer to any strain or isolate of bacteria belonging to the species E. coli.
  • E. coli may include naturally occurring strains or strains that have been genetically modified, such as by mutation or transformation with a plasmid as described herein.
  • an E. coli of the present disclosure is of a strain deficient in endogenous protease activity.
  • strains deficient in endogenous protease activity may allow for enhanced production of recombinant proteins, such as periplasmic proteins of the present disclosure, because some endogenous proteases have activity against recombinantly expressed substrates (see Baneyx F and Georgiu G 1990 J. Bacteriol. 172(1):491 for one such example).
  • Strains deficient in endogenous protease activity may include strains in which a gene encoding an endogenous protease is mutated, deleted, or otherwise inactivated.
  • genes may include, without limitation, degP, pre, and ompT.
  • Methods for introducing mutations in a wide variety of prokaryotic host cells are well known in the art; see, e.g., Snyder L et al. 2013 Molecular Genetics of Bacteria 4 th ed. ASM Press).
  • Two chain proteins such as full length antibody, antibody fusion proteins, and antibody fragments can be produced in bacteria, in particular when glycosylation and Fc effector function are not needed, such as when the therapeutic antibody is conjugated to a cytotoxic agent (e.g., a toxin) that by itself shows effectiveness in tumor cell destruction.
  • a cytotoxic agent e.g., a toxin
  • Full length antibodies have greater half-life in circulation. Production in E. coli is faster and more cost efficient.
  • For expression of antibody fragments and polypeptides in bacteria see, e.g., U.S. Pat. No. 5,648,237 (Carter et. al.), U.S. Pat. No. 5,789,199 (Joly et al.), U.S. Pat. No.
  • Host cells are transformed with the above-described expression or cloning vectors for two chain protein production and cultured in conventional nutrient media modified as appropriate for inducing promoters, selecting transformants, or amplifying the genes encoding the desired sequences.
  • Certain aspects of the present disclosure relate to culturing a host cell in a culture medium under conditions including a growth phase and a production phase.
  • a growth phase may include a growth temperature and a growth agitation rate
  • a production phase may include a production temperature and a production agitation rate.
  • a growth phase may refer to any time during which a culture of host cells is exponentially growing.
  • Growth temperature as used herein may refer to the temperature of a culture medium containing a host cell of the present disclosure during a growth phase of the host cell.
  • a growth phase of a host cell culture may be determined by methods commonly known in the art, e.g., by measuring the optical density of the culture (e.g., at a wavelength of about 550 nm, about 600 nm, or a wavelength in between) over time and determining at what time the exponential growth phase ceases.
  • a growth phase may refer to any time during which a culture of host cells is exponentially growing and the concentration of phosphate in the culture medium is sufficient to prevent the induction of pho promoter-mediated gene transcription.
  • a production phase may refer to any time during which a culture of host cells is producing a product.
  • Production temperature as used herein may refer to the temperature of a culture medium containing a host cell of the present disclosure during a production phase of the host cell. If a host cell contains a vector with a pho promoter driving expression of a product, a production phase may refer to any time during which the concentration of phosphate in the culture medium is sufficiently low to induce pho promoter-mediated product gene transcription.
  • a host cell of the present disclosure is cultured at a growth temperature from 2°C to 10°C above the production temperature. In some embodiments, a host cell of the present disclosure is cultured at a growth temperature 2°C, 3°C, 4°C, 5°C, 6°C, 7°C, 8°C, 9°C, or 10°C above the production temperature. In some embodiments, the growth temperature is above the production temperature by less than about any of the following amounts (in °C): 10, 9.5, 9, 8.5, 8, 7.5, 7, 6.5, 6, 5.5, 5, 4.5, 4, 3.5, 3, or 2.5.
  • the growth temperature is above the production temperature by greater than about any of the following amounts (in °C): 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, or 9.5. That is, the growth temperature is above the production temperature by any of a range of amounts (in °C) having an upper limit of 10, 9.5, 9, 8.5, 8, 7.5, 7, 6.5, 6, 5.5, 5, 4.5, 4, 3.5, 3, or 2.5 and an independently selected lower limit of 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, or 9.5, wherein the lower limit is less than the upper limit.
  • the growth temperature is in the range of about 30°C to about 34°C during the growth phase. In some embodiments, the growth temperature is about 30°C, about 30.5°C, about 31°C, about 31.5°C, about 32°C, about 32.5°C, about 33°C, about 33.5°C, or about 34°C during the growth phase. In some embodiments, the growth temperature during the growth phase is less than about any of the following temperatures (in °C): 34, 33.5, 33, 32.5, 32, 31.5, 31, or 30.5. In some embodiments, the growth temperature during the growth phase is greater than about any of the following temperatures (in °C): 30, 30.5, 31, 31.5, 32, 32.5, 33, or 33.5.
  • the growth temperature during the growth phase can be any of a range of temperatures (in °C) having an upper limit of 34, 33.5, 33, 32.5, 32, 31.5, 31, or 30.5 and an independently selected lower limit of 30, 30.5, 31, 31.5, 32, 32.5, 33, or 33.5, wherein the lower limit is less than the upper limit.
  • the production temperature is in the range of about 25°C to about 29°C during the production phase. In some embodiments, the production temperature is about 25°C, about 25.5°C, about 26°C, about 26.5°C, about 27°C, about 27.5°C, about 28°C, about 28.5°C, or about 29°C during the production phase. In some embodiments, the production temperature during the production phase is less than about any of the following temperatures (in °C): 29, 28.5, 28, 27.5, 27, 26.5, 26, or 25.5. In some embodiments, the production temperature during the production phase is greater than about any of the following temperatures (in °C): 25, 25.5, 26, 26.5, 27, 27.5, 28, or 28.5.
  • the production temperature during the production phase can be any of a range of temperatures (in °C) having an upper limit of 29, 28.5, 28, 27.5, 27, 26.5, 26, or 25.5 and an independently selected lower limit of 25, 25.5, 26, 26.5, 27, 27.5, 28, or 28.5, wherein the lower limit is less than the upper limit.
  • An agitation rate refers to the rate at which a cell culture is agitated (e.g., by shaking).
  • Growth agitation rate as used herein may refer to the rate at which a culture containing a host cell of the present disclosure is agitated during a growth phase of the host cell.
  • Production agitation rate as used herein may refer to the rate at which a culture containing a host cell of the present disclosure is agitated during a production phase of the host cell.
  • Cell cultures may be agitated to maintain aeration of the cell culture.
  • a host cell of the present disclosure is cultured at a growth agitation rate from 50 to 250 rpm above the production agitation rate. In some embodiments, a host cell of the present disclosure is cultured at a growth agitation rate of 50 rpm, 75 rpm, 100 rpm, 125 rpm, 150 rpm, 175 rpm, 200 rpm, 225 rpm, or 250 rpm above the production agitation rate. In some embodiments, the growth agitation rate is above the production agitation rate by less than about any of the following rates (in rpm): 250, 225, 200, 175, 150, 125, 100, or 75.
  • the growth agitation rate is below the production agitation rate by greater than about any of the following rates (in rpm): 50, 75, 100, 125, 150, 175, 200, or 225. That is, the growth agitation rate is above the production agitation rate by any of a range of rates (in rpm) having an upper limit of 250, 225, 200, 175, 150, 125, 100, or 75 and an independently selected lower limit of 50, 75, 100, 125, 150, 175, 200, or 225, wherein the lower limit is less than the upper limit.
  • the growth agitation rate is in the range of about 600 to 800 rpm during the growth phase. In some embodiments, the growth agitation rate is about 600 rpm, about 625 rpm, about 650 rpm, about 675 rpm, about 700 rpm, about 725 rpm, about 750 rpm, about 775 rpm, or about 800 rpm during the growth phase. In some embodiments, the growth agitation rate is less than about any of the following rates (in rpm): 800, 775, 750, 725, 700, 675, 650, or 625.
  • the growth agitation rate is greater than about any of the following rates (in rpm): 600, 625, 650, 675, 700, 725, 750, or 775 during the growth phase. That is, the growth agitation rate during the growth phase is any of a range of rates (in rpm) having an upper limit of 800, 775, 750, 725, 700, 675, 650, or 625 and an independently selected lower limit of 600, 625, 650, 675, 700, 725, 750, or 775, wherein the lower limit is less than the upper limit. [0263] In some embodiments, the production agitation rate is in the range of about 300 to 500 rpm during the production phase.
  • the production agitation rate during the production phase is about 300 rpm, about 325 rpm, about 350 rpm, about 375 rpm, about 400 rpm, about 425 rpm, about 450 rpm, about 475 rpm, or about 500 rpm. In some embodiments, the production agitation rate during the production phase is less than about any of the following rates (in rpm): 500, 475, 450, 425, 400, 375, 350, or 325. In some embodiments, the production agitation rate during the production phase is greater than about any of the following rates (in rpm): 300, 325, 350, 375, 400,425, 450, or 475.
  • the production agitation rate during the production phase is any of a range of rates (in rpm) having an upper limit of 500, 475, 450, 425, 400, 375, 350, or 325 and an independently selected lower limit of 300, 325, 350, 375, 400,425, 450, or 475, wherein the lower limit is less than the upper limit.
  • the oxygen transfer rate is equal to the oxygen uptake rate (OUR) or metabolic rate of the cells.
  • OUR oxygen uptake rate
  • Manipulation of the OTR may be facilitated by adjusting the agitation rate, thus manipulating the OUR. More detailed description of OUR and its relationship to OTR may be found in Ochoa-Garcia et al., Biotechnol. Adv. 27:153, 2009.
  • Techniques for measuring the OUR of a cell culture are known in the art and include, without limitation, using a mass spectrometer to monitor the composition of the off-gas from the cell culture and calculating the oxygen uptake and carbon dioxide evolution rates of the cell culture.
  • a host cell of the present disclosure is cultured at a growth agitation rate sufficient to achieve an oxygen uptake rate in the host cell during the growth phase of from 0.5 to 2.5 mmol/L/min above a peak oxygen uptake rate in the host cell during the production phase. It is a discovery of the present disclosure that decreasing the agitation rate of a cell culture during the production phase to a rate sufficient to achieve an oxygen uptake rate in the host cell less than about 2.5 mmol/L/min as compared to the growth phase greatly enhances the production of a product, such as a two chain polypeptide of the present disclosure.
  • a host cell of the present disclosure is cultured at a growth agitation rate sufficient to achieve an oxygen uptake rate in the host cell during the growth phase of 0.5 mmol/L/min, 1.0 mmol/L/min, 1.5 mmol/L/min, 2.0 mmol/L/min, or 2.5 mmol/L/min above a peak oxygen uptake rate in the host cell during the production phase.
  • a host cell of the present disclosure is cultured at a growth agitation rate sufficient to achieve an oxygen uptake rate in the host cell during the growth phase of less than about any of the following oxygen uptake rates (in mmol/L/min) above a peak oxygen uptake rate in the host cell during the production phase: 2.5, 2.0, 1.5, or 1.0. In some embodiments, a host cell of the present disclosure is cultured at a growth agitation rate sufficient to achieve an oxygen uptake rate in the host cell during the growth phase of greater than about any of the following oxygen uptake rates (in mmol/L/min) above a peak oxygen uptake rate in the host cell during the production phase: 0.5, 1.0, 1.5, 2.0, or 2.5.
  • a host cell of the present disclosure is cultured at a growth agitation rate sufficient to achieve an oxygen uptake rate in the host cell during the growth phase of any of a range of oxygen uptake rates (in in mmol/L/min) having an upper limit of 2.5, 2.0, 1.5, or 1.0 and an independently selected lower limit of 0.5, 1.0, 1.5, 2.0, or 2.5 above a peak oxygen uptake rate in the host cell during the production phase, wherein the lower limit is less than the upper limit.
  • a range of oxygen uptake rates in in mmol/L/min
  • the peak oxygen uptake rate of the host cell during the growth phase is in the range of 3.5 mmol/L/min to 4.5 mmol/L/min. In some embodiments, the peak oxygen uptake rate of the host cell during the growth phase is 3.5 mmol/L/min, 3.75 mmol/L/min, 4.0 mmol/L/min, 4.25 mmol/L/min, or 4.5 mmol/L/min. In some embodiments, the oxygen uptake rate of the host cell during the production phase is in the range of 1.0 mmol/L/min to 3.0 mmol/L/min.
  • the oxygen uptake rate of the host cell during the production phase is 1.0 mmol/L/min, 1.25 mmol/L/min, 1.5 mmol/L/min, 1.75 mmol/L/min, 2.0 mmol/L/min, 2.25 mmol/L/min, 2.5 mmol/L/min, 2.75 mmol/L/min, or 3.0 mmol/L/min.
  • a host cell of the present disclosure is cultured at a growth agitation rate from about 10% to about 40% (rpm/rpm) higher than the production agitation rate. In some embodiments, the host cell is cultured at a growth agitation rate that has a lower limit of at least 10%, 15%, 20%, 25%, 30%, or 35% (rpm/rpm) and an independently selected upper limit of no more than 40%, 35%, 30%, 25%, 20%, or 15% (rpm/rpm) of a production agitation rate. In a preferred embodiment, a host cell of the present disclosure is cultured in a
  • Host cells of the present disclosure may be cultured in a variety of media.
  • “Culture medium” as used herein refers to any composition or broth that supports the growth of the bacteria of the present disclosure.
  • Suitable culture media may be liquid or solid and contain any nutrients, salts, buffers, elements, and other compounds that support the growth and viability of cells.
  • Common nutrients of a culture medium may include sources of nitrogen, carbon, amino acids, carbohydrates, trace elements, vitamins, and minerals. These nutrients may be added as individual components (as in a defined culture medium) or as constituents of a complex extract (for example, yeast extract).
  • a culture medium may be nutrient-rich to support rapid growth or minimal to support slower growth.
  • a culture medium may also contain any agent used to inhibit the growth of or kill contaminating organisms (e.g., an antibiotic).
  • a culture medium may also contain any compound used to control the activity of an inducible promoter or enzyme (as one example, IPTG may be included to induce expression of any polynucleotides controlled by a lac operon or functionally similar promoter).
  • IPTG may be included to induce expression of any polynucleotides controlled by a lac operon or functionally similar promoter.
