WO2015197737A1 - Clostridium difficile immunogenic composition - Google Patents

Clostridium difficile immunogenic composition Download PDF

Info

Publication number
WO2015197737A1
WO2015197737A1 PCT/EP2015/064324 EP2015064324W WO2015197737A1 WO 2015197737 A1 WO2015197737 A1 WO 2015197737A1 EP 2015064324 W EP2015064324 W EP 2015064324W WO 2015197737 A1 WO2015197737 A1 WO 2015197737A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
protein
cdtb
immunogenic composition
cdta
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2015/064324
Other languages
English (en)
French (fr)
Inventor
Cindy Castado
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
GlaxoSmithKline Biologicals SA
Original Assignee
GlaxoSmithKline Biologicals SA
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from GBGB1411306.2A external-priority patent/GB201411306D0/en
Priority claimed from GB201411371A external-priority patent/GB201411371D0/en
Priority to MX2016017094A priority Critical patent/MX374380B/es
Priority to LT15733404T priority patent/LT3160500T/lt
Priority to PL15733404T priority patent/PL3160500T3/pl
Priority to HRP20191864TT priority patent/HRP20191864T1/hr
Priority to EP15733404.6A priority patent/EP3160500B1/en
Priority to JP2016575190A priority patent/JP6688233B2/ja
Priority to US15/320,190 priority patent/US20170218031A1/en
Priority to CN201580039744.7A priority patent/CN106536544B/zh
Application filed by GlaxoSmithKline Biologicals SA filed Critical GlaxoSmithKline Biologicals SA
Priority to CA2952118A priority patent/CA2952118C/en
Priority to ES15733404T priority patent/ES2749701T3/es
Priority to DK15733404T priority patent/DK3160500T3/da
Priority to SI201530954T priority patent/SI3160500T1/sl
Priority to EP19192151.9A priority patent/EP3636278A3/en
Priority to BR112016030096-3A priority patent/BR112016030096B1/pt
Publication of WO2015197737A1 publication Critical patent/WO2015197737A1/en
Anticipated expiration legal-status Critical
Priority to CY20191101061T priority patent/CY1122145T1/el
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/33Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Clostridium (G)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/02Bacterial antigens
    • A61K39/08Clostridium, e.g. Clostridium tetani
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/02Local antiseptics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04Antibacterial agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55555Liposomes; Vesicles, e.g. nanoparticles; Spheres, e.g. nanospheres; Polymers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55572Lipopolysaccharides; Lipid A; Monophosphoryl lipid A
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55577Saponins; Quil A; QS21; ISCOMS
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/70Multivalent vaccine

Definitions

  • Clostridium difficile (C. difficile) is the most important cause of nosocomial intestinal infections and is the major cause of pseudomembranous colitis in humans (Bartlett et al Am. J. Clin. Nutr. 1 1 suppl:2521 -6 (1980)).
  • the overall associated mortality rate for individuals infected with C. difficile was calculated to be 5.99% within 3 months of diagnosis, with higher mortality associated with advanced age, being 13.5% in patients over 80 years (Karas et al Journal of Infection 561 :1 -9 (2010)).
  • the current treatment for C. difficile infection is the administration of antibiotics (metronidazole and vancomycin); however there has been evidence of strains which are resistant to these antibiotics (Shah et al., Expert Rev. Anti Infect. Ther. 8(5), 555-564 (2010)). Accordingly there is a need for immunogenic compositions capable of inducing antibodies to, and /or a protective immune response to, C. difficile.
  • C. difficile enterotoxicity is primarily due to the action of two toxins, toxin A and toxin B. These are both potent cytotoxins (Lyerly et al Current Microbiology 21 :29-32 (1990).
  • fragments of toxin A in particular fragments of the C-terminal domain, can lead to a protective immune response in hamsters (Lyerly et al Current Microbiology 21 :29-32 (1990)), WO96/12802 and WO00/61762.
  • CDT Clostridium difficile binary toxin
  • CDTa enzymatically active component
  • CDTb catalytically inert transport and binding component
  • CDTa has an ADP-ribosylating activity, which transfers the ADP-ribose moiety of NAD/NADPH to monomeric actin (G-actin) in the target cell and thus preventing its polymerization to F-actin and resulting in disruption of the cytoskeleton and eventual cell death (Sundriyal et al, Protein expression and Purification 74 (2010) 42-48).
  • WO2013/1 12867 describes vaccines against Clostridium difficile comprising recombinant C. difficile Toxin A, Toxin B and CDTa proteins, all comprising specifically defined mutations relative to the native toxin sequences that are described as substantially reducing or eliminating toxicity, in combination with binary toxin B (CDTb).
  • CDTb proteins comprising mutations designed to modify the pore forming ability of CDTb or modify the heptamerisation ability of CDTb have improved characteristics.
  • an immunogenic composition comprising an isolated Clostridium difficile CDTb protein wherein the isolated Clostridium difficile CDTb protein has been mutated to modify pore forming ability.
  • an immunogenic composition comprising an isolated Clostridium difficile CDTb protein which is a truncated CDTb protein with the signal peptide and the prodomain removed and also the receptor binding domain removed and/or the CDTa binding domain removed.
  • an immunogenic composition comprising an isolated Clostridium difficile CDTb protein wherein the isolated Clostridium difficile CDTb protein has been mutated to modify heptamerisation ability.
  • an immunogenic composition comprising a fusion protein comprising a full length CDTa protein and a CDTb protein.
  • the present invention provides a vaccine comprising the immunogenic composition of any one of the first four aspects and a pharmaceutically acceptable excipient.
  • the present invention provides the immunogenic composition of any one of the first four aspects or the vaccine of the fifth aspect, for use in the treatment or prevention of disease e.g. C. difficile disease.
  • the present invention provides the use of an immunogenic composition of any one of the first four aspects or the vaccine of the fifth aspect in the preparation of a medicament for the prevention or treatment of disease e.g. C. difficile disease.
  • the present invention provides a method of preventing or treating C. difficile disease comprising administering an immunogenic composition of any one of the first four aspects or the vaccine of the fifth aspect to a mammalian subject.
  • the present invention provides novel polypeptides and nucleotides as defined herein.
  • the present invention provides a method for the treatment or prevention of a condition or disease caused wholly or in part by C. difficile.
  • the method comprises administering to a subject in need thereof a therapeutically effective amount of the proteins as described herein, the immunogenic composition of the invention or the vaccines of the invention.
  • Figure 1 Cytotoxicity of CDTb candidates alone on HT29 cells: data from Example 7.
  • C37, C123, C124, C126 and C128 referred to in Figure 1 are the CDTb proteins as described in Examples 2, 4 and 6, the sequences of which are set out in the sequence summary (Table A).
  • FIG 2 Cytotoxicity of CDTb candidates mixed with CDTa full on HT29 cells: data from Example 7.
  • C37, C123, C124, C126 and C128 referred to in Figure 1 are the CDTb proteins as described in Examples 2, 4 and 6, the sequences of which are set out in the sequence summary (Table A).
  • CDTa full is the CDTa protein C34 the sequence of which is set out in the sequence summary (Table A).
  • FIG. 3 Dynamic light scattering measurements of hydrodynamic radius for KO pore forming CDTb constructs C123, C126 and of KO heptamerisation CDTb construct C128. Average radius gives an indication of the homogeneity of the sample, while peak 1 radius is an estimation of the hydrodynamic radius of the protein of interest.
  • Figure 4 Graph showing anti-CDTb immunogenicity in mice immunised with C. difficile CDTa or C. difficile CDTb, in both cases formulated with adjuvant
  • Figure 5 Graph showing anti-CDTa immunogenicity in mice immunised with C. difficile CDTa or C. difficile CDTb, in both cases formulated with adjuvant
  • Figure 8 Cytotoxicity of CDTb candidates alone ( Figure 8a) or mixed with CDTa full ( Figure 8b) on HT29 cells: data from Example 7.
  • C37, C123, C124, C126 and C128 are the CDTb proteins as described in Examples 2, 4 and 6, the sequences of which are set out in the sequence summary (Table A).
  • “CDTa full” is the CDTa protein C34 the sequence of which is set out in the sequence summary (Table A).
  • C149, C152, C164, C166, C1 16, C1 17 are the CDTb proteins as described in Examples 4 and 5.
  • Figure 9 Cytotoxicity of CDTb candidates alone ( Figure 9a) or mixed with CDTa full ( Figure 9b) on HCT1 16 cells (as described in Example 12)
  • Figure 1 Cytotoxicity of CDTa-CDTb fusion proteins mixed with full CDTb on HT29 cells (as described in Example 13)
  • Figure 12 Graph showing anti-CDTa immunogenicity in mice immunised with CDTb proteins or CDTa-CDTb fusions (see Example 14)
  • FIG 13 Graph showing anti-CDTb immunogenicity in mice immunised with CDTb proteins or CDTa-CDTb fusions (see Example 14)
  • FIG. 14 Cytotoxicity inhibition titres in HT29 and HCT1 16 cells, mice immunised with CDTb proteins or CDTa-CDTb fusions (see Example 15)
  • the Clostridium difficile binary toxin comprises two different proteins, CDTa and CDTb.
  • CDTa comprises two domains, the C-terminal domain is responsible for the ADP ribosyltransferase activity whilst the N-terminal domain is responsible for interacting with CDTb.
  • CDTb During infection CDTb is activated by proteolytic cleavage by a chymotrypsin-like protease to produce a CDTb protein lacking the prodomain (referred to as CDTb"). Note that CDTb” also lacks the CDTb signal sequence. A CDTb protein lacking the signal sequence but not lacking the prodomain is referred to as CDTb'. After proteolytic activation the CDTb oligomerises and binds to CDTa to form the complete C. difficile binary toxin (CDT). The binding of the binary toxin to the cell receptors leads to receptor-mediated endocytosis.
  • CDTb C. difficile binary toxin
  • the present invention provides an immunogenic composition comprising an isolated Clostridium difficile CDTb protein which has been mutated to modify pore forming ability.
  • CDTb protein which has been mutated to modify pore forming ability refers to a CDTb protein which has been mutated to modify the ability of the CDTb protein to form a pore.
  • the isolated Clostridium difficile CDTb protein has been mutated to reduce pore forming ability.
  • Pore forming ability may be analysed according to the methods described in The J. of Biol. Chem. 2001 , vol. 276 : 8371 -8376, PNAS 2004, vol. 101 : 16756-16761 , or The J. of Biol. Chem. 2008, vol. 283 : 3904-3914
  • the isolated Clostridium difficile CDTb protein may have been mutated to avoid the formation of the beta barrel structure which is composed of beta strands shared by each CDTb monomer contained in the heptamer which forms upon oligomerisation of CDTb.
  • the CDTb protein may be a truncated CDTb protein with the signal peptide removed.
  • the CDTb protein may be a truncated CDTb protein with the signal peptide removed and the prodomain removed.
  • truncated CDTb protein with the signal peptide removed refers to a CDTb protein with substantially all of the signal peptide removed (therefore which does not comprise amino acids corresponding to substantially all of the signal peptide.
  • the term “truncated CDTb protein with the signal peptide removed” refers to a CDTb protein with at least 25 of the amino acids of the signal peptide removed. There may be a few amino acids of the signal peptide remaining. For example 2, 5, 10, 15 or 20 amino acids of the signal peptide may remain.
  • truncated CDTb protein with the signal peptide removed. and the prodomain removed refers to a CDTb protein with substantially all of the signal peptide and the prodomain removed (therefore which does not comprise amino acids corresponding to substantially all of the signal peptide and substantially all of the prodomain).
  • the term “truncated CDTb protein with the signal peptide removed. and the prodomain removed” refers to a CDTb protein with all of the signal peptide removed and at least 85 of the amino acids of the prodomain removed.There may be a few amino acids of the signal peptide and/or prodomain remaining. For example 2, 5, 10, 15 or 20 amino acids of the signal peptide may remain.
  • the signal peptide of CDTb corresponds to amino acids 1-48 (encompassing amino acids 1-42) of SEQ ID NO: 3 or their equivalents in a binary toxin protein isolated from a different strain of C. difficile, for example amino acids 1 -42 of the amino acid sequence of CDTb from strain CD196 (Perelle, M. et al Infect. Immun., 65 (1997), pp. 1402-1407).
  • the prodomain of CDTb corresponds to amino acids 48-21 1 (encompassing amino acids 48-166) of SEQ ID NO:3 or their equivalents in a binary toxin protein isolated from a different strain of C. difficile.
  • the isolated Clostridium difficile CDTb protein comprises a mutation at position 455 of SEQ ID NO: 3 or its equivalent in a different strain of C. difficile. In another embodiment of this aspect, the isolated Clostridium difficile CDTb protein comprises a mutation at position 426 of SEQ ID NO: 3 or its equivalent in a different strain of C. difficile. In another embodiment of this aspect, the isolated Clostridium difficile CDTb protein comprises a mutation at position 453 of SEQ ID NO: 3 or its equivalent in a different strain of C. difficile. In another embodiment of this aspect, the isolated Clostridium difficile CDTb protein comprises a mutation at position 426 and a mutation at position 453 of SEQ ID NO:3 or its equivalent in a different strain of C. difficile.
  • the isolated Clostridium difficile CDTb protein comprises at least one mutation selected from the group consisting of F455R, F455G, E426A and D453A.
  • F455R means that the phenylalanine (F) at position 455 of the CDTb sequence in SEQ ID NO: 3 is mutated to arginine (R).
  • F455G means that the phenylalanine (F) at position 455 of the CDTb sequence in SEQ ID NO: 3 is mutated to glycine (G).
  • ⁇ 426 ⁇ means that the glutamate (E) at position 426 of the CDTb sequence in SEQ ID NO: 3 is mutated to alanine (A).
  • the isolated Clostridium difficile CDTb protein comprises the mutation F455R or its equivalent in a different strain of C. difficile. In one embodiment of this aspect, the isolated Clostridium difficile CDTb protein comprises the mutation F455G or its equivalent in a different strain of C. difficile. In one embodiment of this aspect, the isolated Clostridium difficile CDTb protein comprises the mutations E426A and D453A or their equivalents in a different strain of C. difficile.
  • SEQ ID NO: 10 SEQ ID NO: 1 1 or SEQ ID NO: 25 or SEQ ID NO: 26; or (ii) a variant of CDTb having at least 80%, 85%, 88%, 90%, 92%, 95%, 98%, 99%, 100% sequence identity to SEQ ID NO: 10 or SEQ ID NO: 1 1 or SEQ ID NO: 25 or SEQ I D NO: 26; or
  • an immunogenic composition wherein the isolated Clostridium difficile CDTb protein is a variant of CDTb having at least 80%, 85%, 88%, 90%, 92%, 95%, 98%, 99%, 100% sequence identity to SEQ ID NO: 10 or SEQ ID NO: 1 1 or SEQ ID NO: 25 or SEQ ID NO: 26.
  • an immunogenic composition wherein the isolated Clostridium difficile CDTb protein is a variant of CDTb having at least 80%, 85%, 88%, 90%, 92%, 95%, 98%, 99%, 100% sequence identity to SEQ ID NO: 43 or SEQ ID NO: 44.
  • an immunogenic composition wherein the isolated Clostridium difficile CDTb protein is a fragment of CDTb having at least 30, 50, 80, 100, 120, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800 or 850 contiguous amino acids of SEQ ID NO: 10 or SEQ ID NO: 1 1 or SEQ ID NO: 25 or SEQ I D NO: 26.
  • an immunogenic composition wherein the isolated Clostridium difficile CDTb protein is a fragment of CDTb having at least 30, 50, 80, 100, 120, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600 or 650 contiguous amino acids of SEQ ID NO: 43 or SEQ ID NO: 44.
  • the present invention also provides an immunogenic composition
  • an isolated Clostridium difficile CDTb protein which is a truncated CDTb protein with the signal peptide and the prodomain removed and also the receptor binding domain removed and/or the CDTa binding domain removed.