  • suitable culture media include without limitation M9 medium, Lysogeny Broth (LB), Terrific Broth (TB), NZY broth, SOB medium, and YT broth.
  • any of these media may be supplemented as necessary with salts (such as sodium chloride, calcium, magnesium, and phosphate), buffers (such as HEPES), nucleotides (such as adenosine and thymidine), antibiotics, antimycotics, trace elements (defined as inorganic compounds usually present at final concentrations in the micromolar range), glucose, and/or an appropriate energy source.
  • salts such as sodium chloride, calcium, magnesium, and phosphate
  • buffers such as HEPES
  • nucleotides such as adenosine and thymidine
  • antibiotics such as adenosine and thymidine
  • trace elements defined as inorganic compounds usually present at final concentrations in the micromolar range
  • glucose and/or an appropriate energy source.
  • Typical ingredients found in a prokaryotic cell culture medium include yeast extract, salts (e.g, NaCl), tryptone, buffers (e.g., phosphate buffer), glycerol, and
  • Certain aspects of the present disclosure relate to recovering a biologically active polypeptide from a host cell.
  • recovering the terms “purifying” or “purification” may be used interchangeably herein
  • a biologically active polypeptide of the present disclosure involves isolating the polypeptide from the host cell (or cell culture medium if the polypeptide is excreted into the medium) and purifying the polypeptide from other associated macromolecules, e.g., cellular debris and other polypeptides.
  • Numerous techniques for purifying a variety of proteins from a variety of host cell compartments are known in the art (see, e.g., Evans, Jr., TC and Xu MQ (eds.) Heterologous Gene Expression in E.
  • two chain proteins such as secretory proteins can be produced intracellularly, in the periplasmic space, or directly secreted into the medium. If the secretory protein is produced intracellularly, as a first step, the particulate debris, either host cells or lysed fragments, are removed, for example, by centrifugation or ultrafiltration.
  • the secretory protein is recovered from the periplasm of the host cell.
  • Carter et ah, Bio/Technology 10:163-167 (1992) describe a procedure for isolating secretory proteins which are secreted to the periplasmic space of E. coli. Briefly, cell paste is thawed in the presence of sodium acetate (pH 3.5), EDTA, and phenylmethylsulfonylfluoride (PMSF) over about 30 min. Cell debris can be removed by centrifugation.
  • sodium acetate pH 3.5
  • EDTA EDTA
  • PMSF phenylmethylsulfonylfluoride
  • secretory protein is secreted into the medium
  • supernatants from such expression systems are generally first concentrated using a commercially available protein concentration filter, for example, an Amicon or Millipore Pellicon ultrafiltration unit.
  • a protease inhibitor such as PMSF may be included in any of the foregoing steps to inhibit proteolysis and antibiotics may be included to prevent the growth of adventitious contaminants.
  • the secretory protein composition prepared from the cells can be purified using, for example, hydroxylapatite chromatography, hydrophobic interaction chromatography, gel electrophoresis, dialysis, and affinity chromatography, with affinity chromatography being among one of the typically preferred purification steps.
  • affinity chromatography is among one of the typically preferred purification steps.
  • the suitability of protein A as an affinity ligand depends on the species and isotype of any immunoglobulin Fc domain that is present in the antibody.
  • Protein A can be used to purify antibodies that are based on human ⁇ , ⁇ 2, or ⁇ 4 heavy chains (Lindmark et ah, J. Immunol. Meth. 62:1-13 (1983)).
  • Protein G is recommended for all mouse isotypes and for human ⁇ 3 (Guss et al., EMBO J. 5:15671575 (1986)).
  • the matrix to which the affinity ligand is attached is most often agarose, but other matrices are available. Mechanically stable matrices such as controlled pore glass or poly(styrenedivinyl)benzene allow for faster flow rates and shorter processing times than can be achieved with agarose.
  • the antibody comprises a C H 3 domain
  • the Bakerbond ABXTM resin J. T. Baker, Phillipsburg, N.J.
  • Ab antibody
  • hAb half antibody
  • HC heavy chain
  • IPTG isopropyl ⁇ -D-l-thiogalactopyranoside
  • LC light chain
  • OD optical density
  • ORF open reading frame
  • OTR oxygen transfer rate
  • OUR oxygen uptake rate
  • Tg growth temperature
  • Tp production temperature
  • TIR translation initiation region
  • xIL4 anti- interleukin-4
  • xIL13 anti-interleukin-13
  • xIL17 anti-interleukin-17
  • xIL33 anti- interleukin-33
  • Example 1 Effect of Chaperone and Oxidoreductase Levels on Half -Antibody
  • heterologous secreted proteins are important for many therapeutic molecules.
  • Multispecific antibodies e.g., bispecific antibodies
  • heterologous secreted proteins with many important therapeutic uses, such as immunotherapy in cancer and other applications.
  • hAbs half-antibodies
  • HC heavy chain
  • LC light chain
  • FkpA, DsbA, and DsbC chaperone proteins
  • Vectors were constructed in a similar fashion to those described in EP1356052. In particular, various expression vectors were made for the expression of hAbs. For each vector, an expression cassette was cloned into the framework of the E. coli plasmid pBR322 at the EcoRI site (Sutcliffe, Cold Spring Harbor Symp. Quant. Biol. 43:77-90, 1978). Each expression cassette contained at least the following components: (1) a phoA promoter for the control of transcription (Kikuchi et al., Nucleic Acids Res. 9:5671-5678, 1981); (2) a Shine- Dalgarno sequence from the E.
  • coli trp the heat stable enterotoxin II (STII) signal sequence, or a combination of both for translation initiation (Chang et al., Gene 55:189-196, 1987); and (3) a ⁇ terminator to end transcription (Scholtissek and Grosse, Nucleic Acids Res.
  • STII enterotoxin II
  • STII signal sequence or silent codon variants of that signal sequence preceded the coding sequence for the light or heavy chain. This sequence directs the secretion of the polypeptide into the periplasm (Picken et al., Infect. Immun. 42:269-275, 1983; and Simmons and Yansura, Nature Biotechnology 14:629-634, 1996).
  • Vectors with separate cistrons were designed to provide independent expression of the immunoglobulin light and heavy chain genes.
  • the cistron unit for each chain is under the control of its own PhoA promoter and is followed by a ⁇ terminator.
  • each cistron incorporated the TIR (translation initiation region) to modulate expression of both light and heavy chains (Simmons et al., J. Immunol. Meth., 263:133-147, 2002).
  • the expression cassette contains, from 5' to 3', a first PhoA promoter followed by the cistron for light chain (TIR-L + Light Chain) and the first ⁇ terminator, and a second PhoA promoter followed by the cistron for heavy chain (TIR-H + Heavy Chain) and the second ⁇ terminator.
  • the expression cassette contains, from 5' to 3', a first PhoA promoter followed by the cistron for heavy chain (TIR-H + Heavy Chain) and the first ⁇ terminator, and a second PhoA promoter followed by the cistron for light chain (TIR-L + Light Chain) and the second ⁇ terminator. Both TIR-L and TIR-H are contained within an STII signal sequence or a variant thereof.
  • a TIR combination of 1,1 and 2,2 was evaluated.
  • a TIR2,2 was evaluated. The first number represents the TIR strength of the light chain and the second represents the TIR strength of the heavy chain.
  • other IgGl isotype hAb vectors were constructed and tested. Chaperone expression plasmid construction
  • plasmids were provided for co-expression.
  • a number of known chaperones were tested including FkpA protein, a peptidylproyl cis-trans isomerase with chaperone activity.
  • compatible plasmids pACYC, Novagen, Madison, WI
  • pACYC Novagen, Madison, WI
  • FkpA compatible vectors were similarly generated to modulate the levels of FkpA co-expression.
  • the modulation of FkpA levels was accomplished through optimization of the signal peptide as previously described (Simmons and Yansura, supra, 1996). Briefly, the 5' end of the FkpA ORF contained either a FkpA signal peptide (native or variant), or an STII signal peptide. All FkpA variant gene constructs were under the control of a tacll promoter.
  • TIR1 ,1 and TIR2,2 plasmids encoding the LC and HC of the half antibody and FkpA were constructed and used to transform 66F8.
  • the expression of FkpA was controlled by a phoA promoter upstream of the ORF for the LC.
  • the pBR322 plasmid is typically maintained at approximately 30 copies/cell (Bolivar et al., Gene, 2:95-113, 1977) and the pACYC plasmid is typically maintained at approximately 15 copies/cell (Chang and Cohen, J. Bacteriol., 134:1141-1156, 1978).
  • Single plasmids encoding the LC and HC of the hAb and the chaperones FkpA, DsbA and DsbC were also constructed and used to transform 66F8.
  • two TIR2,2 single plasmids were constructed differing in the promoter used to drive the expression of FkpA.
  • the single plasmid MD157 contained a phoA promoter for FkpA expression and the plasmid KA01 contained a tacll promoter. The utilization of different promoters allowed further modulation of FkpA expression.
  • a TIR2,2 single plasmid was constructed (MD341), which utilized a phoA promoter for FkpA expression. In all single plasmid conditions, expression of DsbA and DsbC were under the control of a tacll promoter in a polycistronic fashion.
  • a TIR2,2 single plasmid was constructed that incorporated the ORFs of the compatible chaperone plasmid AH8145, described below, and identified as CB1.
  • the fermentor initially contained approximately 7.0 liters of medium containing 1.1 g of glucose, 100 ml of 1M magnesium sulfate, 10 ml of a trace element solution (100 ml hydrochloric acid, 27 g ferric chloride hexahydrate, 8 g zinc sulfate heptahydrate, 7 g cobalt chloride hexahydrate, 7 g sodium molybdate dihydrate, 8 g cupric sulfate pentahydrate, 2 g boric acid, 5 g manganese sulfate monohydrate, in a final volume of 1 liter), either 20 ml of a tetracycline solution (5 mg/ml in ethanol) or 250 mL of an ampicillin solution (2 mg/mL), 1 bag of HCD salts, (37.5 g ammonium sulfate, 19.5 g potassium phosphate dibasic, 9.75 g sodium phosphate monobasic dihydrate, 7.5 g sodium citrate di
  • Fermentations were initially performed at 30°C with 20 standard liters per minute (slpm) of air flow and were controlled at a pH of 7.0 + 0.2 (although occasional excursions beyond this range occurred in some cases).
  • the back pressure of the fermentor was maintained at 1 bar gauge and the agitation rate was initially set to 650 rpm.
  • the agitation rate can also be varied to manipulate the oxygen transfer rate in the fermentor, and, consequently, control the cellular respiration rate.
  • the temperature during the growth and production phases can be adjusted to maximize product yield.
  • the culture was grown in the fermentor to high cell densities using a computer- based algorithm to feed a concentrated glucose solution to the fermentor.
  • Ammonium hydroxide (58% solution) and sulfuric acid (24% solution) were also fed to the fermentor as needed to control pH.
  • L-61 antifoam was also added in some cases to control foaming.
  • Non-reduced soluble sample prep is similar to what is described in EP1356052 (see, e.g., Example 4, in particular paragraph [0162]).
  • non-reduced soluble samples were prepared as follows: frozen, 1 mL whole broth samples taken during the course of the fermentation were thawed at room temperature. 100 ⁇ ⁇ of the thawed whole broth was added to 500 ⁇ ⁇ of extraction buffer.
  • extraction buffer 10 mM Tris, pH 6.8, 5 mM EDTA, freshly added 0.2 mg/mL of hen egg lysozyme, and freshly prepared iodoacetic acid to a final concentration of 5-10 mM.
  • the whole broth samples plus extraction buffer were incubated on ice for 5-10 minutes, then sonicated 2 x 10 pulses, then centrifuged at 4°C and 14,000 rpm for 15-20 minutes. The supernatant was removed as the soluble fraction.
  • the soluble fraction was diluted 1:10 into 2X Novex Tricine sample buffer without reducing agent. 10 ⁇ ⁇ of this prep was loaded onto a 10 well Novex 10% Bis-Tris NuPage gel and electrophoresed at 150 V with MES buffer. The gel was then used for either an immunoblot or stained with Coomassie Blue.
  • LC-Kappa/RP assay Samples of the soluble fractions were submitted for analysis by a LC-Kappa/RP assay.
  • This assay is a 2-dimensional HPLC assay where the first column is an affinity column that captures kappa-light-chain containing IgG components and the second column is a reversed-phase column.
  • An integral HPLC workstation was configured in the dual column mode.
  • the solvent reservoirs were: Solvent 1A, affinity loading buffer; Solvent IB, affinity elution buffer, 0.2% TFA in water; Solvent 2A, reversed-phase aqueous buffer, 0.1% TFA in water; Solvent 2B, reversed-phase organic elution buffer, 0.1% TFA in 80% acetonitrile.
  • the first column was POROS ® CaptureSelectTM LC Kappa affinity column (2.1x 30 mm) purchased from Life Technologies (Carlsbad, CA). All procedures involving the affinity column were performed at ambient temperature.
  • the second column was POROS ® R2 20 ⁇ reversed-phase column (2.1x30 mm) purchased from Life Technologies (Carlsbad, CA). The reversed-phase column temperature was maintained at 80°C.
  • the affinity column was equilibrated in loading buffer, and a sample was loaded at a flow rate of 2 ml/min. The flow-through was directed to waste. After the sample was loaded, the affinity column was washed with loading buffer (3 ml) to reduce non- specifically bound components. Then, by valve switching, the affinity column was connected to the reversed-phase column and eluted with elution buffer (5 ml) at a flow rate of 2 ml/min to transfer the affinity captured components to the reversed-phase column. During this transfer step, the Integral UV detector was located after the affinity column and before the reversed- phase column, hence monitoring the elution of the affinity column, which became the load to the reversed-phase column. After elution and disconnection from the reversed-phased column, the affinity column was washed by water (2ml) and subsequently re-equilibrated with loading buffer (4 ml).
  • the flow rate was set to 2 ml/min and a rapid gradient (0.25 min) was run to 35% solvent 2B
  • the amount of total subunit production did not result in significant soluble subunit accumulation.
  • the total soluble amount of light and heavy chains produced was 0.2 g/L and less than 0.1 g/L, respectively (FIG. IB).
  • the total soluble amounts of light and heavy chains produced was 0.3 g/L and 0.3 g/L, respectively (FIG. 1C).
  • the titer of assembled xIL13 hAb produced for the TIR1,1 fermentation was only 0.1 g/L, and for the TIR2,2 fermentation the titer was less than 0.2 g/L (FIG. 2).
  • chaperone proteins are known to promote protein folding and assembly (FIG. 3A-B).
  • Particular chaperones of interest include FkpA, which is known to function as a peptidyl-prolyl cis-trans isomerase and a chaperone, and DsbA and DsbC, which are known to function as oxidoreductases. Experiments were undertaken to test whether expression of FkpA, DsbA, and DsbC affected hAb production.
  • the titer of the xVEGF hAb was 0.2 g/L and in the condition with the highest level of FkpA co-expression (FkpA(wt)) the hAb titer was approximately 0.4 g/L (FIG. 5B).
  • xIL13 hAb For the production of xIL13 hAb, a compatible plasmid system (expression of xIL13 HC and LC from one plasmid and FkpA from another, as shown in FIG. 4A) using a TIR1,1 or TIR2,2 antibody expression vector was tested.