  • the term 'truncated CDTb protein with the signal peptide and the prodomain removed and also the receptor binding domain removed and/or the CDTa binding domain removed means a truncated CDTb protein with the signal peptide and the prodomain removed, wherein also the receptor binding domain and/or the CDTa binding domain have been removed.
  • SEQ ID NO: 3 refers to SEQ ID NO: 3 or a fragment or variant thereof with substantially all of the signal peptide and the prodomain removed (therefore which does not comprise amino acids corresponding to substantially all of the signal peptide and substantially all of the prodomain) and also substantially all of the receptor binding domain removed and/or substantially all of the CDTa binding domain removed (therefore which does not comprise amino acids corresponding to substantially all of the receptor binding domain and/or which does not comprise amino acids corresponding to substantially all of the CDTa binding domain).
  • the term "truncated CDTb protein with the signal peptide removed and the prodomain removed” refers to a CDTb protein with all of the signal peptide removed and at least 85 of the amino acids of the prodomain removed.There may be a few amino acids of the signal peptide, prodomain, receptor binding domain or CDTa binding domain remaining. For example 2, 5, 10, 15 or 20 amino acids of the signal peptide may remain. For example 2, 5, 10, 15 or 20 amino acids of the prodomain may remain. For example 2, 5, 10, 15 or 20 amino acids of the receptor binding domain may remain. For example 2, 5, 10, 15 or 20 amino acids of the CDTa binding domain may remain.
  • the signal peptide of CDTb corresponds to amino acids 1-48 (encompassing amino acids 1- 42) of SEQ I D NO: 3 or their equivalents in a binary toxin protein isolated from a different strain of C. difficile, for example amino acids 1-42 of the amino acid sequence of CDTb from strain CD196 (Perelle, M. et al Infect. Immun., 65 (1997), pp. 1402-1407).
  • the prodomain of CDTb corresponds to amino acids 48-21 1 (encompassing amino acids 48- 166) of SEQ ID NO:3 or their equivalents in a binary toxin protein isolated from a different strain of C. difficile.
  • the receptor binding domain of CDTb corresponds to amino acids 620- 876 of SEQ ID NO:3, or their equivalents in a binary toxin protein isolated from a different strain of C. difficile. In another embodiment, the receptor binding domain corresponds to amino acids 636-876 of SEQ ID NO:3 or their equivalents in a binary toxin protein isolated from a different strain of C. difficile.
  • the CDTa binding domain of CDTb corresponds to amino acids 212-296 of SEQ ID NO: 3 or their equivalents in a binary toxin protein isolated from a different strain of C. difficile.
  • the immunogenic composition comprises an isolated Clostridium difficile CDTb protein which is a truncated CDTb protein with the signal peptide and the prodomain removed and also either the receptor binding domain removed or the CDTa binding domain removed.
  • the immunogenic composition comprises an isolated Clostridium difficile CDTb protein which is a truncated CDTb protein with the signal peptide and the prodomain removed and also the receptor binding domain removed and the CDTa binding domain removed.
  • the isolated Clostridium difficile CDTb protein is or comprises
  • the isolated Clostridium difficile CDTb protein is or comprises
  • a fragment of CDTb having at least 30, 50, 80, 100, 120, 150, 200, 250, 300, 350 or 400 contiguous amino acids of SEQ ID NO: 8 or at least 30, 50, 80, 100, 120, 150, 200, 250, 300, 350, 400, 450, 500 or, 550 contiguous amino acids of SEQ ID NO: 9 or at least 30, 50, 80, 100, 120, 150, 200, 250 or 300 , contiguous amino acids of SEQ ID NO: 37
  • an immunogenic composition wherein the isolated Clostridium difficile CDTb protein is a variant of CDTb having at least 80%, 85%, 88%, 90%, 92%, 95%, 98%, 99%, 100% sequence identity to SEQ ID NO: 8 or SEQ ID NO: 9 or SEQ ID NO: 37.
  • an immunogenic composition wherein the isolated Clostridium difficile CDTb protein is a fragment of CDTb having at least 30, 50, 80, 100, 120, 150, 200, 250, 300, 350, 400, 450, 500, 550, contiguous amino acids of SEQ ID NO: 8 or SEQ ID NO: 9 or SEQ ID NO: 37.
  • an immunogenic composition comprising an isolated Clostridium difficile CDTb protein wherein the isolated Clostridium difficile CDTb protein has been mutated to modify heptamerisation ability.
  • CDTb protein which has been mutated to modify heptamerisation ability means that the CDTb protein has been mutated to modify its ability to self-assemble into a heptameric fold. This heptamerisation is allowed by the sharing of beta-strands coming from each CDTb monomer in order to form a beta-barrel structure.
  • the CDTb protein may be a truncated CDTb protein with the signal peptide removed.
  • the CDTb protein may be a truncated CDTb protein with the signal peptide removed and the prodomain removed.
  • the isolated Clostridium difficile CDTb protein has been mutated to reduce heptamerisation ability.
  • CDTb protein to heptamerise may be measured using a technique such as dynamic light scattering (DLS).
  • DLS can be used to evaluate hydrodynamic radius in solution of CDTb purified proteins, in addition to providing information about homogeneity and to detect the presence of high molecular weight aggregates (such as heptamers) within a protein sample. This is based on the calculation of the diffusion coefficient of the different species that are obtained by measuring the light scattering fluctuation, which depends on protein molecular size and shape, and on the other minor constituents of the sample.
  • a loop in the oligomerisation domain may potentially be involved in the heptamerisation of CDTb.
  • four amino acids have been identified having potential electrostatic interactions with amino acids contained in other monomers of heptameric CDTb. These residues are Asp537, Glu539, Asp540 and Lys541 of SEQ ID NO: 3.
  • the isolated Clostridium difficile CDTb protein comprises at least one mutation and/or truncation in the oligomerisation domain which modifies heptamerisation ability.
  • the oligomerisation domain corresponds to amino acids 297-619 of SEQ ID NO:3, or their equivalents in a CDTb protein isolated from a different strain of C. difficile.
  • the isolated Clostridium difficile CDTb protein comprises at least one mutation and/or truncation to the region of CDTb comprising amino acids 533-542 of SEQ ID NO: 3 or to the equivalent region in a different strain of C. difficile.
  • the isolated Clostridium difficile CDTb protein comprises at least one mutation at Asp537, Glu539, Asp540 and Lys541 of SEQ ID NO: 3 or their equivalents in a different strain of C. difficile.
  • suitably any one or more of Asp537, Glu539, Asp540 and/or Lys541 is/are mutated to Gly or another small residue.
  • the oligomerisation domain is truncated.
  • amino acids 533-542 of SEQ ID NO:3, or their equivalents in a CDTb protein isolated from a different strain of C. difficile may be deleted and optionally replaced by other residues, e.g. by 3, 4, 5 or more Gly and/or Ala residues.
  • amino acids 533-542 of SEQ ID NO:3, or their equivalents in a CDTb protein isolated from a different strain of C. difficile may be deleted and optionally replaced by 3 Gly residues or 3 Ala residues.
  • the isolated Clostridium difficile CDTb protein comprises mutations in four amino acids.
  • the CDTb protein comprises the mutation D537G-E539G- D540G-K541 G or their equivalents in a different strain of C. difficile.
  • D537G means that the aspartate at position 537 of the CDTb sequence in SEQ ID NO:3 is mutated to glycine.
  • E539G means that the glutamate at position 539 of the CDTb sequence in SEQ ID NO:3 is mutated to glycine.
  • D540G means that the aspartate at position 540 of the CDTb sequence in SEQ ID NO:3 is mutated to glycine.
  • K541 G means that the lysine at position 541 of the CDTb sequence in SEQ ID NO:3 is mutated to glycine.
  • the isolated Clostridium difficile CDTb protein comprises a mutation in which amino acids 533 to 542 of SEQ ID NO:3, or their equivalents in a CDTb protein isolated from a different strain of C. difficile, are replaced by 3 Gly residues.
  • SEQ ID NO: 12 or SEQ ID NO: 13 (i) SEQ ID NO: 12 or SEQ ID NO: 13; or (ii) a variant of CDTb having at least 80%, 85%, 88%, 90%, 92%, 95%, 98%, 99%, 100% sequence identity to SEQ ID NO: 12 or SEQ ID NO: 13; or
  • an immunogenic composition wherein the isolated Clostridium difficile CDTb protein is a variant of CDTb having at least 80%, 85%, 88%, 90%, 92%, 95%, 98%, 99%, 100% sequence identity to SEQ ID NO: 12 or SEQ ID NO: 13.
  • an immunogenic composition wherein the isolated Clostridium difficile CDTb protein is a fragment of CDTb having at least 30, 50, 80, 100, 120, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800 or 850 contiguous amino acids of SEQ ID NO: 12 or SEQ ID NO: 13.
  • the CDTb and CDTa proteins vary in amino acid sequence between different strains, for this reason the amino acid numbering may differ between strains.
  • the term 'equivalents in a different strain' refers to amino acids which correspond to those of a reference strain (e.g., C. difficile R20291 from which SEQ ID NO:1 and SEQ ID NO:3 are derived), but which are found in a toxin from a different strain and which may thus be numbered differently.
  • a region of 'equivalent' amino acids may be determined by aligning the sequences of the toxins from the different strains. Example binary toxin producing strains of C.
  • CD196 include CD196, CCUG 20309, R8637, IS81 , IS93, IS51 , IS58, R6786, R7605, R10456 and R5989.
  • amino acids numbers provided throughout refer to those of reference strain R20291 , as set forth in SEQ ID NO: 1 (CDTa) and SEQ ID NO:3 (CDTb).
  • the isolated Clostridium difficile CDTb protein is a monomer of CDTb. In a further embodiment the isolated Clostridium difficile CDTb protein is a multimer of CDTb. In a further embodiment the isolated Clostridium difficile CDTb protein is a heptamer of CDTb.
  • the immunogenic composition does not comprise/does not further comprise an isolated Clostridium difficile CDTa protein.
  • the present invention provides an immunogenic composition comprising an isolated
  • Clostridium difficile CDTb protein as the sole C. difficile antigen.
  • the term "as the sole C. difficile antigen” means that the immunogenic composition does not also comprise another antigen from C. difficile e.g. the immunogenic composition does not also comprise a toxin A, toxin B or CDTa protein.
  • the immunogenic composition comprises/further comprises an isolated Clostridium difficile CDTa protein.
  • the isolated Clostridium difficile CDTa protein is a truncated CDTa protein.
  • a truncated CDTa protein as used herein means a CDTa protein that does not achieve its full length or its proper form, and thus is missing some of the amino acid residues that are present in full length CDTa of SEQ ID NO: 1 or an equivalent in a different strain, and which cannot perform the function for which it was intended because its structure is incapable of doing so, e.g. ADP ribosyltransferase activity and/or interacting with CDTb.
  • a suitable assay for ADP ribosyltransferase activity is described in PLOS pathogens 2009, vol 5(10) :
  • the isolated Clostridium difficile CDTa protein is a truncated CDTa protein which does not comprise the C-terminal domain.
  • the term 'truncated CDTa protein which does not comprise the C-terminal domain' refers to a fragment or variant of SEQ ID NO:1 which does not comprise a substantial portion of the C-terminal domain, there may be a few amino acids of the C-terminal domain remaining, for example, 2, 5, 10, 15, 20, 25, 30, 35 or 50 amino acids of the C-terminal domain may remain.
  • the C-terminal domain corresponds to amino acids 269-463 of SEQ ID NO:1 or their equivalents in a CDTa protein isolated from a different strain of C. difficile.
  • the truncated Clostridium difficile CDTa protein suitably is or comprises
  • the truncated CDTa protein which does not comprise the C-terminal domain is a variant of CDTa having at least 80%, 85%, 88%, 90%, 92%, 95%, 98%, 99%, 100% sequence identity to SEQ ID NO: 20.
  • the truncated CDTa protein which does not comprise the C-terminal domain is a variant of CDTa having at least 30, 50, 80, 100, 120, 150, or 190 contiguous amino acids of SEQ ID NO: 20.
  • the isolated Clostridium difficile CDTa protein suitably contains a mutation which reduces its ADP-ribosyltransferase activity.
  • the isolated Clostridium difficile CDTa protein has a mutation from glutamate to another amino acid at position 428 of SEQ ID NO: 1 or an equivalent mutation in another strain of C. difficile.
  • the term 'has a mutation at position 428' refers to CDTa proteins which have a mutation at this exact location but also to a CDTa protein which is isolated from a different strain and which has a mutation at an equivalent position.
  • the CDTa protein varies in amino acid sequence between different strains, for this reason the amino acid numbering may differ between strains, thus a CDTa protein from a different strain may have a corresponding glutamate which is not number 428 in sequence.
  • the isolated Clostridium difficile CDTa protein has a mutation from glutamate to glutamine at position 428 of SEQ ID NO: 1 .
  • the isolated Clostridium difficile CDTa protein suitably has a mutation from glutamate to a different amino acid at position 430 of SEQ ID NO:1 or an equivalent mutation in another strain of C. difficile.
  • the term 'has a mutation at position 430' refers to proteins which have this exact location but also to a CDTa protein which is isolated from a different strain and which has a mutation at an equivalent position.
  • the isolated Clostridium difficile CDTa protein has a mutation from glutamate to glutamine at position 430 of SEQ ID NO: 1.
  • the isolated Clostridium difficile CDTa protein suitably is or comprises
  • a variant of CDTa having at least 80%, 85%, 88%, 90%, 92%, 95%, 98%, 99%, 100% sequence identity to SEQ ID NO: 21 ; SEQ ID NO: 22; SEQ ID NO: 23; or SEQ ID NO: 24; or
  • a fragment of CDTa having at least 30, 50, 80, 100, 120, 150, 200, 250, 300, 350 or 400 contiguous amino acids of SEQ ID NO: 21 ; SEQ ID NO: 22; SEQ ID NO: 23; or SEQ ID NO: 24.
  • the isolated Clostridium difficile CDTa protein suitably is or comprises
  • a variant of CDTa having at least 80%, 85%, 88%, 90%, 92%, 95%, 98%, 99%, 100% sequence identity to SEQ ID NO: 22; or (iii) a fragment of CDTa having at least 30, 50, 80, 100, 120, 150, 200, 250, 300, 350 or 400 contiguous amino acids of SEQ NO: 22.
  • Fusion proteins comprising a CDTa protein and a CDTb protein
  • the invention provides immunogenic compositions comprising a fusion protein comprising a full length CDTa protein and a CDTb protein.
  • full length CDTa means the full length CDTa of SEQ ID NO. 36 or the equivalent in another strain of C. difficile, or a variant of CDTa having at least 80%, 85%, 88%, 90%, 92%, 95%, 98%, 99%, 100% sequence identity to SEQ ID NO: 36
  • Fusion polypeptide refers to a protein having at least two heterologous polypeptides (e.g. at least two Clostridium difficile polypeptides) covalently linked, either directly or via an amino acid linker. It may also refer to a protein having at least two heterologous polypeptides linked non-covalently.
  • the polypeptides forming the fusion protein are typically linked C-terminus to N-terminus, although they can also be linked C-terminus to C-terminus, N-terminus to N-terminus, or N-terminus to C-terminus.
  • the polypeptides of the fusion protein can be in any order. This term also refers to conservatively modified variants, polymorphic variants, alleles, mutants, immunogenic fragments, and interspecies homologs of the antigens that make up the fusion protein.
  • fused refers to the linkage e.g. covalent linkage between two polypeptides in a fusion protein.
  • the polypeptides are typically joined via a peptide bond, either directly to each other or via an amino acid linker.
  • the peptides can be joined via non- peptide covalent linkages known to those of skill in the art.
  • a peptide linker sequence may be employed to separate the first and second polypeptide components by a distance sufficient to ensure that each polypeptide folds into its secondary and tertiary structures.
  • Such a peptide linker sequence is incorporated into the fusion protein using standard techniques well known in the art.