  • the titer for the TIR1,1 plasmid was 0.2 g/L and 0.4 g/L for the TIR2,2 plasmid (FIG. 6A, lanes 3 and 4).
  • FIG. 6A shows the amount of FkpA expression induced in the compatible system, as compared to endogenous expression, as measured by ultra performance liquid chromatography (UPLC) in milliabsorption units (niAu) and Western blot.
  • UPLC ultra performance liquid chromatography
  • the single plasmid system for FkpA expression and hAb production shown in FIG. 4B was also tested.
  • the titers for the single plasmid TIR1,1 and TIR2,2 were 0.4 g/L and 0.7 g/L, respectively (FIG. 6A). This represented an approximately twofold increase in titer over the compatible plasmid system.
  • the expression level of FkpA in the single plasmid system was also approximately two-fold higher than in the induced compatible plasmid system (FIG. 6B). Increased levels of FkpA expression correlated with increased amounts of soluble monomeric heavy chain accumulation in both TIR conditions.
  • a third hAb (xIL4 IgG4) was tested with both TIR1 , 1 and TIR2,2 conditions with induced FkpA co-expression from a compatible plasmid system.
  • FkpA(wt) co-expression increased the amount of soluble monomeric heavy chain in both TIR conditions (FIG. 7A), but did not result in an increase in the titer of hAb produced (FIG. 7B).
  • a fourth hAb (xVEGFC IgGl) was tested with induced FkpA co-expression from a compatible plasmid system.
  • FkpA(wt) co-expression increased the amount of soluble monomeric heavy chain and increased the titer from 0.5 g/L to 0.8 g/L (FIG. 8A).
  • the increased FkpA expression as determined by Coomassie stain (FIG. 8B) correlated to an increase in soluble monomeric HC chain accumulation (FIG. 8C).
  • FkpA expression enhances the accumulation of soluble monomeric heavy chain, but that the effect on assembled hAb titer is variable. This indicates that further optimization is desirable.
  • FIG. 10 shows the titer of the xIL13 hAb produced over time, in the presence and absence of IPTG induction of DsbA and DsbC. The highest titer for the pxIL13.2.2.FkpAcl3 with JJ247 was achieved at 52 hours into the fermentation.
  • a compatible system for expressing DsbA, DsbC, and FkpA was also evaluated with the xIL4 TIR1,1 and TIR2,2 Ab expression plasmids (FIG. 11A).
  • the non- induced co-expression of all three chaperones resulted in a TIR1,1 and TIR2,2 titer of 0.8 g/L and 1.2 g/L, respectively (FIG. 12 lanes 5 and 6). This represented an approximately six-fold increase in titer for the TIR2,2 condition as compared to the previously described FkpA compatible TIR2,2 condition (FIG. 12 lanes 3 and 4).
  • the compatible non-induced AH8145 plasmid system was further evaluated with another hAb.
  • the non- induced compatible AH8145 condition increased the titer to 1.0 g/L from 0.8 g/L, as compared to FkpA co-expression only (FIG. 13).
  • a fifth hAb (xVEGFA IgGl) with both TIR1,1 and TIR2,2 conditions was tested with the AH8145 compatible plasmid. Without chaperone co-expression the titers for both the TIR1,1 and TIR2,2 conditions were similar, about 0.9 g/L (FIG. 14 lanes 1 and 3).
  • the titer for the TIR1,1 and TIR2,2 plasmids was 1.2 g/L and 1.7 g/L, respectively (FIG. 14 lanes 2 and 4).
  • the xIL13 single plasmid system MD157 was compared to the uninduced compatible pxIL13.2.2.FkpAcl3 and JJ247 compatible plasmid system (FIG. 16).
  • the MD157 single plasmid condition produced titers of 2.1 + 0.3 g/L compared to 1.9 + 0.04 g/L in the compatible system (FIG. 17). It should be noted that the titers reported in this comparison were generated from fermentations that utilized an optimized agitation strategy as described in Example 2.
  • fermentations were initially performed at 30°C with 20 standard liters per minute (slpm) of air flow and were controlled at a pH of 7.0 + 0.2.
  • the back pressure of the fermentor was maintained at 1 bar gauge and the agitation rate was initially set to 650 rpm.
  • the additional bar gauge of backpressure resulted in an initial dissolved oxygen concentration (d0 2 ) of 200%.
  • the concentrated glucose solution was fed after the d0 2 signal dropped below 2% of the starting level, typically about two hours into the production culture, and was fed continuously over the course of the fermentation such that glucose was a non-limiting nutrient.
  • the cell density in the culture was sufficient to maintain the d0 2 concentration at or near zero percent.
  • the oxygen transfer rate is equal to the oxygen uptake rate (OUR) or metabolic rate of the cells.
  • OUR oxygen uptake rate
  • Manipulation of the OTR was facilitated by adjusting the agitation rate and had a direct effect on the culture OUR.
  • a mass spectrometer was used to monitor the composition of the off-gas from the fermentations and enabled the calculation of the oxygen uptake and carbon dioxide evolution rates in the fermentations.
  • both the induced and non-induced TIR2,2 cultures had a peak OUR of 4.25 mmol/L/min at hour 12, after which point the d0 2 became limited. These cultures were grown under agitation at a constant rate of 650 rpm.
  • FIG. 19 shows the osmolality of these cultures over time. Taken together, FIGS. 18-19 show that after 50 hours, cell culture OUR declined sharply and osmolality rose.
  • FIG. 20 shows the xIL13 hAb titer produced over time in these cultures.
  • the average titer for the approximate 2.0 mmol/L/min condition was the highest (2.4 + 0.6 g/L) of the four conditions tested; however, there was some variability in the titers and there appeared to be a slight decline in the OUR profile.
  • the approximate 1.5 mmol/L/min condition had both reproduced average titers of 2.1 + 0.3 g/L, but again there appeared to be some variability in the OUR profile late in the fermentation.
  • the approximate 1.75 mmol/L/min condition had both reproducible titers (1.8 + 0.2 g/L), as well as consistent OUR trends so it was chosen as the preferred set point.
  • the fermentation process of a preferred embodiment of the present disclosure may be divided into two different segments: the growth phase and the production phase.
  • the growth phase most nutrients are in excess, and the culture density increases rapidly.
  • the production phase phosphate becomes limited, growth stops, and expression of the product of interest begins. The effect of temperature on hAb production was tested for each of these phases.
  • the 67 A6 strain contains a knockin of a protease deficient allele of the degP gene (also known as htrA and ptd), which encodes DegP.
  • DegP also known as Protease Do
  • DegP acts as a molecular chaperone. The substitution of a alanine for serine eliminates the proteolytic activity of DegP but does not affect its chaperone function (Spiess et al., Cell, 97:339-347, 1999).
  • FIG. 24 shows the growth of cultures grown with a constant Tg/Tp of 30°C or 28°C.
  • a constant Tg/Tp of 28°C resulted in a lag in growth rate as compared to the constant Tg/Tp of 30°C.
  • FIG. 25 shows the OUR of cultures grown at these temperatures. Similar to growth rate, OUR is delayed when cultures are grown at a constant Tg/Tp of 28°C, as compared to 30°C.
  • FIG. 26 shows the xIL13 hAb production of these cultures.
  • product expression began at the time when phosphate depletion occurred.
  • the constant 28°C Tg/Tp condition achieved a final titer of 2.5 + 0.2 g/L, as compared to 1.3 + 0.2 g/L for the constant 30°C Tg/Tp condition.
  • DoE A partial factorial design of experiment was performed to determine the optimal operating conditions for the xIL13 hAb utilizing the 67 A6 host strain.
  • the DoE focused on three operating parameters and the level of FkpA.
  • the operating parameters included Tg and Tp as well as pH.
  • the pattern refers to the operating range for a specific parameter; (-) refers to a low value parameter, (+) refers to a high value parameter, and 0001 and 0002 refer to a center point parameter.
  • the Tg ranged from 30 to 34°C
  • the Tp ranged from 25 to 28°C
  • the pH ranged between 6.7 and 7.0.
  • the amount of FkpA produced was modulated by the promoter used. High levels of FkpA were generated from the phoA promoter on MD157 and low levels of FkpA were generated from the non-induced tac promoter on KA01. Partial factorial analysis was performed by running 10 experiments.
  • the xIL4 single plasmid (CB1) was tested with the optimal fermentation conditions identified from the xIL13 DoE (Tg 34°C, Tp 28°C, pH 7.0). However in the CB1 condition a tacll promoter without IPTG induction was used to drive FkpA expression.
  • the xIL14 hAb titer was compared to a fermentation condition in which the Tg/Tp was held constant at 30°C and the pH was maintained at 7.0 .
  • the xIL4 hAb titer increased from 1.3 g/L to 3.1 g/L with the new process conditions without the addition of IPTG (FIG. 33).
  • a partial factorial DoE was performed to determine the optimal operating conditions for the xIL17 hAb.
  • the MD341 single plasmid was constructed by replacing the ORFs for the xIL13 hAb single plasmid (MD157) LC and HC with the ORF of the xIL17 LC and HC.
  • the promoters used for the expression of the antibody fragments and chaperones were identical to the xIL13 (MD157) plasmid.
  • the DoE focused on three operating parameters.
  • the operating parameters included Tg and Tp, as well as pH.
  • the Tg ranged from 30 to 34°C
  • the Tp ranged from 25 to 30°C
  • the pH ranged between 6.7 and 7.3.
  • FIG. 34 shows that the most significant titer accumulation was achieved in conditions with a Tp of 25°C
  • FIG. 35 shows the effects of first optimizing chaperone protein co-expression and then optimizing the process steps (e.g., agitation rate, Tg, and Tp) on production of xIL13 hAb titer.
  • molecular optimization e.g., chaperone protein expression and vector characteristics
  • process development e.g., agitation rate, Tg, and Tp
  • the xIL13 hAb was expressed in both the 66F8 and 67 A6 host strains.
  • Fermentations were performed under conditions employing temperature and agitation rate shifts as described above.
  • the use of the 67 A6 strain resulted in an increase in soluble xIL13 hAb titer (FIG. 36A) and in total subunit accumulation of both LC and HC as compared to the 66F8 strain (FIG. 36B).
  • the xIL4 hAb was also expressed in both the 66F8 and 67 A6 host strains.
  • the xIL4 hAb fermentations were performed at a constant temperature of 30°C, similar titers of about 1.5 g/L were obtained from both strains (FIG. 37A).
  • the 67A6 strain produced an average of 3.0 g/L and the 66F8 strain produced an average of 2.0 g/L (FIG. 37B).
  • the total subunit accumulation of both LC and HC in the 67 A6 fermentations was greater than in the 66F8 fermentations under conditions employing a temperature shift (FIG. 38A and FIG. 38B).
  • both xIL13 hAb and xIL4 hAb are two examples of a titer benefit provided by the 67 A6 host strain and a decreased production temperature relative to the growth temperature.
  • recombinant protein accumulation appeared to plateau in host strains devoid of DegP, while in the host strain with the mutant DegPS210A, recombinant protein appeared to accumulate until the fermentation ended.
  • the xIL33 hAb (MD501 plasmid) was constructed by replacing the ORFs for the xIL13 hAb single plasmid (MD157) LC and HC with the ORF of the xIL33 LC and HC.
  • the promoters used for the expression of the antibody fragments and chaperones were identical to the xIL13 (MD157) plasmid (FIG. 39).
  • a single fermentation was performed with an xIL33 hAb expression vector that contained only the ORFs for the xIL33 LC and HC (MD481).
  • the MD481 plasmid did not contain ORFs for the molecular chaperones DsbA, DsbC or FkpA.
  • the fermentation was performed at a constant temperature of 30°C, pH of 7.0, and an agitation rate of 650 RPM (base case of FIG. 40).
  • a single fermentation was performed with an xIL33 hAb expression vector that contained ORFs for the xIL33 LC and HC, as well as ORFs for the molecular chaperones DsbA, DsbC or FkpA (MD501).
  • the same operating conditions were used for the MD501 fermentation as for the MD481 fermentation.
  • the use of the single plasmid (MD501) resulted in an approximate 10-fold increase in xIL-33 hAb titer as compared to the base case.
  • a partial factorial DoE was performed to determine the optimal culture conditions for the xIL33 hAb MD501 single plasmid.
  • the DoE focused on four parameters in a fractional factorial with 10 experiments including two center point replicates in the 67 A6 host (Table 5-1). Agitation rate and temperature shifts were done at OD 550 of 150.
  • the Tg ranged from 30 to 34°C
  • the Tp ranged from 25 to 30°C
  • the pH ranged between 6.7 and 7.3
  • the OUR set point ranged from 1.9 to 2.8 mmol 0 2 /L/min.
  • FIG. 41 shows that the center point conditions provided the most significant benefit to titer with the highest titer achieved being 4.0 + 0.05 g/L, which amounts to a further increase in hAb titer as compared to the base case operating conditions (FIG. 40).
  • the best culture conditions included a pH of 7.0, a Tg of 32°C, a Tp of 27.5°C (2 hr ramp), and a target OUR of approximately 2.3 mmol/Lmin (2hr agitation rate ramp).
  • FkpA TIR variants were tested in the single plasmids for xIL13, xIL17 and xIL33 hAbs (MD157, MD341 and MD501 plasmids).
  • FkpA TIR variants were characterized as described in comparison to the endogenous FkpA signal sequence (FIG. 42).
  • the MD157, MD341 and MD501 plasmids incorporated the ORF for FkpAcl3, which was correlated with a TIR strength of three (FIG. 43).
  • the FkpAcl3 ORF was replaced with the FkpA TIRl or TIR2 ORF and tested in the previously identified optimized fermentation conditions for each hAb.
  • TIR2.3 and TIR6 Two additional FkpA TIR variants were tested (TIR2.3 and TIR6) using the previously described best conditions for the xIL13 hAb.
  • the TIR2.3 titer profile trended higher than the previously tested TIR2 condition, but was still lower than the control TIR3 condition (FIG. 47A).
  • the TIR6 condition resulted in a titer accumulation profile similar to the TIR 2.3 condition, but again lower than the TIR3 control.
  • FkpA accumulation as determined by western blot analysis showed the titration of FkpA across the TIR variants (FIG. 47B).
  • the data suggests there is an optimal amount of FkpA expression that correlates with hAb production, which in the case of the xIL13 hAb (MD157 single plasmid) is TIR3.
  • the growth and production phase agitation rates were increased from 650 to 880 RPM and 475 to 650 RPM.
  • Different combinations of vessel backpressure, sparge rates, and agitation rates can be used to achive similar OTR conditions as those cited in previous examples.
  • MIWGDGKIVYNSALKS (SEQ ID NO: 10) Anti-IL13 HVR-H3
  • Anti-IL17A F cross reactive Ab heavy-chain variable domain
  • Anti-IL17A F cross reactive Ab light-chain variable domain
  • Anti-IL17A F cross reactive Ab HVR-H1 DYAMH (SEQ ID NO : 20 )
  • Anti-IL17A F cross reactive Ab IgG4 heavy chain with hole-forming T366S/L368A/Y407V mutations
  • Anti-IL17A F cross reactive Ab IgG4 heavy chain with hole-forming T366S/L368A/Y407V mutations
  • Anti-IL17A F cross reactive Ab IgG4 heavy chain polynucleotide with hole-forming T366S/L368A/Y407V mutations
  • Anti-IL17A F cross reactive Ab IgG4 heavy chain polynucleotide with hole-forming T366S/L368A/Y407V mutations
  • Codon optimized anti-IL17A F cross reactive Ab IgG4 heavy chain polynucleotide with hole- forming T366S/L368A/Y407V mutations

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Microbiology (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Peptides Or Proteins (AREA)
  • Enzymes And Modification Thereof (AREA)
PCT/US2015/059339 2014-11-05 2015-11-05 Methods of producing two chain proteins in bacteria Ceased WO2016073791A1 (en)

Priority Applications (11)

Application Number Priority Date Filing Date Title
AU2015342961A AU2015342961B2 (en) 2014-11-05 2015-11-05 Methods of producing two chain proteins in bacteria
EP15802233.5A EP3215526A1 (en) 2014-11-05 2015-11-05 Methods of producing two chain proteins in bacteria
CN201580059973.5A CN108064308B (zh) 2014-11-05 2015-11-05 细菌中产生双链蛋白的方法
MX2017005930A MX384534B (es) 2014-11-05 2015-11-05 Metodos de produccion de proteinas de cadena doble en bacterias.
CA2966558A CA2966558C (en) 2014-11-05 2015-11-05 Methods of producing two chain proteins in bacteria
HK18114324.8A HK1255201B (zh) 2014-11-05 2015-11-05 细菌中产生双链蛋白的方法
KR1020177014850A KR102709593B1 (ko) 2014-11-05 2015-11-05 박테리아 내 2쇄 단백질을 생산하는 방법
RU2017119403A RU2705274C2 (ru) 2014-11-05 2015-11-05 Способы получения двуцепочечных белков в бактериях
JP2017523894A JP6875276B2 (ja) 2014-11-05 2015-11-05 細菌における2鎖タンパク質の生成方法
BR112017009152A BR112017009152A2 (pt) 2014-11-05 2015-11-05 métodos de produção de proteínas de duas cadeias em bactérias
IL252027A IL252027B (en) 2014-11-05 2017-04-30 Methods for the production of proteins with two chains in bacteria