  • Suitable peptide linker sequences may be chosen based on the following factors: (1 ) their ability to adopt a flexible extended conformation; (2) their inability to adopt a secondary structure that could interact with functional epitopes on the first and second polypeptides; and (3) the lack of hydrophobic or charged residues that might react with the polypeptide functional epitopes.
  • Preferred peptide linker sequences contain Gly, Asn and Ser residues.
  • linker sequences which may be usefully employed as linkers include those disclosed in Maratea et al., Gene 40:39-46 (1985); Murphy et al., Proc. Natl. Acad. Sci. USA 83:8258-8262 (1986); U.S. Patent No. 4,935,233 and U.S. Patent No. 4,751 ,180.
  • the linker sequence may generally be from 1 to about 50 amino acids in length for example 1 , 5, 10, 15, 20, 25, 30, 35 or 40 amino acids in length. Linker sequences are not required when the first and second polypeptides have non-essential N-terminal amino acid regions that can be used to separate the functional domains and prevent steric interference.
  • the fusion protein may suitably comprise a linker.
  • a linker comprises or consists of six consecutive Gly residues.
  • the CDTa protein is suitably first in the fusion. This means that the CDTa protein is placed in the N-terminal of the fusion protein relative to the position of the CDTb protein. This improves the processabilty of the CDTa-CDTb fusion.
  • the CDTa protein has a mutation from cysteine to another amino acid at position 45 of SEQ ID NO: 1 or the equivalent amino acid in another strain of C. difficile.
  • the term 'has a mutation at position 45' refers to CDTa proteins which have a mutation at this exact location of SEQ ID NO: 1 but also to a CDTa protein which is isolated from a different strain and which has a mutation at an equivalent position.
  • the CDTa protein has a mutation from cysteine to tyrosine at position 45. This mutation is made in order to prevent/avoid the formation of a disulfide bond between two CDTa proteins.
  • the full length CDTa protein comprises one or more mutations which reduce its ADP-ribosyltransferase activity.
  • the CDTa protein may have any of the mutation sets disclosed in WO2013/1 12867.
  • the CDTa protein may comprise at least two mutations selected from the following mutations at positions 2, 67, 69, 253, 255, 258, 302, 307, 342, 345, 356, 359, 382, 385 and 387 (corresponding to positions 3, 68, 70, 254, 256, 259, 303, 308, 343, 346, 357, 360, 383, 386 and 388 of the sequence of SEQ ID NO: 36 of the present application:) C2A, Y67A, Y69A, Y253A, R255A, Y258A, R302A, Q307E, N342A, S345F, F356A, R359A, Y382A, E385Q, E385A, E387Q, and E387D as disclosed in WO2013/1 12867.
  • C2A means that the cysteine at position 2 of the CDTb protein sequence disclosed in WO2013/1 12867 (corresponding to position 3 of SEQ ID NO:36 of the present application) is mutated to alanine, and the other mutations listed in this group should be understood similarly.
  • the CDTa mutations are selected from: C2A, R302A, S345F, E385Q, E385A, E387Q, and E387D.
  • the CDTa protein comprises a set of mutations selected from the group consisting of: (a) S345F, E385Q and E387Q; (b) R302A, E385A, E387D; (c) C2A, S345F, E385Q and E387Q; (d) R302A, S345F, E385Q and E387Q; (e) Y67A, Y69A, and R255A; (f) R359A, Y67A, and Q307E; (g) Y258A, F356A, S345F; and (h) N342A, Y253A and Y382A.
  • the CDTa protein comprises one mutation which reduces its ADP- ribosyltransferase activity.
  • CDTa protein comprises one mutation which reduces its ADP-ribosyltransferase activity
  • CDTa protein refers to a CDTa protein which comprises a mutation at a single position which alone is intended to reduce its ADP ribosyltransferase activity.
  • the CDTa protein may optionally comprise other mutations not specifically intended to reduce its ADP ribosyltransferase activity.
  • Mutations specifically intended to reduce ADP ribosyltransferase activity include E428Q and E430Q (amino acid numbering with reference to SEQ ID NO:1 ) or C2A, Y67A, Y69A, Y253A, R255A, Y258A, R302A, Q307E, N342A, S345F, F356A, R359A, Y382A, E385Q, E385A, E387Q, and E387D as disclosed in WO2013/1 12867 (amino acid numbering corresponding to positions 3, 68, 70, 254, 256, 259, 303, 308, 343, 346, 357, 360, 383, 386 and 388 with reference to SEQ ID NO 36).
  • the CDTa protein has a mutation from glutamate to another amino acid at position 428 of SEQ ID NO: 1 or the equivalent amino acid in another strain of C. difficile.
  • the term 'has a mutation at position 428' refers to CDTa proteins which have a mutation at this exact location of SEQ ID NO: 1 but also to a CDTa protein which is isolated from a different strain and which has a mutation at an equivalent position.
  • the CDTa protein varies in amino acid sequence between different strains, for this reason the amino acid numbering may differ between strains, thus a CDTa protein from a different strain may have a corresponding glutamate which is not number 428 in sequence.
  • the CDTa protein has a mutation from glutamate to glutamine at position 428.
  • the CDTa protein suitably has a mutation from glutamate to a different amino acid at position 430 of SEQ ID NO: 1 or the equivalent amino acid in another strain of C. difficile
  • the term 'has a mutation at position 430' refers to proteins which have this exact location but also to a CDTa protein which is isolated from a different strain and which has a mutation at an equivalent position.
  • the CDTa protein has a mutation from glutamate to glutamine at position 430.
  • the full length CDTa protein suitably is or comprises
  • SEQ ID NO: 39 (i) SEQ ID NO: 39; or (ii) a variant CDTa having at least 80%, 85%, 88%, 90%, 92%, 95%, 98%, 99%, 100% sequence identity to SEQ ID NO: 39; or
  • the full length CDTa protein suitably is or comprises
  • the CDTb protein is a full length CDTb protein.
  • full length CDTb means the full length CDTb of SEQ ID NO. 7, ie CDTb with the prodomain removed.
  • the fusion protein comprising a full length CDTa protein and a CDTb protein suitably is or comprises
  • variant fusion protein having at least 80%, 85%, 88%, 90%, 92%, 95%, 98%, 99%, 100% sequence identity to SEQ ID NO: 14;
  • the CDTb protein is a truncated CDTb protein with the CDTa binding domain removed.
  • the term 'with the CDTa binding domain removed' refers to a fragment or variant of SEQ ID NO: 3, or its equivalent in another strain of C. difficile, with substantially all of the CDTa binding domain removed (therefore which does not comprise amino acids corresponding to substantially all of the CDTa binding domain).
  • the term "truncated CDTb protein with the CDTa binding domain removed” refers to a CDTb protein with at least 65 of the amino acids of the CDTa binding domain removed. There may be a few amino acids of the CDTa binding domain remaining. For example 2, 5, 10, 15 or 20 amino acids of the CDTa binding domain may remain.
  • the CDTa binding domain of CDTb corresponds to amino acids 212 to 295 of SEQ ID NO: 3 or their equivalents in a binary toxin protein isolated from a different strain of C. difficile.
  • the truncated CDTb protein with the CDTa binding domain removed suitably is or comprises
  • variant fusion protein having at least 80%, 85%, 88%, 90%, 92%, 95%, 98%, 99%, 100% sequence identity to SEQ ID NO: 9;
  • the fusion protein comprising a full length CDTa protein and a truncated CDTb protein with the CDTa binding domain removed suitably is or comprises
  • variant fusion protein having at least 80%, 85%, 88%, 90%, 92%, 95%, 98%, 99%, 100% sequence identity to SEQ ID NO: 15;
  • the CDTb protein is a truncated CDTb protein comprising the receptor binding domain.
  • the term 'truncated CDTb protein comprising the receptor binding domain' refers to a fragment or variant of SEQ ID NO:3, or its equivalents in another strain of C. difficile, with substantially all but the receptor binding domain removed (therefore which does not comprise amino acids corresponding to substantially all of the protein except for the receptor binding domain), there may be a few amino acids in addition to the receptor binding domain remaining, for example 2, 5, 10, 15 or 20 amino acids except for/in addition to the receptor binding domain.
  • the receptor binding domain corresponds to amino acids 620-876 of SEQ ID NO:3, or their equivalents in a binary toxin protein isolated from a different strain of C. difficile.
  • the receptor binding domain corresponds to amino acids 636-876 of SEQ ID NO:3 or their equivalents in a binary toxin protein isolated from a different strain of C. difficile.
  • the fusion protein comprising a full length CDTa protein and a truncated CDTb protein comprising the receptor binding domain suitably is or comprises
  • variant fusion protein having at least 80%, 85%, 88%, 90%, 92%, 95%, 98%, 99%, 100% sequence identity to SEQ ID NO: 16 or SEQ ID NO: 17; or
  • the invention provides novel polypeptides and nucleotides as defined herein.
  • the invention provides a polypeptide comprising an amino acid sequence represented by any of SEQ ID NOs 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 25, 26, 37, 43, 44, 49, 50, 51 , 52, 53, 54, 55, 56, 57, 58, 66, 67 or 71 .
  • the immunogenic composition elicits antibodies that neutralize CDTa or CDTb or both. In a further embodiment the composition elicits antibodies that neutralize binary toxin. Whether a composition elicits antibodies against a toxin can be measured by immunising mice with the immunogenic composition, collecting sera and analysing the anti-toxin titres of the sera using by ELISA. The sera should be compared to a reference sample obtained from mice which have not been immunised. The composition of the invention elicits antibodies that neutralise CDTa if the sera against the polypeptide gives an ELISA readout more than 10%, 20%, 30%, 50%, 70%, 80%, 90%, or 100% higher than the reference sample.
  • the immunogenic compositions of the invention elicits a protective immune response in a mammalian host against strains of C. Difficile.
  • the mammalian host is selected from the group consisting of mouse, rabbit, guinea pig, non- human primate, monkey and human.
  • the mammalian host is a mouse.
  • the mammalian host is a human.
  • an immunogenic composition elicits a protective immune response in a mammalian host against strains of C. Difficile can be determined using a challenge assay. In such an assay the mammalian host is vaccinated with the immunogenic composition and challenged by exposure to C. Difficile, the time which the mammal survives after challenge is compared with the time which a reference mammal that has not been immunised with the immunogenic composition survives.
  • An immunogenic composition elicits a protective immune response if a mammal immunised with the immunogenic composition survives at least 10%, 20%, 30%, 50%, 80%, 80%, 90%, or 100% longer than a reference mammal which has not been immunised after challenge with C. Difficile.
  • the immunogenic compositions of the invention further comprise an isolated Clostridium difficile toxin A protein and/or an isolated C. difficile toxin B protein.
  • the term 'isolated Clostridium difficile toxin A protein' refers to a protein with the amino acid sequence of SEQ ID NO: 29, or a fragment or variant of SEQ ID NO: 29.
  • the isolated Clostridium difficile toxin A protein is a fragment comprising 50, 100, 150, 200, 250, 300, 500, 750, 1000, 1250, 1500, 1750, 2000 or 2500 contiguous amino acids of SEQ ID NO: 29.
  • the isolated Clostridium difficile toxin A protein is a variant comprising 80%, 85%, 90%, 92%, 95%, 98%, 99% or 100% identity to SEQ ID NO: 29.
  • the term 'isolated Clostridium difficile toxin B protein' refers to a protein with the amino acid sequence of SEQ ID NO: 30, or a fragment or variant of SEQ ID NO: 30.
  • the isolated Clostridium difficile toxin B protein is a fragment comprising 50, 100, 150, 200, 250, 300, 500, 750, 1000, 1250, 1500, 1750 or 2000 SEQ ID NO: 30.
  • the isolated Clostridium difficile toxin B protein is a variant comprising 80%, 85%, 90%, 92%, 95%, 98%, 99% or 100% identity to SEQ ID NO: 30.
  • the isolated Clostridium difficile toxin A protein comprises a repeating domain fragment.
  • the term 'toxin A repeating domain' refers to the C-terminal domain of the toxin A protein from C. difficile, comprising repeated sequences.
  • the toxin A repeating domain refers to amino acids 1832-2710 of toxin A from strain VP110463 (ATCC43255) and their equivalents in a different strain
  • the sequence of amino acids 1832-2710 from strain VP110463 (ATCC43255) corresponds to amino acids 1832-2710 of SEQ ID NO: 29.
  • the isolated Clostridium difficile toxin A protein comprises a fragment of the toxin A N-terminal domain.
  • the toxin A N-terminal domain refers to amino acids 1 -1831 of toxin A from strain VP110463 (ATCC43255) and their equivalents in a different strain.
  • the sequence of amino acids 1-1831 of toxin A from strain VP110463 (ATCC43255) corresponds to amino acids 1-1831 of SEQ ID NO: 29.
  • the isolated Clostridium difficile toxin B protein comprises a toxin B repeating domain fragment.
  • the term 'toxin B repeating domain' refers to the C-terminal domain of the toxin B protein from C. difficile.
  • This domain refers to amino acids 1834-2366 from strain VP110463 (ATCC43255) and their equivalents in a different strain.
  • the sequence of amino acids 1834-2366 from strain VP110463 (ATCC43255) corresponds to amino acids 1834-2366 of SEQ ID NO: 30.
  • the isolated Clostridium difficile toxin B protein comprises a fragment of the toxin B N-terminal domain.
  • the toxin B N-terminal domain refers to amino acids 1 -1833 of toxin B from strain VB110463 (ATCC43255) and their equivalents in a different strain.
  • the sequence of amino acids 1-1833 of toxin B from strain VB110463 (ATCC43255) corresponds to amino acids 1-1833 of SEQ ID NO: 30.
  • the C. difficile toxins A and B are conserved proteins, however the sequence differs a small amount between strains, moreover the amino acid sequence for toxins A and B in different strains may differ in number of amino acids.
  • toxin A repeating domain and/or toxin B repeating domain refer to a sequence which is a variant with 90%, 95%, 98%, 99% or 100% sequence identity to amino acids 1832-2710 of SEQ ID NO: 29 or a variant with 90%, 95%, 98%, 99% or 100% sequence identity to amino acids 1834-2366 of SEQ ID NO: 30.
  • toxin A N-terminal domain and/or toxin B N terminal domain refer to a sequence which is a variant with 90%, 95%, 98%, 99% or 100% sequence identity to amino acids 1 -1831 of SEQ ID NO: 29 or a variant with 90%, 95%, 98%, 99% or 100% sequence identity to amino acids 1-1833 of SEQ ID NO: 30.
  • amino acid numbering may differ between the C-terminal domains of toxin A (or toxin B) from one strain and toxin A (or toxin B) from another strain.
  • the term 'equivalents in a different strain' refers to amino acids which correspond to those of a reference strain (e.g., C. difficile VP110463), but which are found in a toxin from a different strain and which may thus be numbered differently.
  • a region of 'equivalent' amino acids may be determined by aligning the sequences of the toxins from the different strains.
  • the amino acids numbers provided throughout refer to those of strain VP110463 (and are as set forth in SEQ ID NO: 29 and SEQ ID NO: 30).
  • the isolated C. difficile toxin A protein and the isolated C. difficile toxin B protein form a fusion protein.
  • the fusion protein is 80%, 85%, 90%, 95%, 98%, 99% or 100% identical to a sequence selected from the group consisting of SEQ ID NO: 31 , 32, 33, 34, and 35.
  • the fusion protein is a fragment of at least 800, 850, 900 or 950 contiguous amino acids of a sequence selected from the group consisting of SEQ ID NO: 31 , 32, 33, 34, and 35.
  • fragment as defined herein may refer to a fragment comprising a T cell epitope.
  • T cell epitopes are short contiguous stretches of amino acids which are recognised by T cells (e.g. CD4+ or CD8+ T cells). Identification of T cell epitopes may be achieved through epitope mapping experiments which are well known to the person skilled in the art (see, forexample, Paul, Fundamental Immunology, 3rd ed., 243-247 (1993); Bei3barth et al Bioinformatics 2005 21 (Suppl. 1 ):i29-i37).