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201462075792P 2014-11-05 2014-11-05
US62/075,792 2014-11-05
US201562207882P 2015-08-20 2015-08-20
US62/207,882 2015-08-20

Publications (1)

Publication Number Publication Date
WO2016073791A1 true WO2016073791A1 (en) 2016-05-12

Family

ID=54754738

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2015/059339 Ceased WO2016073791A1 (en) 2014-11-05 2015-11-05 Methods of producing two chain proteins in bacteria

Country Status (12)

Country Link
US (2) US10112994B2 (https=)
EP (1) EP3215526A1 (https=)
JP (3) JP6875276B2 (https=)
KR (1) KR102709593B1 (https=)
CN (1) CN108064308B (https=)
AU (1) AU2015342961B2 (https=)
BR (1) BR112017009152A2 (https=)
CA (1) CA2966558C (https=)
IL (1) IL252027B (https=)
MX (1) MX384534B (https=)
RU (1) RU2705274C2 (https=)
WO (1) WO2016073791A1 (https=)

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10066002B2 (en) 2014-11-05 2018-09-04 Genentech, Inc. Methods of producing two chain proteins in bacteria
WO2020096959A1 (en) 2018-11-05 2020-05-14 Genentech, Inc. Methods of producing two chain proteins in prokaryotic host cells
US11299539B2 (en) 2014-11-05 2022-04-12 Genentech, Inc. Methods of producing two chain proteins in bacteria
US12497430B2 (en) 2019-01-23 2025-12-16 Genentech, Inc. Methods of producing multimeric proteins in eukaryotic host cells
US12570738B2 (en) 2019-12-20 2026-03-10 UCB Biopharma SRL Multi-specific antibody with binding specificity for human IL-13 and IL-17

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP4540284A2 (en) 2022-06-17 2025-04-23 Apogee Therapeutics, Inc. Antibodies that bind interleukin 13 and methods of use

Citations (73)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0003089A1 (fr) 1978-01-06 1979-07-25 Bernard David Séchoir pour feuilles imprimées par sérigraphie
US4676980A (en) 1985-09-23 1987-06-30 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Target specific cross-linked heteroantibodies
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
DD266710A3 (de) 1983-06-06 1989-04-12 Ve Forschungszentrum Biotechnologie Verfahren zur biotechnischen Herstellung van alkalischer Phosphatase
EP0404097A2 (de) 1989-06-22 1990-12-27 BEHRINGWERKE Aktiengesellschaft Bispezifische und oligospezifische, mono- und oligovalente Rezeptoren, ihre Herstellung und Verwendung
WO1991000360A1 (en) 1989-06-29 1991-01-10 Medarex, Inc. Bispecific reagents for aids therapy
WO1991010741A1 (en) 1990-01-12 1991-07-25 Cell Genesys, Inc. Generation of xenogeneic antibodies
WO1992020373A1 (en) 1991-05-14 1992-11-26 Repligen Corporation Heteroconjugate antibodies for treatment of hiv infection
WO1993001161A1 (en) 1991-07-11 1993-01-21 Pfizer Limited Process for preparing sertraline intermediates
WO1993008829A1 (en) 1991-11-04 1993-05-13 The Regents Of The University Of California Compositions that mediate killing of hiv-infected cells
WO1993016185A2 (en) 1992-02-06 1993-08-19 Creative Biomolecules, Inc. Biosynthetic binding protein for cancer marker
WO1994004690A1 (en) 1992-08-17 1994-03-03 Genentech, Inc. Bispecific immunoadhesins
WO1994029351A2 (en) 1993-06-16 1994-12-22 Celltech Limited Antibodies
US5500362A (en) 1987-01-08 1996-03-19 Xoma Corporation Chimeric antibody with specificity to human B cell surface antigen
US5545807A (en) 1988-10-12 1996-08-13 The Babraham Institute Production of antibodies from transgenic animals
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
WO1996027011A1 (en) 1995-03-01 1996-09-06 Genentech, Inc. A method for making heteromultimeric polypeptides
US5569825A (en) 1990-08-29 1996-10-29 Genpharm International Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
WO1996034096A1 (en) 1995-04-28 1996-10-31 Abgenix, Inc. Human antibodies derived from immunized xenomice
WO1996033735A1 (en) 1995-04-27 1996-10-31 Abgenix, Inc. Human antibodies derived from immunized xenomice
US5571894A (en) 1991-02-05 1996-11-05 Ciba-Geigy Corporation Recombinant antibodies specific for a growth factor receptor
US5587458A (en) 1991-10-07 1996-12-24 Aronex Pharmaceuticals, Inc. Anti-erbB-2 antibodies, combinations thereof, and therapeutic and diagnostic uses thereof
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5624821A (en) 1987-03-18 1997-04-29 Scotgen Biopharmaceuticals Incorporated Antibodies with altered effector functions
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5641870A (en) 1995-04-20 1997-06-24 Genentech, Inc. Low pH hydrophobic interaction chromatography for antibody purification
US5648237A (en) 1991-09-19 1997-07-15 Genentech, Inc. Expression of functional antibody fragments
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5750373A (en) 1990-12-03 1998-05-12 Genentech, Inc. Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants
WO1998024893A2 (en) 1996-12-03 1998-06-11 Abgenix, Inc. TRANSGENIC MAMMALS HAVING HUMAN IG LOCI INCLUDING PLURAL VH AND Vλ REGIONS AND ANTIBODIES PRODUCED THEREFROM
US5789199A (en) 1994-11-03 1998-08-04 Genentech, Inc. Process for bacterial production of polypeptides
US5821337A (en) 1991-06-14 1998-10-13 Genentech, Inc. Immunoglobulin variants
US5840523A (en) 1995-03-01 1998-11-24 Genetech, Inc. Methods and compositions for secretion of heterologous polypeptides
US5869046A (en) 1995-04-14 1999-02-09 Genentech, Inc. Altered polypeptides with increased half-life
WO1999051642A1 (en) 1998-04-02 1999-10-14 Genentech, Inc. Antibody variants and fragments thereof
US6075181A (en) 1990-01-12 2000-06-13 Abgenix, Inc. Human antibodies derived from immunized xenomice
US6150584A (en) 1990-01-12 2000-11-21 Abgenix, Inc. Human antibodies derived from immunized xenomice
US6194551B1 (en) 1998-04-02 2001-02-27 Genentech, Inc. Polypeptide variants
US6248516B1 (en) 1988-11-11 2001-06-19 Medical Research Council Single domain ligands, receptors comprising said ligands methods for their production, and use of said ligands and receptors
WO2002040697A2 (en) * 2000-11-03 2002-05-23 Genentech, Inc. Metabolic rate shifts in fermentations expressing recombinant proteins
WO2002061090A2 (en) * 2000-12-14 2002-08-08 Genentech, Inc. Prokaryotically produced antibodies and uses thereof
US6737056B1 (en) 1999-01-15 2004-05-18 Genentech, Inc. Polypeptide variants with altered effector function
WO2004056312A2 (en) 2002-12-16 2004-07-08 Genentech, Inc. Immunoglobulin variants and uses thereof
WO2004106381A1 (en) 2003-05-31 2004-12-09 Micromet Ag Pharmaceutical compositions comprising bispecific anti-cd3, anti-cd19 antibody constructs for the treatment of b-cell related disorders
US20050014934A1 (en) 2002-10-15 2005-01-20 Hinton Paul R. Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis
WO2005010044A2 (en) 2003-07-08 2005-02-03 Genentech, Inc. Il-17 a/f heterologous polypeptides and therapeutic uses thereof
US20050079574A1 (en) 2003-01-16 2005-04-14 Genentech, Inc. Synthetic antibody phage libraries
US20050119455A1 (en) 2002-06-03 2005-06-02 Genentech, Inc. Synthetic antibody phage libraries
WO2005061547A2 (en) 2003-12-22 2005-07-07 Micromet Ag Bispecific antibodies
WO2005100402A1 (en) 2004-04-13 2005-10-27 F.Hoffmann-La Roche Ag Anti-p-selectin antibodies
US20050266000A1 (en) 2004-04-09 2005-12-01 Genentech, Inc. Variable domain library and uses
US6982321B2 (en) 1986-03-27 2006-01-03 Medical Research Council Altered antibodies
WO2006029879A2 (en) 2004-09-17 2006-03-23 F.Hoffmann-La Roche Ag Anti-ox40l antibodies
US7087409B2 (en) 1997-12-05 2006-08-08 The Scripps Research Institute Humanization of murine antibody
EP1691833A2 (en) 2003-11-28 2006-08-23 Micromet AG Compositions comprising polypeptides
US7189826B2 (en) 1997-11-24 2007-03-13 Institute For Human Genetics And Biochemistry Monoclonal human natural antibodies
WO2007042261A2 (en) 2005-10-11 2007-04-19 Micromet Ag Compositions comprising cross-species-specific antibodies and uses thereof
US20070117126A1 (en) 1999-12-15 2007-05-24 Genentech, Inc. Shotgun scanning
US20070160598A1 (en) 2005-11-07 2007-07-12 Dennis Mark S Binding polypeptides with diversified and consensus vh/vl hypervariable sequences
US20070237764A1 (en) 2005-12-02 2007-10-11 Genentech, Inc. Binding polypeptides with restricted diversity sequences
US20070292936A1 (en) 2006-05-09 2007-12-20 Genentech, Inc. Binding polypeptides with optimized scaffolds
US7371826B2 (en) 1999-01-15 2008-05-13 Genentech, Inc. Polypeptide variants with altered effector function
WO2008119567A2 (en) 2007-04-03 2008-10-09 Micromet Ag Cross-species-specific cd3-epsilon binding domain
US20090002360A1 (en) 2007-05-25 2009-01-01 Innolux Display Corp. Liquid crystal display device and method for driving same
US7527791B2 (en) 2004-03-31 2009-05-05 Genentech, Inc. Humanized anti-TGF-beta antibodies
WO2011133886A2 (en) 2010-04-23 2011-10-27 Genentech, Inc. Production of heteromultimeric proteins
US8088618B2 (en) 2003-12-23 2012-01-03 Genentech, Inc. Anti-IL 13 antibodies and uses thereof
WO2012106615A1 (en) * 2011-02-03 2012-08-09 Xoma Technology Ltd. Methods and materials for enhancing functional protein expression in bacteria
US8361744B2 (en) 2009-11-05 2013-01-29 Genentech, Inc. Methods and composition for secretion of heterologous polypeptides
WO2013055958A1 (en) 2011-10-11 2013-04-18 Genentech, Inc. Improved assembly of bispecific antibodies
US8715669B2 (en) 2008-05-05 2014-05-06 Novimmune Sa Anti-IL-17A/IL-17F cross-reactive antibodies
US20150017168A1 (en) 2009-05-01 2015-01-15 Abbvie Inc. Dual variable domain immunoglobulins and uses thereof
WO2015127405A2 (en) * 2014-02-21 2015-08-27 Genentech, Inc. Anti-il-13/il-17 bispecific antibodies and uses thereof