  • fragment when used in relation to a polypeptide comprising a histidine tag includes the polypeptide without the histidine tag, for example from which the histidine tag has been cleaved.
  • suitable fragments of polypeptides comprising an amino acid sequence represented by any of sequence ID Nos. 5, 7-28 or 36-42 include the corresponding polypeptide without the histidine tag represented by sequence ID Nos 47-76, as set out in the following concordance:
  • the fragments of the invention are immunogenic fragments.
  • immunogenic fragments will typically comprise at least 9 contiguous amino acids from the full length polypeptide sequence (e.g. at least 10), such as at least 12 contiguous amino acids (e.g. at least 15 or at least 20 contiguous amino acids), in particular at least 50 contiguous amino acids, such as at least 100 contiguous amino acids (for example at least 200 contiguous amino acids).
  • the immunogenic fragments will be at least 20%, such as at least 50%, at least 70% or at least 80% of the length of the full length polypeptide sequence.
  • an immunogenic fragment contains a plurality of the epitopes from the full length sequence (suitably all epitopes).
  • “Variants” or “conservatively modified variants” applies to both amino acid and nucleic acid sequences. With respect to particular nucleic acid sequences, conservatively modified variants refers to those nucleic acids which encode identical or essentially identical amino acid sequences. Where the nucleic acid does not encode an amino acid sequence, “conservatively modified variants” refers to essentially identical sequences.
  • a polypeptide of the invention may contain a number of conservative substitutions (for example, 1-50, such as 1-25, in particular 1-10, and especially 1 amino acid residue(s) may be altered) when compared to the reference sequence.
  • conservative substitutions will fall within one of the amino-acid groupings specified below, though in some circumstances other substitutions may be possible without substantially affecting the immunogenic properties of the antigen.
  • the following eight groups each contain amino acids that are typically conservative substitutions for one another:
  • Polypeptide variants may also include those wherein additional amino acids are inserted compared to the reference sequence, for example, such insertions may occur at 1-10 locations (such as 1-5 locations, suitably 1 or 2 locations, in particular 1 location) and may, for example, involve the addition of 50 or fewer amino acids at each location (such as 20 or fewer, in particular 10 or fewer, especially 5 or fewer).
  • insertions do not occur in the region of an epitope, and do not therefore have a significant impact on the immunogenic properties of the antigen.
  • One example of insertions includes a short stretch of histidine residues (e.g. 2-6 residues) to aid expression and/or purification of the antigen in question.
  • Polypeptide variants include those wherein amino acids have been deleted compared to the reference sequence, for example, such deletions may occur at 1-10 locations (such as 1-5 locations, suitably 1 or 2 locations, in particular 1 location) and may, for example, involve the deletion of 50 or fewer amino acids at each location (such as 20 or fewer, in particular 10 or fewer, especially 5 or fewer). Suitably such deletions do not occur in the region of an epitope, and do not therefore have a significant impact on the immunogenic properties of the antigen.
  • polypeptide variant may comprise substitutions, deletions and additions (or any combination thereof).
  • Variants preferably exhibit at least about 70% identity, more preferably at least about 80% identity and most preferably at least about 90% identity (such as at least about 95%, at least about 98% or at least about 99%) to the associated reference sequence.
  • nucleic acids or polypeptide sequences refer to two or more sequences or sub-sequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same (i.e., 70% identity, optionally 75%, 80%, 85%, 90%, 95%, 98% or 99% identity over a specified region), when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using, for example, sequence comparison algorithms or by manual alignment and visual inspection. Such sequences are then said to be “substantially identical.” This definition also refers to the compliment of a test sequence.
  • the identity exists over a region that is at least about 25 to about 50 amino acids or nucleotides in length, or optionally over a region that is 75-100 amino acids or nucleotides in length.
  • the comparison is performed over a window corresponding to the entire length of the reference sequence.
  • sequence comparison typically one sequence acts as a reference sequence, to which test sequences are compared.
  • test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated.
  • the sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
  • a “comparison window”, as used herein, references to a segment in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned.
  • Methods of alignment of sequences for comparison are well-known in the art.
  • Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981 ), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Nat'l. Acad. Sci.
  • PILEUP creates a multiple sequence alignment from a group of related sequences using progressive, pairwise alignments to show relationship and percent sequence identity. It also plots a tree or dendogram showing the clustering relationships used to create the alignment. PILEUP uses a simplification of the progressive alignment method of Feng & Doolittle, J. Mol. Evol. 35:351-360 (1987). The method used is similar to the method described by Higgins & Sharp, CABIOS 5:151-153 (1989). The program can align up to 300 sequences, each of a maximum length of 5,000 nucleotides or amino acids. The multiple alignment procedure begins with the pairwise alignment of the two most similar sequences, producing a cluster of two aligned sequences.
  • This cluster is then aligned to the next most related sequence or cluster of aligned sequences.
  • Two clusters of sequences are aligned by a simple extension of the pairwise alignment of two individual sequences.
  • the final alignment is achieved by a series of progressive, pairwise alignments.
  • the program is run by designating specific sequences and their amino acid or nucleotide coordinates for regions of sequence comparison and by designating the program parameters.
  • PILEUP a reference sequence is compared to other test sequences to determine the percent sequence identity relationship using the following parameters: default gap weight (3.00), default gap length weight (0.10), and weighted end gaps.
  • PILEUP can be obtained from the GCG sequence analysis software package, e.g., version 7.0 (Devereaux et al., Nuc. Acids Res. 12:387-395 (1984).
  • BLAST and BLAST 2.0 algorithms are described in Altschul et al., Nuc. Acids Res. 25:3389-3402 (1977) and Altschul et al., J. Mol. Biol. 215:403-410 (1990), respectively.
  • Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (website at www.ncbi.nlm.nih.gov/).
  • This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence.
  • HSPs high scoring sequence pairs
  • T is referred to as the neighborhood word score threshold (Altschul et al., supra).
  • These initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them.
  • the word hits are extended in both directions along each sequence for as far as the cumulative alignment score can be increased.
  • Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always > 0) and N (penalty score for mismatching residues; always ⁇ 0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score.
  • the BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment.
  • W wordlength
  • E expectation
  • the BLAST algorithm also performs a statistical analysis of the similarity between two sequences ⁇ see, e.g., Karlin & Altschul, Proc. Nat'l. Acad. Sci. USA 90:5873-5787 (1993)).
  • One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance.
  • P(N) the smallest sum probability
  • a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.2, more preferably less than about 0.01 , and most preferably less than about 0.001.
  • Polynucleotides encoding the Clostridium difficile CDTa, CDTb, Toxin A and Toxin B proteins of the invention may be identified, prepared and/or manipulated using any of a variety of well established techniques.
  • a polynucleotide may be identified, as described in more detail below, by screening a microarray of cDNAs. Such screens may be performed, for example, using a Synteni microarray (Palo Alto, CA) according to the manufacturer's instructions (and essentially as described by Schena et al., Proc. Natl. Acad. Sci. USA 93:10614-10619 (1996) and Heller et al., Proc. Natl. Acad. Sci.
  • polynucleotides may be amplified from cDNA prepared from cells expressing the proteins described herein, such as M. tuberculosis cells. Such polynucleotides may be amplified via polymerase chain reaction (PCR). For this approach, sequence-specific primers may be designed based on the sequences provided herein, and may be purchased or synthesised.
  • PCR polymerase chain reaction
  • An amplified portion of a polynucleotide may be used to isolate a full length gene from a suitable library (e.g., a M. tuberculosis cDNA library) using well known techniques.
  • a library cDNA or genomic
  • a library is screened using one or more polynucleotide probes or primers suitable for amplification.
  • a library is size-selected to include larger molecules. Random primed libraries may also be preferred for identifying 5' and upstream regions of genes. Genomic libraries are preferred for obtaining introns and extending 5' sequences.
  • a partial sequence may be labelled (e.g., by nick-translation or end-labelling with 32 P) using well known techniques.
  • a bacterial or bacteriophage library is then generally screened by hybridising filters containing denatured bacterial colonies (or lawns containing phage plaques) with the labelled probe (see Sambrook et al., Molecular Cloning: A Laboratory Manual (2000)).
  • Hybridising colonies or plaques are selected and expanded, and the DNA is isolated for further analysis.
  • cDNA clones may be analyzed to determine the amount of additional sequence by, for example, PCR using a primer from the partial sequence and a primer from the vector. Restriction maps and partial sequences may be generated to identify one or more overlapping clones.
  • the complete sequence may then be determined using standard techniques, which may involve generating a series of deletion clones.
  • the resulting overlapping sequences can then be assembled into a single contiguous sequence.
  • a full length cDNA molecule can be generated by ligating suitable fragments, using well known techniques.
  • amplification techniques for obtaining a full length coding sequence from a partial cDNA sequence.
  • amplification is generally performed via PCR. Any of a variety of commercially available kits may be used to perform the amplification step.
  • Primers may be designed using, for example, software well known in the art. Primers are preferably 22-30 nucleotides in length, have a GC content of at least 50% and anneal to the target sequence at temperatures of about 68°C to 72°C.
  • the amplified region may be sequenced as described above, and overlapping sequences assembled into a contiguous sequence.
  • amplification technique is inverse PCR (see Triglia et al., Nucl. Acids Res. 16:8186 (1988)), which uses restriction enzymes to generate a fragment in the known region of the gene. The fragment is then circularised by intramolecular ligation and used as a template for PCR with divergent primers derived from the known region.
  • sequences adjacent to a partial sequence may be retrieved by amplification with a primer to a linker sequence and a primer specific to a known region. The amplified sequences are typically subjected to a second round of amplification with the same linker primer and a second primer specific to the known region.
  • RACE Rapid amplification of cDNA ends
  • This technique involves the use of an internal primer and an external primer, which hybridises to a polyA region or vector sequence, to identify sequences that are 5' and 3' of a known sequence. Additional techniques include capture PCR (Lagerstrom et al., PCR Methods Applic. 1 :1 1 1-19 (1991 )) and walking PCR (Parker ei al., Nucl. Acids. Res. 19:3055-60 (1991 )). Other methods employing amplification may also be employed to obtain a full length cDNA sequence.
  • EST expressed sequence tag
  • Searches for overlapping ESTs may generally be performed using well known programs (e.g., NCBI BLAST searches), and such ESTs may be used to generate a contiguous full length sequence.
  • Full length DNA sequences may also be obtained by analysis of genomic fragments.
  • POLYNUCLEOTIDE EXPRESSION IN HOST CELLS Polynucleotide sequences or fragments thereof which encode the Clostridium difficile CDTa, CDTb, Toxin A and Toxin B proteins, or fusion proteins or functional equivalents thereof, may be used in recombinant DNA molecules to direct expression of a polypeptide in appropriate host cells. Due to the inherent degeneracy of the genetic code, other DNA sequences that encode substantially the same or a functionally equivalent amino acid sequence may be produced and these sequences may be used to clone and express a given polypeptide.
  • codons preferred by a particular prokaryotic or eukaryotic host can be selected to increase the rate of protein expression or to produce a recombinant RNA transcript having desirable properties, such as a half-life which is longer than that of a transcript generated from the naturally occurring sequence.
  • polynucleotide sequences can be engineered using methods generally known in the art in order to alter polypeptide encoding sequences for a variety of reasons, including but not limited to, alterations which modify the cloning, processing, and/or expression of the gene product.
  • DNA shuffling by random fragmentation and PCR reassembly of gene fragments and synthetic oligonucleotides may be used to engineer the nucleotide sequences.
  • site-directed mutagenesis may be used to insert new restriction sites, alter glycosylation patterns, change codon preference, produce splice variants, or introduce mutations, and so forth.
  • Natural, modified, or recombinant nucleic acid sequences may be ligated to a heterologous sequence to encode a fusion protein.
  • a heterologous sequence For example, to screen peptide libraries for inhibitors of polypeptide activity, it may be useful to encode a chimeric protein that can be recognised by a commercially available antibody.
  • a fusion protein may also be engineered to contain a cleavage site located between the polypeptide-encoding sequence and the heterologous protein sequence, so that the polypeptide may be cleaved and purified away from the heterologous moiety.
  • Sequences encoding a desired polypeptide may be synthesised, in whole or in part, using chemical methods well known in the art (see Caruthers, M. H. ei al., Nucl. Acids Res. Symp. Ser. pp. 215-223 (1980), Horn ei al., Nucl. Acids Res. Symp. Ser. pp. 225-232 (1980)).
  • the protein itself may be produced using chemical methods to synthesize the amino acid sequence of a polypeptide, or a portion thereof.
  • peptide synthesis can be performed using various solid-phase techniques (Roberge et al., Science 269:202- 204 (1995)) and automated synthesis may be achieved, for example, using the ABI 431A Peptide Synthesizer (Perkin Elmer, Palo Alto, CA).
  • a newly synthesised peptide may be substantially purified by preparative high performance liquid chromatography (e.g., Creighton, Proteins, Structures and Molecular Principles (1983)) or other comparable techniques available in the art.
  • the composition of the synthetic peptides may be confirmed by amino acid analysis or sequencing (e.g., the Edman degradation procedure). Additionally, the amino acid sequence of a polypeptide, or any part thereof, may be altered during direct synthesis and/or combined using chemical methods with sequences from other proteins, or any part thereof, to produce a variant polypeptide.
  • the nucleotide sequences encoding the polypeptide, or functional equivalents may be inserted into an appropriate expression vector, i.e., a vector which contains the necessary elements for the transcription and translation of the inserted coding sequence.
  • an appropriate expression vector i.e., a vector which contains the necessary elements for the transcription and translation of the inserted coding sequence.
  • Methods which are well known to those skilled in the art may be used to construct expression vectors containing sequences encoding a polypeptide of interest and appropriate transcriptional and translational control elements. These methods include in vitro recombinant DNA techniques, synthetic techniques, and in vivo genetic recombination. Such techniques are described in Sambrook et al., Molecular Cloning, A Laboratory Manual (2000), and Ausube/ et al., Current Protocols in Molecular Biology (updated annually).
  • a variety of expression vector/host systems may be utilised to contain and express polynucleotide sequences. These include, but are not limited to, microorganisms such as bacteria transformed with recombinant bacteriophage, plasmid, or cosmid DNA expression vectors; yeast transformed with yeast expression vectors; insect cell systems infected with virus expression vectors (e.g., baculovirus); plant cell systems transformed with virus expression vectors (e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV) or with bacterial expression vectors (e.g., Ti or pBR322 plasmids); or animal cell systems.
  • microorganisms such as bacteria transformed with recombinant bacteriophage, plasmid, or cosmid DNA expression vectors
  • yeast transformed with yeast expression vectors insect cell systems infected with virus expression vectors (e.g., baculovirus)
  • plant cell systems transformed with virus expression vectors e.g., cauliflower mosaic virus, CaMV;
  • control elements or "regulatory sequences” present in an expression vector are those non-translated regions of the vector— enhancers, promoters, 5' and 3' untranslated regions- which interact with host cellular proteins to carry out transcription and translation. Such elements may vary in their strength and specificity. Depending on the vector system and host utilised, any number of suitable transcription and translation elements, including constitutive and inducible promoters, may be used. For example, when cloning in bacterial systems, inducible promoters such as the hybrid lacZ promoter of the PBLUESCRIPT phagemid (Stratagene, La Jolla, Calif.) or PSPORT1 plasmid (Gibco BRL, Gaithersburg, MD) and the like may be used.
  • inducible promoters such as the hybrid lacZ promoter of the PBLUESCRIPT phagemid (Stratagene, La Jolla, Calif.) or PSPORT1 plasmid (Gibco BRL, Gaithersburg, MD) and the like
  • promoters from mammalian genes or from mammalian viruses are generally preferred. If it is necessary to generate a cell line that contains multiple copies of the sequence encoding a polypeptide, vectors based on SV40 or EBV may be advantageously used with an appropriate selectable marker.
  • a number of expression vectors may be selected depending upon the use intended for the expressed polypeptide. For example, when large quantities are needed, for example for the induction of antibodies, vectors which direct high level expression of fusion proteins that are readily purified may be used.
  • Such vectors include, but are not limited to, the multifunctional E. coli cloning and expression vectors such as BLUESCRIPT (Stratagene), in which the sequence encoding the polypeptide of interest may be ligated into the vector in frame with sequences for the amino-terminal Met and the subsequent 7 residues of ⁇ -galactosidase so that a hybrid protein is produced; pIN vectors (Van Heeke &Schuster, J. Biol. Chem.
  • pGEX Vectors may also be used to express foreign polypeptides as fusion proteins with glutathione S-transferase (GST).
  • GST glutathione S-transferase
  • fusion proteins are soluble and can easily be purified from lysed cells by adsorption to glutathione-agarose beads followed by elution in the presence of free glutathione.
  • Proteins made in such systems may be designed to include heparin, thrombin, or factor XA protease cleavage sites so that the cloned polypeptide of interest can be released from the GST moiety at will.
  • Saccharomyces cerevisiae or Pichia such as Pichia pastoris for example, a number of vectors containing constitutive or inducible promoters such as alpha factor, alcohol oxidase, and PGH may be used.
  • Other vectors containing constitutive or inducible promoters include GAP, PGK, GAL and ADH.
  • sequences encoding polypeptides may be driven by any of a number of promoters.
  • viral promoters such as the 35S and 19S promoters of CaMV may be used alone or in combination with the omega leader sequence from TMV (Takamatsu, EMBO J. 3:17-31 1 (1987)).
  • plant promoters such as the small subunit of RUBISCO or heat shock promoters may be used (Coruzzi et al., EMBO J. 3: 1671-1680 (1984); Broglie et al., Science 224:838-843 (1984); and Winter et al., Results Probl. Cell Differ. 17:85-105 (1991 )).
  • constructs can be introduced into plant cells by direct DNA transformation or pathogen-mediated transfection. Such techniques are described in a number of generally available reviews (see, e.g., Hobbs in McGraw Hill Yearbook of Science and Technology pp. 191-196 (1992)).
  • An insect system may also be used to express a polypeptide of interest.
  • Autographa californica nuclear polyhedrosis virus (AcNPV) is used as a vector to express foreign genes in Spodoptera frugiperda cells or in Trichoplusia larvae.
  • the sequences encoding the polypeptide may be cloned into a non-essential region of the virus, such as the polyhedrin gene, and placed under control of the polyhedrin promoter. Successful insertion of the polypeptide-encoding sequence will render the polyhedrin gene inactive and produce recombinant virus lacking coat protein.
  • the recombinant viruses may then be used to infect, for example, S.
  • a number of viral-based expression systems are generally available.
  • sequences encoding a polypeptide of interest may be ligated into an adenovirus transcription/translation complex consisting of the late promoter and tripartite leader sequence. Insertion in a non-essential E1 or E3 region of the viral genome may be used to obtain a viable virus which is capable of expressing the polypeptide in infected host cells (Logan & Shenk, Proc. Natl. Acad. Sci. U.S.A. 81 :3655-3659 (1984)).
  • transcription enhancers such as the Rous sarcoma virus (RSV) enhancer
  • RSV Rous sarcoma virus
  • Methods and protocols for working with adenovirus vectors are reviewed in Wold, Adenovirus Methods and Protocols, 1998. Additional references regarding use of adenovirus vectors can be found in Adenovirus: A Medical Dictionary, Bibliography, and Annotated Research Guide to Internet References, 2004.
  • Specific initiation signals may also be used to achieve more efficient translation of sequences encoding a polypeptide of interest. Such signals include the ATG initiation codon and adjacent sequences. In cases where sequences encoding the polypeptide, its initiation codon, and upstream sequences are inserted into the appropriate expression vector, no additional transcriptional or translational control signals may be needed. However, in cases where only coding sequence, or a portion thereof, is inserted, exogenous translational control signals including the ATG initiation codon should be provided. Furthermore, the initiation codon should be in the correct reading frame to ensure translation of the entire insert. Exogenous translational elements and initiation codons may be of various origins, both natural and synthetic. The efficiency of expression may be enhanced by the inclusion of enhancers which are appropriate for the particular cell system which is used, such as those described in the literature (Scharf. et al., Results Probl. Cell Differ. 20:125-162 (1994)).
  • a host cell strain may be chosen for its ability to modulate the expression of the inserted sequences or to process the expressed protein in the desired fashion.
  • modifications of the polypeptide include, but are not limited to, acetylation, carboxylation, glycosylation, phosphorylation, lipidation, and acylation.
  • Post-translational processing which cleaves a "prepro" form of the protein may also be used to facilitate correct insertion, folding and/or function.
  • Different host cells such as CHO, HeLa, MDCK, HEK293, and WI38, which have specific cellular machinery and characteristic mechanisms for such post-translational activities, may be chosen to ensure the correct modification and processing of the foreign protein.
  • cell lines which stably express a polynucleotide of interest may be transformed using expression vectors which may contain viral origins of replication and/or endogenous expression elements and a selectable marker gene on the same or on a separate vector. Following the introduction of the vector, cells may be allowed to grow for 1- 2 days in an enriched media before they are switched to selective media.
  • the purpose of the selectable marker is to confer resistance to selection, and its presence allows growth and recovery of cells which successfully express the introduced sequences.
  • Resistant clones of stably transformed cells may be proliferated using tissue culture techniques appropriate to the cell type.
  • any number of selection systems may be used to recover transformed cell lines. These include, but are not limited to, the herpes simplex virus thymidine kinase (Wigler et al., Cell 1 1 :223-32 (1977)) and adenine phosphoribosyltransferase (Lowy et al., Cell 22:817-23 (1990)) genes which can be employed in tk.sup.- or aprt.sup.- cells, respectively. Also, antimetabolite, antibiotic or herbicide resistance can be used as the basis for selection; for example, dhfr which confers resistance to methotrexate (Wigler et al., Proc. Natl. Acad. Sci.
  • npt which confers resistance to the aminoglycosides, neomycin and G-418 (Colbere-Garapin et al., J. Mol. Biol. 150:1-14 (1981 )); and als or pat, which confer resistance to chlorsulfuron and phosphinotricin acetyltransferase, respectively (Murry, supra). Additional selectable genes have been described, for example, trpB, which allows cells to utilise indole in place of tryptophan, or hisD, which allows cells to utilise histinol in place of histidine (Hartman & Mulligan, Proc. Natl. Acad. Sci.
  • marker gene expression suggests that the gene of interest is also present, its presence and expression may need to be confirmed.
  • sequence encoding a polypeptide is inserted within a marker gene sequence, recombinant cells containing sequences can be identified by the absence of marker gene function.
  • a marker gene can be placed in tandem with a polypeptide-encoding sequence under the control of a single promoter. Expression of the marker gene in response to induction or selection usually indicates expression of the tandem gene as well.
  • host cells which contain and express a desired polynucleotide sequence may be identified by a variety of procedures known to those of skill in the art. These procedures include, but are not limited to, DNA-DNA or DNA-RNA hybridisations and protein bioassay or immunoassay techniques which include membrane, solution, or chip based technologies for the detection and/or quantification of nucleic acid or protein.
  • a variety of protocols for detecting and measuring the expression of polynucleotide-encoded products, using either polyclonal or monoclonal antibodies specific for the product are known in the art. Examples include enzyme-linked immunosorbent assay (ELISA), radioimmunoassay (RIA), and fluorescence activated cell sorting (FACS).
  • ELISA enzyme-linked immunosorbent assay
  • RIA radioimmunoassay
  • FACS fluorescence activated cell sorting
  • a two-site, monoclonal-based immunoassay utilising monoclonal antibodies reactive to two non- interfering epitopes on a given polypeptide may be preferred for some applications, but a competitive binding assay may also be employed. These and other assays are described, among other places, in Hampton et al., Serological Methods, a Laboratory Manual (1990) and Maddox et al., J. Exp. Med. 158:121 1-1216 (1983).
  • Means for producing labelled hybridisation or PCR probes for detecting sequences related to polynucleotides include oligolabeling, nick translation, end-labelling or PCR amplification using a labelled nucleotide.
  • the sequences, or any portions thereof may be cloned into a vector for the production of an mRNA probe.
  • Such vectors are known in the art, are commercially available, and may be used to synthesize RNA probes in vitro by addition of an appropriate RNA polymerase such as T7, T3, or SP6 and labelled nucleotides.
  • reporter molecules or labels include radionuclides, enzymes, fluorescent, chemiluminescent, or chromogenic agents as well as substrates, cofactors, inhibitors, magnetic particles, and the like.
  • Host cells transformed with a polynucleotide sequence of interest may be cultured under conditions suitable for the expression and recovery of the protein from cell culture.
  • the protein produced by a recombinant cell may be secreted or contained intracellular ⁇ depending on the sequence and/or the vector used.
  • expression vectors containing polynucleotides may be designed to contain signal sequences which direct secretion of the encoded polypeptide through a prokaryotic or eukaryotic cell membrane.
  • Other recombinant constructions may be used to join sequences encoding a polypeptide of interest to nucleotide sequence encoding a polypeptide domain which will facilitate purification of soluble proteins.
  • Such purification facilitating domains include, but are not limited to, metal chelating peptides such as histidine-tryptophan modules that allow purification on immobilized metals, protein A domains that allow purification on immobilised immunoglobulin, and the domain utilized in the FLAGS extension/affinity purification system (Immunex Corp., Seattle, Wash.).
  • metal chelating peptides such as histidine-tryptophan modules that allow purification on immobilized metals
  • protein A domains that allow purification on immobilised immunoglobulin
  • the domain utilized in the FLAGS extension/affinity purification system Immunex Corp., Seattle, Wash.
  • cleavable linker sequences such as those specific for Factor XA or enterokinase (Invitrogen. San Diego, Calif.) between the purification domain and the encoded polypeptide may be used to facilitate purification.
  • One such expression vector provides for expression of a fusion protein containing a polypeptide of interest and a nucleic acid encoding 6 histidine residues preceding a thioredoxin or an enterokinase cleavage site.
  • the histidine residues facilitate purification on IMIAC (immobilised metal ion affinity chromatography) as described in Porath et al., Prot. Exp. Purif. 3:263-281 (1992) while the enterokinase cleavage site provides a means for purifying the desired polypeptide from the fusion protein.
  • IMIAC immobilised metal ion affinity chromatography
  • a polypeptide of use in the invention will be an isolated polypeptide (i.e. separated from those components with which it may usually be found in nature).
  • a naturally-occurring protein is isolated if it is separated from some or all of the coexisting materials in the natural system.
  • polypeptides are at least about 90% pure, more preferably at least about 95% pure and most preferably at least about 99% pure.
  • a polynucleotide is considered to be isolated if, for example, it is cloned into a vector that is not a part of the natural environment.
  • Polypeptides may be prepared using any of a variety of well known techniques. Recombinant polypeptides encoded by DNA sequences as described above may be readily prepared from the DNA sequences using any of a variety of expression vectors known to those of ordinary skill in the art. Expression may be achieved in any appropriate host cell that has been transformed or transfected with an expression vector containing a DNA molecule that encodes a recombinant polypeptide. Suitable host cells include prokaryotes, yeast, and higher eukaryotic cells, such as mammalian cells and plant cells. Preferably, the host cells employed are E. coli, yeast or a mammalian cell line such as COS or CHO.
  • Supernatants from suitable host/vector systems which secrete recombinant protein or polypeptide into culture media may be first concentrated using a commercially available filter. Following concentration, the concentrate may be applied to a suitable purification matrix such as an affinity matrix or an ion exchange resin. Finally, one or more reverse phase HPLC steps can be employed to further purify a recombinant polypeptide.
  • a suitable purification matrix such as an affinity matrix or an ion exchange resin.
  • Polypeptides for use in the invention, immunogenic fragments thereof, and other variants having less than about 100 amino acids, and generally less than about 50 amino acids, may also be generated by synthetic means, using techniques well known to those of ordinary skill in the art.
  • such polypeptides may be synthesised using any of the commercially available solid-phase techniques, such as the Merrifield solid-phase synthesis method, where amino acids are sequentially added to a growing amino acid chain. See Merrifield, J. Am. Chem. Soc. 85:2149-2146 (1963).
  • Equipment for automated synthesis of polypeptides is commercially available from suppliers such as Perkin Elmer/Applied BioSystems Division (Foster City, CA), and may be operated according to the manufacturer's instructions.
  • a polypeptide may be a fusion protein that comprises multiple polypeptides as described herein, or that comprises at least one polypeptide as described herein and an unrelated sequence
  • examples of such proteins include tetanus, tuberculosis and hepatitis proteins ⁇ see, e.g., Stoute et al., New Engl. J. Med. 336:86-91 (1997)).
  • a fusion partner may, for example, assist in providing T helper epitopes (an immunological fusion partner), preferably T helper epitopes recognised by humans, or may assist in expressing the protein (an expression enhancer) at higher yields than the native recombinant protein.
  • Certain preferred fusion partners are both immunological and expression enhancing fusion partners.
  • Other fusion partners may be selected so as to increase the solubility of the protein or to enable the protein to be targeted to desired intracellular compartments.
  • Still further fusion partners include affinity tags, which facilitate purification of the protein.
  • Fusion proteins may generally be prepared using standard techniques, including chemical conjugation.
  • a fusion protein is expressed as a recombinant protein, allowing the production of increased levels, relative to a non-fused protein, in an expression system.
  • DNA sequences encoding the polypeptide components may be assembled separately, and ligated into an appropriate expression vector.
  • the 3' end of the DNA sequence encoding one polypeptide component is ligated, with or without a peptide linker, to the 5' end of a DNA sequence encoding the second polypeptide component so that the reading frames of the sequences are in phase. This permits translation into a single fusion protein that retains the biological activity of both component polypeptides.
  • a peptide linker sequence may be employed to separate the first and second polypeptide components by a distance sufficient to ensure that each polypeptide folds into its secondary and tertiary structures.
  • Such a peptide linker sequence is incorporated into the fusion protein using standard techniques well known in the art.
  • Suitable peptide linker sequences may be chosen based on the following factors: (1 ) their ability to adopt a flexible extended conformation; (2) their inability to adopt a secondary structure that could interact with functional epitopes on the first and second polypeptides; and (3) the lack of hydrophobic or charged residues that might react with the polypeptide functional epitopes.
  • Preferred peptide linker sequences contain Gly, Asn and Ser residues.
  • linker sequences which may be usefully employed as linkers include those disclosed in Maratea et al., Gene 40:39-46 (1985); Murphy et al., Proc. Natl. Acad. Sci. USA 83:8258-8262 (1986); U.S. Patent No. 4,935,233 and U.S. Patent No. 4,751 ,180.
  • the linker sequence may generally be from 1 to about 50 amino acids in length. Linker sequences are not required when the first and second polypeptides have non-essential N-terminal amino acid regions that can be used to separate the functional domains and prevent steric interference.
  • the immunogenic composition further comprises an adjuvant.
  • the adjuvant comprises aluminium hydroxide or aluminium phosphate.
  • the immunogenic composition of the invention may comprise an aluminium-free adjuvant, the immunogenic composition is formulated with an adjuvant that is free of aluminum or aluminum salts, that is, an aluminum- free adjuvant or adjuvant system.
  • the immunogenic composition is formulated with an adjuvant comprising an immunologically active saponin fraction presented in the form of a liposome.
  • the adjuvant may further comprise a lipopolysaccharide.
  • the adjuvant may include QS21 .
  • the adjuvant contains QS21 in a liposomal formulation.
  • the adjuvant system includes 3D-MPL and QS21.
  • the adjuvant contains 3D-MPL and QS21 in a liposomal formulation.
  • the adjuvant system also contains cholesterol.
  • the adjuvant includes QS21 and cholesterol.
  • the adjuvant system contains 1 , 2- Dioleoyl-sn-Glycero-3-phosphocholine (DOPC).