Family Cites Families (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE266710C (https=)
DE3850542T2 (de) 1987-09-23 1994-11-24 Bristol Myers Squibb Co Antikörper-Heterokonjugate zur Töting von HIV-infizierten Zellen.
AU3305100A (en) 1999-03-17 2000-10-04 Medical Research Council Method for refolding molecules of polypeptides containing ig domains
GB9911569D0 (en) * 1999-05-18 1999-07-21 Oxford Biomedica Ltd Antibodies
CN100513414C (zh) 2001-08-27 2009-07-15 杰南技术公司 进行抗体表达和装配的系统
IL160359A0 (en) 2001-08-31 2004-07-25 Avidex Ltd Soluble t cell receptor
WO2004009776A2 (en) * 2002-07-19 2004-01-29 Abbott Biotechnology Ltd. TREATMENT OF TNFα RELATED DISORDERS
WO2004042017A2 (en) 2002-10-31 2004-05-21 Genentech, Inc. Methods and compositions for increasing antibody production
JP4501451B2 (ja) 2004-02-18 2010-07-14 株式会社豊田自動織機 塗料組成物、塗料組成物を用いた透明性保護膜の製造方法および透明性保護膜を有する有機ガラス
WO2006028936A2 (en) 2004-09-02 2006-03-16 Genentech, Inc. Heteromultimeric molecules
GB201012599D0 (en) * 2010-07-27 2010-09-08 Ucb Pharma Sa Process for purifying proteins
US9158890B2 (en) 2011-07-27 2015-10-13 At&T Mobility Ii Llc Mobile applications and methods for conveying performance information of a cardiac pacemaker
JP2016522168A (ja) * 2013-04-05 2016-07-28 ジェネンテック, インコーポレイテッド 抗il−4抗体及び二重特異性抗体及びその使用
SG11201508642WA (en) 2013-04-19 2015-11-27 Sutro Biopharma Inc Expression of biologically active proteins in a bacterial cell-free synthesis system using cell extracts with elevated levels of exogenous chaperones
WO2016073791A1 (en) * 2014-11-05 2016-05-12 Genentech, Inc. Methods of producing two chain proteins in bacteria
US10066002B2 (en) 2014-11-05 2018-09-04 Genentech, Inc. Methods of producing two chain proteins in bacteria

Patent Citations (85)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0003089A1 (fr) 1978-01-06 1979-07-25 Bernard David Séchoir pour feuilles imprimées par sérigraphie
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
DD266710A3 (de) 1983-06-06 1989-04-12 Ve Forschungszentrum Biotechnologie Verfahren zur biotechnischen Herstellung van alkalischer Phosphatase
US4676980A (en) 1985-09-23 1987-06-30 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Target specific cross-linked heteroantibodies
US6982321B2 (en) 1986-03-27 2006-01-03 Medical Research Council Altered antibodies
US5500362A (en) 1987-01-08 1996-03-19 Xoma Corporation Chimeric antibody with specificity to human B cell surface antigen
US5624821A (en) 1987-03-18 1997-04-29 Scotgen Biopharmaceuticals Incorporated Antibodies with altered effector functions
US5648260A (en) 1987-03-18 1997-07-15 Scotgen Biopharmaceuticals Incorporated DNA encoding antibodies with altered effector functions
US5545807A (en) 1988-10-12 1996-08-13 The Babraham Institute Production of antibodies from transgenic animals
US6248516B1 (en) 1988-11-11 2001-06-19 Medical Research Council Single domain ligands, receptors comprising said ligands methods for their production, and use of said ligands and receptors
EP0404097A2 (de) 1989-06-22 1990-12-27 BEHRINGWERKE Aktiengesellschaft Bispezifische und oligospezifische, mono- und oligovalente Rezeptoren, ihre Herstellung und Verwendung
WO1991000360A1 (en) 1989-06-29 1991-01-10 Medarex, Inc. Bispecific reagents for aids therapy
US6075181A (en) 1990-01-12 2000-06-13 Abgenix, Inc. Human antibodies derived from immunized xenomice
US6150584A (en) 1990-01-12 2000-11-21 Abgenix, Inc. Human antibodies derived from immunized xenomice
WO1991010741A1 (en) 1990-01-12 1991-07-25 Cell Genesys, Inc. Generation of xenogeneic antibodies
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5569825A (en) 1990-08-29 1996-10-29 Genpharm International Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5750373A (en) 1990-12-03 1998-05-12 Genentech, Inc. Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants
US5571894A (en) 1991-02-05 1996-11-05 Ciba-Geigy Corporation Recombinant antibodies specific for a growth factor receptor
WO1992020373A1 (en) 1991-05-14 1992-11-26 Repligen Corporation Heteroconjugate antibodies for treatment of hiv infection
US5821337A (en) 1991-06-14 1998-10-13 Genentech, Inc. Immunoglobulin variants
WO1993001161A1 (en) 1991-07-11 1993-01-21 Pfizer Limited Process for preparing sertraline intermediates
US5648237A (en) 1991-09-19 1997-07-15 Genentech, Inc. Expression of functional antibody fragments
US5587458A (en) 1991-10-07 1996-12-24 Aronex Pharmaceuticals, Inc. Anti-erbB-2 antibodies, combinations thereof, and therapeutic and diagnostic uses thereof
WO1993008829A1 (en) 1991-11-04 1993-05-13 The Regents Of The University Of California Compositions that mediate killing of hiv-infected cells
WO1993016185A2 (en) 1992-02-06 1993-08-19 Creative Biomolecules, Inc. Biosynthetic binding protein for cancer marker
WO1994004690A1 (en) 1992-08-17 1994-03-03 Genentech, Inc. Bispecific immunoadhesins
WO1994029351A2 (en) 1993-06-16 1994-12-22 Celltech Limited Antibodies
US5789199A (en) 1994-11-03 1998-08-04 Genentech, Inc. Process for bacterial production of polypeptides
US8216805B2 (en) 1995-03-01 2012-07-10 Genentech, Inc. Knobs and holes heteromeric polypeptides
WO1996027011A1 (en) 1995-03-01 1996-09-06 Genentech, Inc. A method for making heteromultimeric polypeptides
US5731168A (en) 1995-03-01 1998-03-24 Genentech, Inc. Method for making heteromultimeric polypeptides
US5821333A (en) 1995-03-01 1998-10-13 Genetech, Inc. Method for making heteromultimeric polypeptides
US5840523A (en) 1995-03-01 1998-11-24 Genetech, Inc. Methods and compositions for secretion of heterologous polypeptides
US7642228B2 (en) 1995-03-01 2010-01-05 Genentech, Inc. Method for making heteromultimeric polypeptides
US5807706A (en) 1995-03-01 1998-09-15 Genentech, Inc. Method for making heteromultimeric polypeptides
US7695936B2 (en) 1995-03-01 2010-04-13 Genentech, Inc. Knobs and holes heteromeric polypeptides
US20130089553A1 (en) 1995-03-01 2013-04-11 Genentech, Inc. Method for making heteromultimeric polypeptides
US5869046A (en) 1995-04-14 1999-02-09 Genentech, Inc. Altered polypeptides with increased half-life
US5641870A (en) 1995-04-20 1997-06-24 Genentech, Inc. Low pH hydrophobic interaction chromatography for antibody purification
WO1996033735A1 (en) 1995-04-27 1996-10-31 Abgenix, Inc. Human antibodies derived from immunized xenomice
WO1996034096A1 (en) 1995-04-28 1996-10-31 Abgenix, Inc. Human antibodies derived from immunized xenomice
WO1998024893A2 (en) 1996-12-03 1998-06-11 Abgenix, Inc. TRANSGENIC MAMMALS HAVING HUMAN IG LOCI INCLUDING PLURAL VH AND Vλ REGIONS AND ANTIBODIES PRODUCED THEREFROM
US7189826B2 (en) 1997-11-24 2007-03-13 Institute For Human Genetics And Biochemistry Monoclonal human natural antibodies
US7087409B2 (en) 1997-12-05 2006-08-08 The Scripps Research Institute Humanization of murine antibody
US6194551B1 (en) 1998-04-02 2001-02-27 Genentech, Inc. Polypeptide variants
WO1999051642A1 (en) 1998-04-02 1999-10-14 Genentech, Inc. Antibody variants and fragments thereof
US6737056B1 (en) 1999-01-15 2004-05-18 Genentech, Inc. Polypeptide variants with altered effector function
US7371826B2 (en) 1999-01-15 2008-05-13 Genentech, Inc. Polypeptide variants with altered effector function
US7332581B2 (en) 1999-01-15 2008-02-19 Genentech, Inc. Polypeptide variants with altered effector function
US20070117126A1 (en) 1999-12-15 2007-05-24 Genentech, Inc. Shotgun scanning
WO2002040697A2 (en) * 2000-11-03 2002-05-23 Genentech, Inc. Metabolic rate shifts in fermentations expressing recombinant proteins
WO2002061090A2 (en) * 2000-12-14 2002-08-08 Genentech, Inc. Prokaryotically produced antibodies and uses thereof
EP1356052A2 (en) 2000-12-14 2003-10-29 Genentech, Inc. Prokaryotically produced antibodies and uses thereof
EP1356052B1 (en) 2000-12-14 2008-08-20 Genentech, Inc. Production of full antibodies in procaryotic cells
US20050119455A1 (en) 2002-06-03 2005-06-02 Genentech, Inc. Synthetic antibody phage libraries
US20050014934A1 (en) 2002-10-15 2005-01-20 Hinton Paul R. Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis
WO2004056312A2 (en) 2002-12-16 2004-07-08 Genentech, Inc. Immunoglobulin variants and uses thereof
US20050079574A1 (en) 2003-01-16 2005-04-14 Genentech, Inc. Synthetic antibody phage libraries
WO2004106381A1 (en) 2003-05-31 2004-12-09 Micromet Ag Pharmaceutical compositions comprising bispecific anti-cd3, anti-cd19 antibody constructs for the treatment of b-cell related disorders
WO2005010044A2 (en) 2003-07-08 2005-02-03 Genentech, Inc. Il-17 a/f heterologous polypeptides and therapeutic uses thereof
EP1691833A2 (en) 2003-11-28 2006-08-23 Micromet AG Compositions comprising polypeptides
WO2005061547A2 (en) 2003-12-22 2005-07-07 Micromet Ag Bispecific antibodies
US8088618B2 (en) 2003-12-23 2012-01-03 Genentech, Inc. Anti-IL 13 antibodies and uses thereof
US7527791B2 (en) 2004-03-31 2009-05-05 Genentech, Inc. Humanized anti-TGF-beta antibodies
US20050266000A1 (en) 2004-04-09 2005-12-01 Genentech, Inc. Variable domain library and uses
WO2005100402A1 (en) 2004-04-13 2005-10-27 F.Hoffmann-La Roche Ag Anti-p-selectin antibodies
WO2006029879A2 (en) 2004-09-17 2006-03-23 F.Hoffmann-La Roche Ag Anti-ox40l antibodies
WO2007042261A2 (en) 2005-10-11 2007-04-19 Micromet Ag Compositions comprising cross-species-specific antibodies and uses thereof
US20070160598A1 (en) 2005-11-07 2007-07-12 Dennis Mark S Binding polypeptides with diversified and consensus vh/vl hypervariable sequences
US20070237764A1 (en) 2005-12-02 2007-10-11 Genentech, Inc. Binding polypeptides with restricted diversity sequences
US20070292936A1 (en) 2006-05-09 2007-12-20 Genentech, Inc. Binding polypeptides with optimized scaffolds
WO2008119567A2 (en) 2007-04-03 2008-10-09 Micromet Ag Cross-species-specific cd3-epsilon binding domain
US20090002360A1 (en) 2007-05-25 2009-01-01 Innolux Display Corp. Liquid crystal display device and method for driving same
US8715669B2 (en) 2008-05-05 2014-05-06 Novimmune Sa Anti-IL-17A/IL-17F cross-reactive antibodies
US8771697B2 (en) 2008-05-05 2014-07-08 Novimmune Sa Methods of treatment using anti-IL-17A/IL-17F cross-reactive antibodies
US20150017168A1 (en) 2009-05-01 2015-01-15 Abbvie Inc. Dual variable domain immunoglobulins and uses thereof
US8361744B2 (en) 2009-11-05 2013-01-29 Genentech, Inc. Methods and composition for secretion of heterologous polypeptides
WO2011133886A2 (en) 2010-04-23 2011-10-27 Genentech, Inc. Production of heteromultimeric proteins
WO2012106615A1 (en) * 2011-02-03 2012-08-09 Xoma Technology Ltd. Methods and materials for enhancing functional protein expression in bacteria
WO2013055958A1 (en) 2011-10-11 2013-04-18 Genentech, Inc. Improved assembly of bispecific antibodies
WO2015127405A2 (en) * 2014-02-21 2015-08-27 Genentech, Inc. Anti-il-13/il-17 bispecific antibodies and uses thereof