  • DOPC 2- Dioleoyl-sn-Glycero-3-phosphocholine
  • the immunogenic composition includes an adjuvant formulated in a dose that includes: from about 0.1 to about 0.5 mg cholesterol; from about 0.25 to about 2 mg DOPC; from about 10 g to about 100 Mg 3D-MPL; and from about 10 g to about 100 Mg QS21 .
  • the immunogenic composition includes an adjuvant formulated in a dose that includes: from about 0.1 to about 0.5 mg cholesterol; from about 0.25 to about 2 mg DOPC; from about 10 g to about 70 Mg 3D-MPL; and from about 10 Mg to about 70 Mg QS21.
  • the adjuvant is formulated in a single dose that contains: about 0.25 mg cholesterol; about 1.0 mg DOPC; about 50 Mg 3D-MPL; and about 50 Mg QS21 .
  • the immunogenic composition is formulated with a fractional dose (that is a dose, which is a fraction of the preceding single dose formulations, such as one half of the preceding quantity of components (cholesterol, DOPC, 3D-MPL and QS21 ), 1 ⁇ 4 of the preceding quantity of components, or another fractional dose (e.g., 1/3, 1/6, etc.) of the preceding quantity of components.
  • the immunogenic compositions according to the invention include an adjuvant containing combinations of lipopolysaccharide and Quillaja saponins that have been disclosed previously, for example in EP0671948.
  • This patent demonstrated a strong synergy when a lipopolysaccharide (3D-MPL) was combined with a Quillaja saponin (QS21 ).
  • the adjuvant may further comprise immunostimulatory oligonucleotides (for example, CpG) or a carrier.
  • a particularly suitable saponin for use in the present invention is Quil A and its derivatives.
  • Quil A is a saponin preparation isolated from the South American tree Quillaja Saponaria Molina and was first described by Dalsgaard et al. in 1974 ("Saponin adjuvants", Archiv. fur dieumble Virusforschung, Vol. 44, Springer Verlag, Berlin, p243-254) to have adjuvant activity.
  • Purified fragments of Quil A have been isolated by HPLC which retain adjuvant activity without the toxicity associated with Quil A (EP 0 362 278), for example QS7 and QS21 (also known as QA7 and QA21 ).
  • QS21 is a natural saponin derived from the bark of Quillaja saponaria Molina, which induces CD8+ cytotoxic T cells (CTLs), Th1 cells and a predominant lgG2a antibody response and is a preferred saponin in the context of the present invention.
  • the adjuvant may further comprise a sterol.
  • the sterol is provided at a ratio of saponin :sterol of from 1 :1 to 1 :100 w/w, such as from 1 :1 to 1 :10w/w; or 1 :1 to 1 :5 w/w.
  • QS21 is provided in its less reactogenic composition where it is quenched with an exogenous sterol, such as cholesterol for example.
  • an exogenous sterol such as cholesterol for example.
  • the saponin /sterol is in the form of a liposome structure (WO 96/33739, Example 1 ).
  • the liposomes suitably contain a neutral lipid, for example phosphatidylcholine, which is suitably non-crystalline at room temperature, for example eggyolk phosphatidylcholine, dioleoyl phosphatidylcholine (DOPC) or dilauryl phosphatidylcholine.
  • DOPC dioleoyl phosphatidylcholine
  • the liposomes may also contain a charged lipid which increases the stability of the lipsome-QS21 structure for liposomes composed of saturated lipids.
  • the amount of charged lipid is suitably 1-20% w/w, preferably 5-10%.
  • the ratio of sterol to phospholipid is 1 -50% (mol/mol), suitably 20-25%.
  • Suitable sterols include ⁇ -sitosterol, stigmasterol, ergosterol, ergocalciferol and cholesterol.
  • the adjuvant composition comprises cholesterol as sterol.
  • these sterols are well known in the art, for example cholesterol is disclosed in the Merck Index, 1 1 th Edn., page 341 , as a naturally occurring sterol found in animal fat.
  • the active saponin fraction is QS21
  • the ratio of QS21 : sterol will typically be in the order of 1 :100 to 1 :1 (w/w), suitably between 1 :10 to 1 :1 (w/w), and preferably 1 :5 to 1 :1 (w/w).
  • the ratio of QS21 :sterol being at least 1 :2 (w/w). In one embodiment, the ratio of QS21 :sterol is 1 :5 (w/w).
  • the sterol is suitably cholesterol.
  • the invention provides a dose of an immunogenic composition comprising immunologically active saponin, preferably QS21 , at a level of about 1 - about 70 ⁇ g per dose, for example at an amount of about 50 ⁇ g.
  • the invention provides a dose of an immunogenic composition comprising immunologically active saponin, preferably QS21 , at a level of 60 ⁇ g or less, for example between 1 and 60 ⁇ g.
  • the dose of the immunogenic composition comprises QS21 at a level of approximately around 50 ⁇ g, for example between 45 and 55 ⁇ g, suitably between 46 - 54 ⁇ g or between 47 and 53 ⁇ g or between 48 and 52 ⁇ g or between 49 and 51 ⁇ g, or 50 ⁇ g.
  • the dose of the immunogenic composition comprises QS21 at a level of around 25 ⁇ g, for example between 20 - 30 ⁇ g, suitably between 21 - 29 ⁇ g or between 22 and 28 ⁇ g or between 23 and 27 ⁇ g or between 24 and 26 ⁇ g, or 25 ⁇ g.
  • the dose of the immunogenic composition comprises QS21 at a level of around 10 ⁇ g per, for example between 5 and 15 ⁇ g, suitably between 6 and 14 ⁇ g, for example between 7 and 13 ⁇ g or between 8 and 12 ⁇ g or between 9 and 1 1 ⁇ g, or 10 ⁇ g.
  • a 0.5 ml vaccine dose volume contains 25 ⁇ g or 50 ⁇ g of QS21 per dose. Specifically, a 0.5 ml vaccine dose volume contains 50 ⁇ g of QS21 per dose.
  • compositions comprising a lipopolysaccharide may be present at an amount of about 1 - about 70 ⁇ g per dose, for example at an amount of about 50 ⁇ g.
  • the lipopolysaccharide may be a non-toxic derivative of lipid A, particularly monophosphoryl lipid A or more particularly 3-Deacylated monophoshoryl lipid A (3D - MPL).
  • 3D-MPL is sold under the name MPL by GlaxoSmithKline Biologicals S.A. and is referred throughout the document as MPL or 3D-MPL. See, for example, US Patent Nos. 4,436,727; 4,877,61 1 ; 4,866,034 and 4,912,094. 3D-MPL primarily promotes CD4+ T cell responses with an IFN- ⁇ (Th1 ) phenotype. 3D-MPL can be produced according to the methods disclosed in GB 2 220 21 1 A. Chemically it is a mixture of 3-deacylated monophosphoryl lipid A with 3, 4, 5 or 6 acylated chains. Preferably in the compositions of the present invention small particle 3D-MPL is used. Small particle 3D-MPL has a particle size such that it may be sterile-filtered through a 0.22 ⁇ filter. Such preparations are described in WO 94/21292.
  • the invention therefore provides a dose of an immunogenic composition comprising lipopolysaccharide, preferably 3D-MPL, at a level of 75 ⁇ g or less, for example between 1 and 60 ⁇ g.
  • the dose of the immunogenic composition comprises 3D-MPL at a level of around 50 ⁇ g, for example between 45 - 55 ⁇ g, suitably between 46 - 54 ⁇ g or between 47 and 53 ⁇ g or between 48 and 52 ⁇ g or between 49 and 51 ⁇ g, or 50 ⁇ g.
  • the dose of the immunogenic composition comprises 3D-MPL at a level of around 25 ⁇ g, for example between 20 - 30 ⁇ g, suitably between 21 - 29 ⁇ g or between 22 and 28 ⁇ g or between 23 and 27 ⁇ g or between 24 and 26 ⁇ g, or 25 ⁇ g.
  • the dose of the immunogenic composition comprises 3D-MPL at a level of around 10 ⁇ g, for example between 5 and 15 ⁇ g, suitably between 6 and 14 ⁇ g, for example between 7 and 13 ⁇ g or between 8 and 12 ⁇ g or between 9 and 1 1 ⁇ g, or 10 ⁇ g.
  • the volume of the dose is 0.5 ml.
  • the immunogenic composition is in a volume suitable for a dose which volume is higher than 0.5 ml, for example 0.6, 0.7, 0.8, 0.9 or 1 ml.
  • the human dose is between 1 ml and 1.5 ml.
  • a 0.5 ml vaccine dose volume contains 25 ⁇ g or 50 ⁇ g of 3D-MPL per dose. Specifically, a 0.5 ml vaccine dose volume contains 50 ⁇ g of 3D-MPL per dose.
  • the dose of the immunogenic composition according to any aspect of the invention suitably refers to human dose.
  • human dose is meant a dose which is in a volume suitable for human use. Generally this is between 0.3 and 1 .5 ml.
  • a human dose is 0.5 ml.
  • a human dose is higher than 0.5 ml, for example 0.6, 0.7, 0.8, 0.9 or 1 ml.
  • a human dose is between 1 ml and 1 .5 ml.
  • compositions of the invention are those wherein liposomes are initially prepared without MPL (as described in WO 96/33739), and MPL is then added, suitably as small particles of below 100 nm particles or particles that are susceptible to sterile filtration through a 0.22 ⁇ membrane.
  • MPL is therefore not contained within the vesicle membrane (known as MPL out).
  • Compositions where the MPL is contained within the vesicle membrane also form an aspect of the invention.
  • the polypeptide comprising a C. difficile toxin A fragment and / or a C. difficile toxin B fragment can be contained within the vesicle membrane or contained outside the vesicle membrane.
  • a dose of immunogenic composition comprises a final level of 25 ⁇ g of 3D- MPL and 25 [Jig of QS21 or 50 [Jig of 3D-MPL and 50 [Jig of QS21.
  • the adjuvant includes an oil-in-water emulsion.
  • the adjuvant comprises an oil in water emulsion, wherein the oil in water emulsion comprises a metabolisable oil, a tocol and an emulsifier.
  • the oil-in-water emulsion can include an oil phase that incorporates a metabolisable oil, and an additional oil phase component, such as a tocol.
  • the oil-in-water emulsion may also contain an aqueous component, such as a buffered saline solution (e.g., phosphate buffered saline).
  • the oil-in-water emulsion typically contains an emulsifier.
  • the metabolisable oil is squalene.
  • the tocol is alpha-tocopherol.
  • the emulsifier is a nonionic surfactant emulsifier (such as polyoxyethethylene sorbitan monooleate, Polysorbate® 80 , TWEEN80TM).
  • the oil- in-water emulsion contains squalene and alpha tocopherol in a ratio which is equal or less than 1 (w/w).
  • the metabolisable oil in the oil-in-water emulsion may be present in an amount of 0.5-1 Omg.
  • the tocol in the oil-in-water emulsion may be present in an amount of 0.5 - 1 1 mg.
  • the emulsifying agent may be present in an amount of 0.4 - 4 mg,
  • the oil phase of the emulsion system has to comprise a metabolisable oil.
  • metabolisable oil is well known in the art. Metabolisable can be defined as 'being capable of being transformed by metabolism' (Dorland's Illustrated Medical Dictionary, W.B. Sanders Company, 25th edition (1974)).
  • the oil may be any vegetable oil, fish oil, animal oil or synthetic oil, which is not toxic to the recipient and is capable of being transformed by metabolism. Nuts, seeds, and grains are common sources of vegetable oils.
  • Synthetic oils are also part of this invention and can include commercially available oils such as NEOBEE® (caprylic/capric triglycerides made using glycerol from vegetable oil sources and medium-chain fatty acids (MCTs) from coconut or palm kernel oils) and others.
  • a particularly suitable metabolisable oil is squalene.
  • Squalene (2,6,10,15,19,23-Hexamethyl- 2,6,10,14,18,22-tetracosahexaene) is an unsaturated oil which is found in large quantities in shark-liver oil, and in lower quantities in olive oil, wheat germ oil, rice bran oil, and yeast, and is a particularly preferred oil for use in this invention.
  • Squalene is a metabolisable oil by virtue of the fact that it is an intermediate in the biosynthesis of cholesterol (Merck index, 10th Edition, entry no.8619).
  • the metabolisable oil is present in the adjuvant composition in an amount of 0.5-10 mg, preferably 1-10, 2-10, 3-9, 4-8, 5-7, or 5-6 mg (e.g. 2-3, 5-6, or 9-1 Omg), specifically about 5.35 mg or about 2.14 mg per dose.
  • Tocols are well known in the art and are described in EP0382271 .
  • the tocol is alpha-tocopherol or a derivative thereof such as alpha-tocopherol succinate (also known as vitamin E succinate).
  • Said tocol is suitably present in an amount of 0.5-1 1 mg, preferably 1- 1 1 , 2-10, 3-9, 4-8, 5-7, 5-6 mg (e.g. 10-1 1 , 5-6, 2.5-3.5 or 1-3 mg). In a specific embodiment the tocol is present in an amount of about 5.94 mg or about 2.38 mg per dose.
  • the oil in water emulsion further comprises an emulsifying agent.
  • the emulsifying agent may suitably be polyoxyethylene sorbitan monooleate.
  • the emulsifying agent may be Polysorbate® 80 (Polyoxyethylene (20) sorbitan monooleate) or Tween® 80.
  • Said emulsifying agent is suitably present in the adjuvant composition in an amount of 0.1-5, 0.2-5, 0.3-4, 0.4-3 or 2-3 mg (e.g. 0.4-1 .2, 2-3 or 4-5 mg) emulsifying agent.
  • the emulsifying agent is present in an amount of about 0.97 mg or about 2.425 mg.
  • the amounts of specific components present in the composition are the amounts present in a 0.5 ml human dose.
  • the immunogenic composition is in a volume suitable for a human dose which volume is higher than 0.5 ml, for example 0.6, 0.7, 0.8, 0.9 or 1 ml.
  • the human dose is between 1 ml and 1 .5 ml.
  • the adjuvant composition in a human dose will be a fraction of the intended final volume of the human dose, for example approximately half of the intended final volume of the human dose, for example a 350 ⁇ volume for an intended human dose of 0.7ml, or a 250 ⁇ volume for an intended human dose of 0.5 ml.
  • the adjuvant composition is diluted when combined with the polypeptide antigen composition to provide the final human dose of vaccine.
  • the final volume of such dose will of course vary dependent on the initial volume of the adjuvant composition and the volume of polypeptide antigen composition added to the adjuvant composition.
  • a liquid adjuvant is used to reconstitute a lyophilised polypeptide composition.
  • the human dose of the adjuvant composition is approximately equal to the final volume of the human dose.
  • the liquid adjuvant composition is added to the vial containing the lyophilised polypeptide composition.
  • the final human dose can vary between 0.5 and 1.5 ml.
  • the method of producing oil-in-water emulsions is well known to the person skilled in the art.
  • the method comprises mixing the tocol-containing oil phase with a surfactant such as a PBS/ polyoxyethylene sorbitan monooleate solution, followed by homogenisation using a homogenizer.
  • a surfactant such as a PBS/ polyoxyethylene sorbitan monooleate solution
  • microfluidiser M1 10S Microfluidics machine, maximum of 50 passes, for a period of 2 minutes at maximum pressure input of 6 bar (output pressure of about 850 bar)
  • M1 10S Microfluidics machine maximum of 50 passes, for a period of 2 minutes at maximum pressure input of 6 bar (output pressure of about 850 bar)
  • the adaptation could be achieved by routine experimentation comprising the measurement of the resultant emulsion until a preparation was achieved with oil droplets of the required diameter.
  • the oil and emulsifier should be in an aqueous carrier.
  • the aqueous carrier may be, for example, phosphate buffered saline.
  • the oil-in-water emulsion systems of the present invention have a small oil droplet size in the sub-micron range.
  • the droplet sizes will be in the range 120 to 750 nm, more preferably sizes from 120 to 600 nm in diameter.
  • the oil-in water emulsion contains oil droplets of which at least 70% by intensity are less than 500 nm in diameter, more preferably at least 80% by intensity are less than 300 nm in diameter, more preferably at least 90% by intensity are in the range of 120 to 200 nm in diameter.
  • the immunogenic composition is not 3 ⁇ g or 10 ⁇ g of any of SEQ ID Nos.
  • the immunogenic composition is not 3 ⁇ g or 10 ⁇ g of any of SEQ ID Nos. 1 to 7 combined with an adjuvant comprising an oil in water emulsion 5.35 mg squalene, 5.94 mg DL-a-tocopherol and 2.425 mg polysorbate 80 per 0.5 ml dose.
  • the immunogenic composition does not contain an adjuvant comprising a oil in water emulsion having squalene, DL-a-tocopherol and polysorbate 80.
  • the immunogenic composition has a volume of 0.5 to 1.5 ml.
  • the immunogenic composition further comprises additional antigens.
  • the additional antigens are antigens derived from a bacterium selected from the group consisting of S. pneumoniae, H. influenzae, N. meningitidis, E.coli, M.catarrhalis, Clostridium tetani (tetanus), Corynebacterium diphtheria (diphtheria), Bordetella pertussis (pertussis), S.epidermidis, enterococci, S. aureus, and Pseudomonas aeruginosa.
  • the immunogenic composition of the invention may comprise further antigens from C. difficile, for example, the S-layer proteins (WO01/73030).
  • the immunogenic composition further comprises a saccharide from C. difficile.
  • a vaccine comprising an immunogenic composition of the invention and a pharmaceutically acceptable excipient.
  • the vaccine preparations containing immunogenic compositions of the present invention may be used to protect a mammal susceptible to C. difficile infection or treat a mammal with a C. difficile infection, by means of administering said vaccine via systemic or mucosal route.
  • These administrations may include injection via the intramuscular, intraperitoneal, intradermal or subcutaneous routes; or via mucosal administration to the oral/alimentary, respiratory, genitourinary tracts.
  • the vaccine of the invention may be administered as a single dose, components thereof may also be co-administered together at the same time or at different times (for instance pneumococcal saccharide conjugates could be administered separately, at the same time or 1 -2 weeks after the administration of the any bacterial protein component of the vaccine for coordination of the immune responses with respect to each other).
  • 2 different routes of administration may be used.
  • saccharides or saccharide conjugates may be administered intramuscularly (IM) or intradermally (ID) and bacterial proteins may be administered intranasally (IN) or intradermally (ID).
  • the vaccines of the invention may be administered IM for priming doses and IN for booster doses.
  • the content of toxins in the vaccine will typically be in the range 1-25C ⁇ g, preferably 5-5C ⁇ g, most typically in the range 5 - 25 ⁇ g.
  • subjects may receive one or several booster immunizations adequately spaced.
  • Vaccine preparation is generally described in Vaccine Design ("The subunit and adjuvant approach” (eds Powell M.F. & Newman M.J.) (1995) Plenum Press New York). Encapsulation within liposomes is described by Fullerton, US Patent 4,235,877.
  • a vaccine kit comprising a vial containing an immunogenic composition of the invention, optionally in lyophilised form, and further comprising a vial containing an adjuvant as described herein. It is envisioned that in this aspect of the invention, the adjuvant will be used to reconstitute the lyophilised immunogenic composition.
  • a further aspect of the invention is a method of preventing or treating C. difficile infection comprising administering to the host an immunoprotective dose of the immunogenic composition or vaccine or kit of the invention.
  • a method of preventing or treating primary and/or recurrence episodes of C. difficile infection comprising administering to the host an immunoprotective dose of the immunogenic composition or vaccine or kit of the invention.
  • an immunogenic composition or vaccine of the invention for use in the treatment or prevention of a condition or disease caused by C. difficile.
  • C. difficile disease means a disease caused wholly or in part by C. difficile.
  • an immunogenic composition or vaccine of the invention for use in the treatment or prevention of a condition or disease caused wholly or in part by a strain of C. difficile selected from the group consisting of 078, 019, 023, 027, 033, 034, 036, 045, 058, 059, 063, 066, 075, 078, 080, 1 1 1 1 , 1 12, 203, 250 and 571 .
  • the strain is strain 078.
  • treatment means the prevention of occurrence of symptoms of the condition or disease in a subject, the prevention of recurrence of symptoms of the condition or disease in a subject, the delay of recurrence of symptoms of the condition or disease in a subject, the decrease in severity or frequency of symptoms of the condition or disease in a subject, slowing or eliminating the progression of the condition and the partial or total elimination of symptoms of the disease or condition in a subject.
  • an immunogenic composition or vaccine of the invention in the preparation of a medicament for the prevention or treatment of C. difficile disease.
  • the disease is a disease caused by a strain of C. difficile selected from the group consisting of 078, 019, 023, 027, 033, 034, 036, 045, 058, 059, 063, 066, 075, 078, 080, 1 1 1 , 1 12, 203, 250 and 571.
  • the strain is strain 078.
  • a method of preventing or treating C. difficile disease comprising administering the immunogenic composition of the invention or the vaccine of the invention to a mammalian subject such as a human subject.
  • the disease is a disease caused by a strain of C. difficile selected from the group consisting of 078, 019, 023, 027, 033, 034, 036, 045, 058, 059, 063, 066, 075, 078, 080, 1 1 1 , 1 12, 203, 250 and 571 .
  • the strain is strain 078.
  • amino acid numbering used herein is derived from the sequences for CDTa, CDTb, Toxin A and Toxin B presented herein as SEQ ID NO: 1 , SEQ ID NO: 3, SEQ ID NO: 29 and SEQ ID NO: 30, respectively, which are to be considered as reference sequences for these proteins.
  • SEQ ID NO: 1 SEQ ID NO: 2
  • SEQ ID NO: 3 SEQ ID NO: 29
  • SEQ ID NO: 30 SEQ ID NO: 30
  • the AS01 B adjuvant referred to is an adjuvant having 50 ⁇ g QS21 presented in the form of a liposome, 50 ⁇ g 3D-MPL, 0.25 mg cholesterol and 1 .0 mg DOPC per 0.5ml dose.
  • a dose of 50 ⁇ suitable for immunizing mice contains 5 ⁇ g QS21 , 5 ⁇ g 3D-MPL, 0.025mg cholesterol and 0.1 mg DOPC.
  • Example 1 Design of binary toxin antigens
  • the Binary Toxin (other name: ADP-ribosyltransferase toxin) is composed by two components: the enzymatic component, named CDTa and the transport and binding component, named CDTb.
  • CDTb could be divided into five domains. The first one is the prodomain, its cleavage by an enzyme having a chymotrypsin activity allows the heptamerisation of the mature protein. The second domain allows the binding to CDTa. The third and fourth ones are involved in the oligomerisation and membrane insertion. Finally, the last domain is the host cell receptor binding domain.
  • CDTb In the literature (Protein Expression and Purification, 2010, vol. 74 : 42-48), the mature CDTb was described as starting at Leucine 210 of SEQ ID NO: 3. This mature CDTb was named CDTb".
  • the 3D homology structure model obtained for CDTb using the PA antigen from B. anthraxis is accurate for the four first domains of CDTb but not for the receptor-binding domain (these domains of CDTb and PA are too different).
  • the C-terminal part of the fourth domain was analysed on the 3D structure model in order to decide where the last domain will start.
  • CDTb-receptor binding domain Two versions of the CDTb-receptor binding domain were designed. In the first one, this domain starts just after the modelised 3D structure of the fourth domain. In this version, the CDTb-receptor-binding domain will probably have a long flexible peptide in its N-terminal part.
  • the second version of the receptor-binding domain starts where the 2D predicted structures performed on the C-terminal part of CDTb (predictions done using Psipred program, Bioinformatics, 2000, vol. 16 : 404-405) become more compacts after a lack of predicted secondary structures. This could indicate the beginning of a new structural domain. In this second version, no flexible peptide is present at the N-terminal part of the isolated CDTb receptor-binding domain.
  • the first one starts at residue 43 of CDTb of SEQ ID NO: 3 (after the signal peptide cleavage) and finishes at residue Met 211 (given that the experimentally determined first residue of the mature CDTb is Ser 212 ).
  • the second prodomain was designed based on the predicted 3D structure of CDTb. The linker existing between the prodomain and the first structural domain of the mature CDTb protein is removed in this construct.
  • Expression plasmid and recombinant strain C37 and C55 (as set out in Table A).
  • BL21 (DE3) is a non-methionine auxotroph derivative of B834. Strains having the designation (DE3) are lysogenic for a ⁇ prophage that contains an IPTG inducible T7 RNA polymerase, ⁇ DE3 lysogens are designed for protein expression from pET vectors This strain is also deficient in the Ion and ompT proteases.
  • Genotype E.coli BL21 ::DE3 strain, F " ompT sdS B ⁇ rB ⁇ m B " ) gal dcm (DE3).
  • B834 is the parental strain for BL21. These protease-deficient hosts are methionine auxotrophs. ⁇ DE3 lysogens are designed for protein expression from pET vectors This strain is also deficient in the Ion and ompT proteases.
  • E.coli transformants were stripped from agar plate and used to inoculate 200 ml of LBT broth ⁇ 1 % (w/v) glucose +/- kanamycin (50 g/ml) or ampicillin (100 g/ml) to obtain O.D ⁇ 6oonm between 0.1 -0.2. Cultures were incubated overnight at 37 °C, 250 RPM.
  • Overnight culture were diluted to 1 :20 in 500 ml of LBT medium containing +/- kanamycin (50 g/ml) or ampicillin (100 g/ml) and grown at 37°C at a stirring speed of 250 rpm until O.D.620 reached 0.5/0.6.
  • the bacterial pellet was re-suspended in 50mM bicine buffer (pH 8.0) containing 500mM NaCI , 5mM TCEP (Thermo Scientific Pierce, (2-carboxyethyl)phosphine hydrochloride) and a mixture of protease inhibitor (Complete, Roche). Bacteria were lysed using a French Press system 3 X 20 000 PSI. Soluble (supernatant) and insoluble (pellet) components were separated by centrifugation at 20 OOOg for 30 min at 4°C.
  • the 6-His tagged-protein was purified under native conditions on I MAC.
  • the soluble components were loaded on a 5ml GE Histrap column (GE) pre-equilibrated with the same buffer used to bacterial re-suspension. After loading on the column, the column was washed with a 50mM bicine buffer pH8.0, containing 150mM NaCI, 25mM imidazole, 1 mM TCEP. Elution was performed using a 50mM bicine buffer pH8.0 containing 150mM NaCI, 250mM imidazole, 1 mM TCEP.
  • the protein was passed through a GST affinity column ( GE GSTrap FF) pre- equilibrated with buffer 50mM bicine buffer pH8.0 containing 150mM NaCI , 1 mM TCEP, 0.2% tween20 and 20mM reduced glutation, in order to remove the cleaved tag, un-cleaved fusion protein and the PreScission protease.
  • GE GSTrap FF GST affinity column
  • the GST-free protein was collected in the flow through and loaded again on a 5ml GE Histrap column (GE) pre-equilibrated with 50mM bicine buffer pH8.0 containing 150mM NaCI, 1 mM TCEP, 0.2% tween20. After loading on the column, the column was washed with a 50mM bicine buffer pH8.0, containing 150mM NaCI, 0.2% tween20, 1 mM TCEP and 10mM imidazole. Elution was performed using a 50mM bicine buffer pH8.0 containing 150mM NaCI, 0.2% tween20, 1 mM TCEP and 500mM imidazole.
  • the fully activated product was loaded on SEC chromatography (SUPERDEXTM 75) in 50mM bicine buffer pH8.0 containing 300mM NaCI, 1 mM TCEP. Fractions containing CDTb antigen were selected on the basis of purity by SDS-PAGE. Protein concentration was determined using Lowry RC/DC Protein Assay of BioRad. The purified bulk was sterile- filtered on 0.22 ⁇ and stored at -80°C.
  • the bacterial pellet was re-suspended in 50mM bicine buffer (pH 8.0) containing 150 mM NaCI,5mM TCEP (Thermo Scientific Pierce, (2-carboxyethyl) phosphine hydrochloride), 0.4% empigen and a mixture of protease inhibitors (Complete, Roche). Bacteria were lysed using a French Press system 3 X 20 000 PSI. Soluble (supernatant) and insoluble (pellet) components were separated by centrifugation at 20 OOOg for 30 min at 4°C.
  • the 6-His tagged-protein was purified under native conditions on I MAC.
  • the soluble components were loaded on a 5ml GE Histrap column (GE) pre-equilibrated with 50mM bicine buffer (pH 8.0) containing 150mM NaCI , 0.15% empigen, 1 mM TCEP.
  • 50mM bicine buffer pH8.0 containing 150 mM NaCI, 0.2% tween 20, 20mM imidazole and 1 mM TCEP.
  • Elution was performed using a 50mM bicine buffer pH8.0 containing 150mM NaCI, 0.2% tween 20, 500mM imidazole and 1 mM TCEP.
  • CDTa full length (C34, C44, C49, C50, C54, C67. C68. C69. C107. C108. C1 10 as set out in Table A)
  • HMS 174 (DE3).
  • HMS174 strains provide the recA mutation in a K-12 background.
  • Strains having the designation (DE3) are lysogenic for a ⁇ prophage that contains an IPTG inducible T7 RNA polymerase, ⁇ DE3 lysogens are designed for protein expression from pET vectors Genotype: F " recA1 hsdR ⁇ r K12 ' m K i2 + ) ( if R ).
  • BLR(DE3) pLysS is a recA derivative of BL21 .
  • Strains having the designation (DE3) are lysogenic for a ⁇ prophage that contains an IPTG inducible T7 RNA polymerase, ⁇ DE3 lysogens are designed for protein expression from pET vectors This strain is also deficient in the Ion and ompT proteases, pLysS strains express T7 lysozyme which further suppress basal expression of the T7 RNA polymerase prior to induction.
  • Genotype E.coli BLR::DE3 strain, F " ompT hsdS B (r B ⁇ m B " ) gal dcm (DE3) A(srl- recA)306::Tn iO pLysS (Cam R , Tet R ).
  • E.coli transformants were stripped from agar plate and used to inoculate 200 ml of LBT broth ⁇ 1 % (w/v) glucose + kanamycin (50 g/ml) to obtain O.D.600nm between 0.1 -0.2. Cultures were incubated overnight at 37 °C, 250 RPM.
  • Each overnight culture were diluted to 1 :20 in 500 ml of LBT medium containing kanamycin (50 g/ml) and grown at 37°C at a stirring speed of 250 rpm until O.D.620 reached 0.5/0.6.
  • O.D.600nm around 0.6 the cultures were cooled down before inducing the expression of the recombinant protein by addition of 1 mM isopropyl ⁇ -D-l -thiogalactopyranoside (IPTG; EMD Chemicals Inc., catalogue number: 5815) and incubated overnight at 23 °C, 250 RPM.
  • IPTG isopropyl ⁇ -D-l -thiogalactopyranoside
  • CDTa- N-term (C49 and C50 as set out in Table A)
  • HMS 174 (DE3).
  • HMS174 strains provide the recA mutation in a K-12 background.
  • Strains having the designation (DE3) are lysogenic for a ⁇ prophage that contains an IPTG inducible T7 RNA polymerase, ⁇ DE3 lysogens are designed for protein expression from pET vectors Genotype: F " recA1 m K i 2 + ) (Rif R ).
  • E.coli transformants were stripped from agar plate and used to inoculate 200 ml of LBT broth ⁇ 1 % (w/v) glucose + kanamycin (50 ⁇ g ml) to obtain O.D.600nm between 0.1 -0.2. Cultures were incubated overnight at 37 °C, 250 RPM.