Non-Patent Citations (152)

* Cited by examiner, † Cited by third party
Title
"Methods in Molecular Biology", vol. 705, 2011, HUMANA PRESS, article "Heterologous Gene Expression in E. coli"
ABBAS ET AL.: "Cellular and Mol. Immunology. 4th ed.", 2000, W.B. SAUNDERS, CO.
ALMAGRO; FRANSSON, FRONT. BIOSCI., vol. 13, 2008, pages 1619 - 1633
ALTSCHUL ET AL., J MOL BIOL, vol. 215, 1990, pages 403 - 410
ALTSCHUL ET AL., NUC ACIDS RES, vol. 25, 1977, pages 3389 - 3402
BACA ET AL., J. BIOL. CHEM., vol. 272, 1997, pages 10678 - 10684
BANEYX F; GEORGIU G, J. BACTERIOL., vol. 172, no. 1, 1990, pages 491
BOERNER ET AL., J. IMMUNOL., vol. 147, no. 1, 1991, pages 86 - 95
BOLIVAR ET AL., GENE, vol. 2, 1977, pages 95 - 113
BOSTROM ET AL., SCIENCE, vol. 323, 2009, pages 1610
BOTHMANN H; PLUCKTHUN A, J. BIOL. CHEM., vol. 275, 2000, pages 17100
BRENNAN ET AL., SCIENCE, vol. 229, 1985, pages 81
BRUGGEMANN ET AL., YEAR IN IMMUNOL., vol. 7, 1993, pages 33
BRUGGEMANN, M. ET AL., J. EXP. MED., vol. 166, 1987, pages 1351 - 1361
CARTER ET AL., BIOLTECHNOLOGY, vol. 10, 1992, pages 163 - 167
CARTER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 4285
CHANG ET AL., GENE, vol. 55, 1987, pages 189 - 196
CHANG; COHEN, J. BACTERIOL., vol. 134, 1978, pages 1141 - 1156
CHARLTON: "Methods in Molecular Biology", vol. 248, 2003, HUMANA PRESS, pages: 245 - 254
CHEN ET AL., J. MOL. BIOL., vol. 293, 1999, pages 865 - 881
CHINTALACHARUVU KR ET AL., J. IMMUNOL., vol. 169, no. 9, 2002, pages 5072
CHOTHIA; LESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917
CHOWDHURY, METHODS MOL. BIOL., vol. 207, 2008, pages 179 - 196
CHRISTOPH SPIESS ET AL: "Bispecific antibodies with natural architecture produced by co-culture of bacteria expressing two distinct half-antibodies", NATURE BIOTECHNOLOGY, vol. 31, no. 8, 7 July 2013 (2013-07-07), pages 753 - 758, XP055127867, ISSN: 1087-0156, DOI: 10.1038/nbt.2621 *
CLACKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628
CLYNES ET AL., PROC. NAT'L ACAD. SCI. USA, vol. 95, 1998, pages 652 - 656
COLE ET AL.: "Monoclonal Antibodies and Cancer Therapy", 1985, ALAN R. LISS, pages: 77
CRAGG, M.S. ET AL., BLOOD, vol. 101, 2003, pages 1045 - 1052
CRAGG, M.S.; M.J. GLENNIE, BLOOD, vol. 103, 2004, pages 2738 - 2743
CUNNINGHAM; WELLS, SCIENCE, vol. 244, 1989, pages 1081 - 1085
DALL'ACQUA ET AL., METHODS, vol. 36, 2005, pages 43 - 60
DEVEREAUX ET AL., NUC ACIDS RES, vol. 12, 1984, pages 387 - 395
DUNCAN; WINTER, NATURE, vol. 322, 1988, pages 738 - 40
FELLOUSE, PROC. NATL. ACAD. SCI. USA, vol. 101, no. 34, 2004, pages 12467 - 12472
FENG; DOOLITTLE, J MOL EVOL, vol. 35, 1987, pages 351 - 360
FISHWILD ET AL., NATURE BIOTECHNOL., vol. 14, 1996, pages 845 - 851
GAFFEN, S. L., NATURE REVIEW, vol. 9, 2009, pages 556 - 567
GAZZANO-SANTORO ET AL., J. IMMUNOL. METHODS, vol. 202, 1996, pages 163
GRIFFITHS ET AL., EMBO J, vol. 12, 1993, pages 725 - 734
GRUBER ET AL., J. IMMUNOL, vol. 152, 1994, pages 5368
GUSS ET AL., EMBO J., vol. 5, 1986, pages 1567 - 1575
GUYER ET AL., J. IMMUNOL., vol. 117, 1976, pages 587
HAMERS-CASTERMAN ET AL., NATURE, vol. 363, 1993, pages 446 - 448
HAMMERLING ET AL.: "Monoclonal Antibodies and T-Cell Hybridomas", 1981, ELSEVIER, pages: 563 - 681
HARLOW ET AL.: "Antibodies: A Laboratory Manual. 2nd ed.", 1988, COLD SPRING HARBOR LABORATORY PRESS
HARRIS, BIOCHEM. SOC. TRANSACTIONS, vol. 23, 1995, pages 1035 - 1038
HELLSTROM, I ET AL., PROC. NAT 'L ACAD. SCI. USA, vol. 82, 1985, pages 1499 - 1502
HELLSTROM, I. ET AL., PROC. NAT 'L ACAD. SCI. USA, vol. 83, 1986, pages 7059 - 7063
HELM BA ET AL., EUR. J. IMMUNOL., vol. 21, no. 6, 1991, pages 1543
HENIKOFF; HENIKOFF, PROC NATL ACAD SCI USA, vol. 89, 1989, pages 10915
HENIKOFF; HENIKOFF, PROC NATL ACAD SCI USA, vol. 89, 1992, pages 10915 - 10919
HIGGINS; SHARP, CABIOS, vol. 5, 1989, pages 151 - 153
HOLLINGER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 6448
HONGO ET AL., HYBRIDOMA, vol. 14, no. 3, 1995, pages 253 - 260
HOOGENBOOM ET AL.: "Methods in Molecular Biology", vol. 178, 2001, HUMAN PRESS, pages: 1 - 37
HOOGENBOOM; WINTER, J. MOL. BIOL., vol. 227, 1991, pages 381
HOOGENBOOM; WINTER, J. MOL. BIOL., vol. 227, 1992, pages 381 - 388
HSIEH YJ; WANNER BL, CURR. OPIN. MICROBIOL., vol. 13, no. 2, 2010, pages 198
HUDSON ET AL., NAT. MED., vol. 9, 2003, pages 129 - 134
HUMPHREYS DP ET AL., PROTEIN EXPR. PURIF., vol. 20, no. 2, 2000, pages 252
HURLE; GROSS, CURR. OP. BIOTECH., vol. 5, 1994, pages 428 - 433
HYMOWITZ ET AL., EMBO J., vol. 20, 2001, pages 5332 - 41
IDUSOGIE ET AL., J. IMMUNOL., vol. 164, 2000, pages 4178 - 4184
JAKOBOVITS ET AL., NATURE, vol. 362, 1993, pages 255 - 258
JAKOBOVITS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 2551
JANG CW; MAGNUSON T, PLOS ONE, vol. 8, no. 2, 2013, pages E57075
JOHNSON; WU: "Methods in Molecular Biology", vol. 248, 2003, HUMAN PRESS, pages: 1 - 25
JONES ET AL., NATURE, vol. 321, 1986, pages 522 - 525
KABAT ET AL.: "Sequences of Immunological Interest. 5th ed.", 1991, NATIONAL INSTITUTES OF HEALTH
KABAT ET AL.: "Sequences of Proteins of Immunological Interest. 5th ed.", 1991, NATIONAL INSTITUTE OF HEALTH
KABAT ET AL.: "Sequences of Proteins of Immunological Interest. 5th ed.", 1991, NATIONAL INSTITUTES OF HEALTH
KARLIN; ALTSCHUL, PROC NATL ACAD SCI USA, vol. 90, 1993, pages 5873 - 5787
KASHMIRI ET AL., METHODS, vol. 36, 2005, pages 25 - 34
KIKUCHI ET AL., NUCLEIC ACIDS RES., vol. 9, 1981, pages 5671 - 5678
KIM ET AL., J. IMMUNOL., vol. 24, 1994, pages 249
KLIMKA ET AL., BR. J. CANCER, vol. 83, 2000, pages 252 - 260
KOHLER ET AL., NATURE, vol. 256, 1975, pages 495
KOHLER; MILSTEIN, NATURE, vol. 256, 1975, pages 495 - 97
KOSTELNY ET AL., J. IMMUNOL., vol. 148, no. 5, 1992, pages 1547 - 1553
LEE ET AL., J. IMMUNOL. METHODS, vol. 284, no. 1-2, 2004, pages 119 - 132
LEE ET AL., J. MOL. BIOL., vol. 340, no. 5, 2004, pages 1073 - 1093
LEVY RAPHAEL ET AL: "Enhancement of antibody fragment secretion into theEscherichia coliperiplasm by co-expression with the peptidyl prolyl isomerase, FkpA, in the cytoplasm", JOURNAL OF IMMUNOLOGICAL METHODS, vol. 394, no. 1, 23 April 2013 (2013-04-23), pages 10 - 21, XP028672930, ISSN: 0022-1759, DOI: 10.1016/J.JIM.2013.04.010 *
LI ET AL., PROC. NATL. ACAD. SCI. USA, vol. 103, 2006, pages 3557 - 3562
LINDMARK ET AL., J. IMMUNOL. METH., vol. 62, 1983, pages 1 - 13
LIU H; MAY K, MABS, vol. 4, no. 1, 2012, pages 17
LONBERG ET AL., NATURE, vol. 368, 1994, pages 856 - 859
LONBERG, CURR. OPIN. IMMUNOL., vol. 20, 2008, pages 450 - 459
LONBERG; HUSZAR, INTERN. REV. IMMUNOL., vol. 13, 1995, pages 65 - 93
LUBKE C ET AL., ENZYME MICROB. TECHNOL., vol. 17, no. 10, 1995, pages 923
MARKS ET AL., BIOLTECHNOLOGY, vol. 10, 1992, pages 779 - 783
MARKS ET AL., J. MOL. BIOL., vol. 222, 1991, pages 581
MARKS ET AL., J. MOL. BIOL., vol. 222, 1992, pages 581 - 597
MARKS; BRADBURY: "Methods in Molecular Biology", vol. 248, 2003, HUMAN PRESS, pages: 161 - 175
MCCAFFERTY ET AL., NATURE, vol. 348, pages 552 - 554
MERCHANT A MARGARET ET AL: "An efficient route to human bispecific IgG", NATURE BIOTECHNOLOGY, NATURE PUBLISHING GROUP, US, vol. 16, no. 7, 1 July 1998 (1998-07-01), pages 677 - 681, XP002141015, ISSN: 1087-0156, DOI: 10.1038/NBT0798-677 *
MILLSTEIN ET AL., NATURE, vol. 305, 1983, pages 537 - 539
MORIMOTO ET AL., JOURNAL OF BIOCHEMICAL AND BIOPHYSICAL METHODS, vol. 24, 1992, pages 107 - 117
MORRISON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 81, 1984, pages 6851 - 6855
MORRISON, NATURE, vol. 368, 1994, pages 812 - 813
NEEDLEMAN; WUNSCH, J MOL BIOL, vol. 48, 1970, pages 443
NEUBERGER, NATURE BIOTECHNOL., vol. 14, 1996, pages 826
NI, XIANDAI MIANYIXUE, vol. 26, no. 4, 2006, pages 265 - 268
OCHOA-GARCIA ET AL., BIOTECHNOL. ADV., vol. 27, 2009, pages 153
OSBOURN ET AL., METHODS, vol. 36, 2005, pages 61 - 68
PADLAN, MOL. IMMUNOL., vol. 28, 1991, pages 489 - 498
PEARSON, METHODS ENZYMOL, vol. 266, 1996, pages 227 - 258
PEARSON; LIPMAN, PROC NATL ACAD SCI USA, vol. 85, 1988, pages 2444
PETKOVA, S.B. ET AL., INT'L. IMMUNOL., vol. 18, no. 12, 2006, pages 1759 - 1769
PICKEN ET AL., INFECT. IMMUN., vol. 42, 1983, pages 269 - 275
PLUCKTHIIN: "The Pharmacology of Monoclonal Antibodies", vol. 113, 1994, SPRINGER-VERLAG, pages: 269 - 315
PRESTA ET AL., J. IMMUNOL., vol. 151, 1993, pages 2623
PRESTA, CURR. OP. STRUCT. BIOL., vol. 2, 1992, pages 593 - 596
QUEEN ET AL., PROC. NAT'L ACAD. SCI. USA, vol. 86, 1989, pages 10029 - 10033
RAPHAEL LEVY ET AL: "Production of Correctly Folded Fab Antibody Fragment in the Cytoplasm of Escherichia coli trxB gor Mutants via the Coexpression of Molecular Chaperones", PROTEIN EXPRESSION AND PURIFICATION, vol. 23, no. 2, 1 November 2001 (2001-11-01), pages 338 - 347, XP055024235, ISSN: 1046-5928, DOI: 10.1006/prep.2001.1520 *
RAVETCH; KINET, ANNU. REV. IMMUNOL., vol. 9, 1991, pages 457 - 492
RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 329
ROSOK ET AL., J. BIOL. CHEM., vol. 271, 1996, pages 22611 - 22618
SCHLAPSCHY ET AL., PROTEIN ENGINEERING, DESIGN AND SELECTION, vol. 19, 2006, pages 385
SCHLAPSCHY M ET AL., PROTEIN ENG. DES. SEL., vol. 19, no. 8, 2006, pages 385
SCHOLTISSEK; GROSSE, NUCLEIC ACIDS RES., vol. 15, 1987, pages 3185
SHALABY ET AL., CLINICAL IMMUNOLOGY, vol. 74, 1995, pages 185
SHALABY ET AL., J. EXP. MED., vol. 175, 1992, pages 217 - 225
SHERIFF ET AL., NATURE, vol. 3, 1996, pages 733 - 736
SHIELDS ET AL., J. BIOL. CHEM., vol. 9, no. 2, 2001, pages 6591 - 6604
SHIN SU ET AL., HUM. ANTIBODIES HYBRIDOMAS, vol. 3, no. 2, 1992, pages 65
SIDHU ET AL., J. MOL. BIOL., vol. 338, no. 2, 2004, pages 299 - 310
SIMMONS ET AL., J. IMMUNOL. METH., vol. 263, 2002, pages 133 - 147
SIMMONS ET AL., JOURNAL OF IMMUNOLOGICAL METHODS, vol. 263, 2002, pages 133
SIMMONS LC; YANSURA DG, NAT. BIOTECHNOL., vol. 14, 1996, pages 629
SIMMONS; YANSURA, NATURE BIOTECHNOLOGY, vol. 14, 1996, pages 629 - 634
SIMS ET AL., J. IMMUNOL., vol. 151, 1993, pages 2296
SMITH; WATERMAN, ADV APPL MATH, vol. 2, 1981, pages 482
SNYDER L ET AL.: "Molecular Genetics of Bacteria. 4th ed.", 2013, ASM PRESS
SPEISS ET AL., NAT BIOTECHNOL, vol. 31, 2013, pages 753 - 8
SPIESS ET AL., CELL, vol. 97, 1999, pages 339 - 347
SPIESS ET AL., NATURE BIOTECHNOLOGY, vol. 31, 2013, pages 753 - 758
SURESH ET AL., METHODS IN ENZYMOLOGY, vol. 121, 1986, pages 210
SUTCLIFFE, COLD SPRING HARBOR SYMP. QUANT. BIOL., vol. 43, 1978, pages 77 - 90
TERPE K, APPL. MICROBIOL. BIOTECHNOL., vol. 72, 2006, pages 211
THOMPSON ET AL., NUCL ACIDS. RES, vol. 22, 1994, pages 4673 - 4680
TRAUNECKER ET AL., EMBO J., vol. 10, 1991, pages 3655 - 3659
TUFT ET AL., J. IMMUNOL., vol. 147, 1991, pages 60
VAN DIJK; VAN DE WINKEL, CURR. OPIN. PHARMACOL., vol. 5, 2001, pages 368 - 74
VASWANI; HAMILTON, ANN. ALLERGY, ASTHMA & IMMUNOL., vol. 1, 1998, pages 105 - 115
VIMBERG V ET AL., BMC MOL. BIOL., vol. 8, 2007, pages 100
VOLLMERS; BRANDLEIN, HISTOLOGY AND HISTOPATHOLOGY, vol. 20, no. 3, 2005, pages 927 - 937
VOLLMERS; BRANDLEIN, METHODS AND FINDINGS IN EXPERIMENTAL AND CLINICAL PHARMACOLOGY, vol. 27, no. 3, 2005, pages 185 - 91
WIERSMA EJ; SHULMAN MJ, J. IMMUNOL., vol. 154, no. 10, 1995, pages 5265
WINTER ET AL., ANN. REV. IMMUNOL.,, vol. 12, 1994, pages 433 - 455
WU ET AL., NATURE BIOTECHNOLOGY, vol. 25, 2007, pages 1290
XU ET AL., IMMUNITY, vol. 13, 2000, pages 37 - 45
ZAPATA ET AL., PROTEIN ENG, vol. 8, no. 10, 1995, pages 1057 - 1062

Cited By (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10066002B2 (en) 2014-11-05 2018-09-04 Genentech, Inc. Methods of producing two chain proteins in bacteria
US11091530B2 (en) 2014-11-05 2021-08-17 Genentech, Inc. Methods of producing two chain proteins in bacteria
US11299539B2 (en) 2014-11-05 2022-04-12 Genentech, Inc. Methods of producing two chain proteins in bacteria
WO2020096959A1 (en) 2018-11-05 2020-05-14 Genentech, Inc. Methods of producing two chain proteins in prokaryotic host cells
TWI872030B (zh) * 2018-11-05 2025-02-11 美商建南德克公司 在原核宿主細胞中產生二鏈蛋白質之方法
US12291712B2 (en) 2018-11-05 2025-05-06 Genentech, Inc. Methods of producing two chain proteins in prokaryotic host cells
US12497430B2 (en) 2019-01-23 2025-12-16 Genentech, Inc. Methods of producing multimeric proteins in eukaryotic host cells
US12570738B2 (en) 2019-12-20 2026-03-10 UCB Biopharma SRL Multi-specific antibody with binding specificity for human IL-13 and IL-17

Also Published As

Publication number Publication date
MX2017005930A (es) 2017-06-30
US11299539B2 (en) 2022-04-12
JP2018500008A (ja) 2018-01-11
RU2017119403A (ru) 2018-12-05
CN108064308B (zh) 2023-06-09
US20190112368A1 (en) 2019-04-18
JP2023088935A (ja) 2023-06-27
AU2015342961A1 (en) 2017-06-15
IL252027B (en) 2021-10-31
CN108064308A (zh) 2018-05-22
BR112017009152A2 (pt) 2018-03-06
KR20170075793A (ko) 2017-07-03
US10112994B2 (en) 2018-10-30
CA2966558C (en) 2024-03-12
CA2966558A1 (en) 2016-05-12
AU2015342961B2 (en) 2021-08-12
IL252027A0 (en) 2017-06-29
EP3215526A1 (en) 2017-09-13
MX384534B (es) 2025-03-14
US20160159898A1 (en) 2016-06-09
KR102709593B1 (ko) 2024-09-26
RU2705274C2 (ru) 2019-11-06
JP2021119777A (ja) 2021-08-19
JP6875276B2 (ja) 2021-05-19
RU2017119403A3 (https=) 2019-03-27
HK1255201A1 (zh) 2019-08-09

Similar Documents

Publication Publication Date Title
AU2021236533B2 (en) Methods of producing two chain proteins in bacteria
US11299539B2 (en) Methods of producing two chain proteins in bacteria
US20260062710A1 (en) Methods of producing two chain proteins in prokaryotic host cells
RU2828630C2 (ru) Способы получения двуцепочечных белков в бактериях
HK1255201B (zh) 细菌中产生双链蛋白的方法
HK1242739B (zh) 在細菌中產生雙鏈蛋白質的方法

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 15802233

Country of ref document: EP

Kind code of ref document: A1

REEP Request for entry into the european phase

Ref document number: 2015802233

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2015802233

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 252027

Country of ref document: IL

ENP Entry into the national phase

Ref document number: 2966558

Country of ref document: CA

Ref document number: 2017523894

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: MX/A/2017/005930

Country of ref document: MX

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112017009152

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 20177014850

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2017119403

Country of ref document: RU

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2015342961

Country of ref document: AU

Date of ref document: 20151105

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 112017009152

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20170502