  • This overnight culture was diluted to 1 :20 in 500 ml of LBT medium containing kanamycin (50 ⁇ g ml) and grown at 37°C at a stirring speed of 250 rpm until O.D.620 reached 0.5/0.6.
  • the culture was cooled down before inducing the expression of the recombinant protein by addition of 1 mM isopropyl ⁇ -D-l -thiogalactopyranoside (IPTG; EMD Chemicals Inc., catalogue number: 5815) and incubated overnight at 23 °C, 250 RPM. After overnight induction (around 16 hours), O.D. 6 oonm was evaluated after induction and culture was centrifuged at 14 000 RPM for 15 minutes and pellets were frozen at -20°C separately.
  • IPTG isopropyl ⁇ -D-l -thiogalactopyranoside
  • the bacterial pellets were re-suspended in 20mM or 50mM bicine buffers (pH 7.5 or pH 8.0), containing 500mM NaCI , OmM or 5mM TCEP (Thermo Scientific Pierce, (2- carboxyethyl)phosphine hydrochloride) and a mixture of protease inhibitors (Complete, Roche, without EDTA). Bacteria were lysed using a French Press system 3 X 20 000 PSI. Soluble (supernatant) and insoluble (pellet) components were separated by centrifugation at 20 OOOg for 30 min at 4°C.
  • the 6-His tagged-proteins were purified under native conditions on I MAC.
  • the soluble components were loaded on a 5ml GE Histrap column (GE) pre-equilibrated with the same buffer used to bacterial re-suspension. After loading on the column, the column was washed with a 20mM or 50mM bicine buffer (pH7.5 or pH8.0), containing 500mM NaCI, 10mM imidazole, 5mM TCEP. Elution was performed using a 50mM bicine buffer pH7.6, 500mM NaCI, 1 mM TCEP and imidazole (250mM or 500mM).
  • Example 4 Design, cloning, expression and purification of C. difficile CDTb protein with modified pore forming ability.
  • B834 is the parental strain for BL2. These protease-deficient hosts are methionine auxotrophs. ⁇ DE3 lysogens are designed for protein expression from pET and pGEX vectors This strain is also deficient in the Ion and ompT proteases. Selection antibiotic: Ampicillin: 5C ⁇ g/ml/ production o/n at 16C
  • Elution buffer 50mM Bicine - 150mM NaCI- I mMTCEP- 0.2%Tween 20 -250mM Imidazole, -pH8.0
  • Wash buffer 50mM Bicine - 150mM NaCI- I mMTCEP- "l OmM imidazole 0.2%Tween20 , - pH8.0
  • Elution buffer 50mM Bicine - 150mM NaCI- I mMTCEP- 250mM Imidazole - 0.2%Tween 20, -pH8.0
  • Desalting buffer 50mM Bicine - 150mM NaCI- I mMTCEP - 0.2%Tween20, -pH8.0
  • Chymotrypsin treatment Chymotrypsin treatment :
  • Wash buffer 50mM Bicine - 150mM NaCI- I mMTCEP, -pH8.0
  • Elution buffer 50mM Bicine - 150mM NaCI- I mMTCEP- 250mM Imidazole, -pH8.0
  • Desalting buffer 50mM Bicine - 150mM NaCI- I mMTCEP, -pH8.0
  • Lysis buffer 50mM Bicine- M NaCI, - 5mMTCEP pH 7.5
  • Dynamic light scattering is used to evaluate hydrodynamic radius in solution of CDTb purified proteins, in addition to provide information about homogeneity and to detect presence of high molecular weight aggregates within a protein sample. This is based on the calculation of the diffusion coefficient of the different species that are obtained by measuring the light scattering fluctuation, which depends on protein molecular size and shape, and on the other minor constituents of the sample.
  • Protein samples were analysed on a Dynapro plate reader (Wyatt technology), using five acquisition of 15 seconds at 25°C
  • Example 5 Design, cloning, expression and purification of C. difficile CDTb protein with the signal peptide and the prodomain removed and also the receptor binding domain removed and/or the CDTa binding domain removed.
  • CDTb The rational of expressing the different structural domains of CDTb alone was to understand which one leads to degradation and aggregation issues. Two domains were evaluated using this strategy: the receptor-binding domain and the CDTa-binding domain were removed on construct C1 16 and C1 17, respectively. The "oligomerisation” and “membrane insertion” domains of CDTb were not expressed separately because they are potentially structurally related. The following CDTb proteins were designed:
  • B834 is the parental strain for BL2. These protease-deficient hosts are methionine auxotrophs. ⁇ DE3 lysogens are designed for protein expression from pET vectors This strain is also deficient in the Ion and ompT proteases. Selection antibiotic: Kanamycin: 5C ⁇ g/ml/ production o/n at 16C
  • Lysis buffer 50mM Bicine-500mM NaCI, - 5mMTCEP , Complete- pH8.0
  • Gardient "l OOmin at 1 ml/min : 8M -50mM Bicine - 150mM NaCI - 1 mM TECP - pH 8.0 I mMTCEP to 0M Urea 50mM Bicine - 150mM NaCI - 1 mM TECP - pH 8.0
  • Example 6 Design, cloning, expression and purification of C. difficile CDTb protein with modified heptamerisation ability
  • B834 is the parental strain for BL2. These protease-deficient hosts are methionine auxotrophs. ⁇ DE3 lysogens are designed for protein expression from pET vectors This strain is also deficient in the Ion and ompT proteases. Selection antibiotic: Kanamycin: 5C ⁇ g/ml/ production o/n at 16C.
  • Dynamic light scattering is used to evaluate hydrodynamic radius in solution of CdtB purified proteins, in addition to provide information about homogeneity and to detect presence of high molecular weight aggregates within a protein sample. This is based on the calculation of the diffusion coefficient of the different species that are obtained by measuring the light scattering fluctuation, which depends on protein molecular size and shape, and on the other minor constituents of the sample.
  • Protein samples were analysed on a Dynapro plate reader (Wyatt technology), using five acquisition of 15 seconds at 25°C
  • a second generation of antigen design has been produced in order to inhibit the pore forming step by disrupting the hydrophobic interactions between beta-sheets of individual proteins.
  • This binary toxin subunit B (binding cells part) of binary toxins was added alone or mixed with binary toxin subunit A (enzymatic part) on Human colonic epithelial cells (HT29 cells) to evaluate their residual cytotoxicity.
  • HT29 cells Human colonic epithelial cells (HT29 cells) were cultured at 37°C with 5% C02 in DMEM + 10% fetal bovine serum + 1 % glutamine + 1 % antibiotics (penicillin-streptomycin- amphotericin) and were seeded in 96-well black tissue culture plates (Greiner Bio-one, Ref:655090) at a density of 4 10 3 cells/well for HT29.
  • the binary toxin candidates to characterize were diluted in order to reach 2 ⁇ g ml of CDTa and 6 ⁇ g ml of CDTb. Further three-fold dilutions were made in microplate (NUNC, Ref: 163320). 50 ⁇ of serial dilutions of binary toxin preparations were added to the black plates and the microplates were incubated at 37°C with 5% C02 for 6 days.
  • the Hoechst stain was removed from the wells and the cells fluorescence cells was measured using an Axiovision microscope.
  • the cytotoxicity is expressed in percentage of surface covered by fluorescent staining in each well. No cytotoxic (100% of recovery) effect is obtained with cells alone. And Higher level of cytotoxicity is obtained with binary toxin full activated (CDTa C34+ CDTb C37).
  • Dynamic light scattering was used to evaluate hydrodynamic radius in solution of CDTb purified proteins C123, C126 and C128, in addition to provide information about homogeneity and to detect presence of high molecular weight aggregates within a protein sample. This is based on the calculation of the diffusion coefficient of the different species that are obtained by measuring the light scattering fluctuation, which depends on protein molecular size and shape, and on the other minor constituents of the sample.
  • both C126 KO pore forming construct and C128 KO heptamerisation construct have a hydrodynamic radius of the main population around 3nm that might be coherent with a monomer.
  • the C123 KO heptamerisation construct is found as a homogeneous high molecular weight oligomer or aggregate, with a hydrodynamic radius of 15,7nm.
  • Example 9 Design, cloning, expression and purification of C. difficile CDTb fusion protein comprising a full length CDTa protein and a CDTb protein
  • CDTa There are two big advantages for a fusion of CDTa and CDTb : the first one is only one process to obtain 2 proteins. The second one : CDTa is easier than CDTb to produce -> Putting the CDTa as first partner of the fusion could potentially have a positive effect on the entire processability of the fusion.
  • CDTa is easier than CDTb to produce -> Putting the CDTa as first partner of the fusion could potentially have a positive effect on the entire processability of the fusion.
  • C139 both mature CDTa (without its signal peptide) and CDTb (without its signal peptide and without its prodomain) proteins were fused.
  • CDTa partner is mutated at position 428 (a Glutamate is mutated into a Glutamine) in order to mutate the cytotoxic activity of CDTa, and the CDTa partner of this fusion is mutated in position 45 (a Cys was mutated into a Tyr residue) in order to avoid an observed dimerisation of CDTa.
  • the CDTa part of the fusion is the same as for C139.
  • the CDTa-binding domain of CDTb partner was removed in order to potentially avoid interaction between this domain and the CDTa partner.
  • a linker/spacer (6 Gly residues) was added in order to improve the structural flexibility between partners and allow a independent correct folding of the two proteins.
  • the receptor-binding domain of CDTb has a very good expression yield, is homogenous but less immunogenic than CDTb mature. We tried to increase the immunogenicity of this domain by fusing it to the mature CDTa partner. Two different limits were designed for this receptor-binding domain so 2 fusions were evaluated. In C155 and C156 the CDTa partner is the same as for C139 and C145. In C156, between both partners of the fusion, a spacer/linker was added (6 Gly residues). This linker was not needed in the C155 construct because the receptor-binding domain of CDTb used in C155 begins by a long un-structured and flexible peptide that could be used as linker/spacer.
  • CDTb 620-876 of RBD long
  • Analytical ultracentrifugation may be used to determine the homogeneity and size distribution in solution of the different species within a protein sample by measuring the rate at which molecules move in response to a centrifugal force. This is based on the calculation of the coefficients of sedimentation of the different species that are obtained by sedimentation velocity experiment, which depend on their molecular shape and mass.
  • Protein samples are spun in a Beckman-Coulter ProteomeLab XL-1 analytical ultracentrifuge at 8000RPM, 25000RPM or 42000RPM depending of the target protein size, after the AN-60Ti rotor had been equilibrated to 15°C.
  • the molecular weight of the different species may be determined from the C(S) distribution plot (concentration vs sedimentation coefficient), considering that it's a better representation of the raw data than the C(M) distribution (concentration vs molecular weight) to characterize the size distribution of a mixture.
  • Example 11 Immunisation of mice with C. difficile CDTa and CDTb sub-units proteins in a ASOI B formulation-
  • mice immunisation Groups of 25 female Balb/C mice were immunized I M at days 0, 14 and 28 with 5 ⁇ g of full CDTa and CDTb binary toxin purified sub-units. These antigens were injected in an AS01 B formulation.
  • Anti-CDTa and anti-CDTb ELISA titres were determined in individual sera collected at day 42 (Post I I I 14). Results are shown in Figures 4-5.
  • Full CDTa (C34) or full CDTb (C37)sub-units were coated at (for CDTa) or 2 ⁇ g/ml (for CDTb) in phosphate buffered saline (PBS) on high-binding microtitre plates (Nunc MAXISORPTM), overnight at 4° C.
  • PBS phosphate buffered saline
  • the plates were blocked with PBS-BSA 1 % for 30 min at RT with agitation.
  • the mice anti-sera are prediluted 1 /500 in PBS-BSA0.2%-TWEENTM 0.05%. and then, further twofold dilutions were made in microplates and incubated at RT for 30 min. After washing, bound mouse antibody was detected using Jackson ImmunoLaboratories Inc.
  • peroxidase-conjugated Anti-Mouse (ref: 1 15-035-003) diluted 1 :5000 in PBS-BSA0.2%-tween 0.05%.
  • the detection antibodies were incubated for 30 min. at room temperature (RT) with agitation.
  • the colour was developed using 4 mg O- phenylenediamine (OPD) + 5 ⁇ H 2 0 2 per 10 ml pH 4.5 0.1 M citrate buffer for 15 minutes in the dark at room temperature.
  • OPD O- phenylenediamine
  • the reaction was stopped with 50 ⁇ HCI, and the optical density (OD) was read at 490 nm relative to 620 nm.
  • the level of anti-CDTa or anti-CDTb antibodies are expressed in mid-point titres.
  • a GMT was calculated for the 25 samples in each treatment group.
  • HT29 or HCT-1 16 cells Human colonic epithelial cells (HT29 or HCT-1 16 cells) were cultured at 37°C with 5%C0 2 in DMEM +10% fetal bovine serum +1 % glutamine +1 % antibiotics (penicillin-streptomycin- amphotericin) and were seeded in 96-well black tissue culture plates (Greiner Bio-one, Ref : 655090) at a density of 4.10 4 cells/well for HT29 and 1 .10 4 cells/well for HCT1 16.
  • mice anti-sera were prediluted 1 :50 in cell media and then, further three-fold dilutions were made in microplate (NUNC, Ref : 163320). 50 ⁇ of serial dilutions of mice pooled antisera were added to the black plates. 50 ⁇ of a mix of CDTa (25ng/ml) and chymotrypsin- activated CDTb (75 ng/ml) were then added and the black plates incubated at 37°C with 5% C0 2 for 6 days.
  • the Hoescht stain was removed from the wells and the cells fluorescence cells was measured using an Axiovision microscope.
  • cytotoxicity inhibition titres were defined as the reciprocal dilution inducing a 50% inhibition of the fluorescent signal.
  • a second generation of antigen design has been produced in order to inhibit the pore forming step by disrupting the hydrophobic interactions between beta-sheets of individual proteins.
  • This binary toxin subunit B (binding cells part) of binary toxins was added alone or mixed with binary toxin subunit A (enzymatic part) on Human colonic epithelial cells (HCT1 16) to evaluate their residual cytotoxicity.
  • HCT1 16 cells Human colonic epithelial cells (HCT1 16 cells) were cultured at 37°C with 5% C02 in DMEM + 10% fetal bovine serum + 1 % glutamine + 1 % antibiotics (penicillin-streptomycin- amphotericin) and were seeded in 96-well black tissue culture plates (Greiner Bio-one, Ref:655090) at a density of 10 3 cells/well for HCT1 16.
  • the binary toxin candidates to characterize were diluted in order to reach 2 ⁇ g ml of CDTa and 6 ⁇ g ml of CDTb. Further three-fold dilutions were made in microplate (NUNC, Ref: 163320). 50 ⁇ of serial dilutions of binary toxin preparations were added to the black plates and the microplates were incubated at 37°C with 5% C02 for 6 days. After 6 days, the mix of binary toxin and medium were removed from the well and 10 ⁇ of Hoechst stain (BD Pharmingen, Ref. 561908) diluted 1 :500 in phosphate buffer saline (PBS) was added in each well for 2 hours in the dark at room temperature.
  • PBS phosphate buffer saline
  • the Hoechst stain was removed from the wells and the cells fluorescence cells was measured using an Axiovision microscope.
  • the cytotoxicity is expressed in percentage of surface covered by fluorescent staining in each well. No cytotoxic (100% of recovery) effect is obtained with cells alone. And Higher level of cytotoxicity is obtained with binary toxin full activated (CDTa C34+ CDTb C37).
  • Example 13 Cytotoxicity of CDTa -CDTb fusion proteins on HT29 cells
  • the cytotoxicity of fusions C139, C145, C155 and C156 was tested on HT29 cell lines.
  • the potential residual cytotoxicity associated with the CdtB sub-unit was evaluated by spiking with full CdtA sub-unit.
  • the potential residual cytotoxicity associated with the CdtA sub-unit was evaluated by spiking with full CdtB sub-unit.
  • Full length CDTa and full length CDTb were used as controls.
  • HT29 cells Human colonic epithelial cells (HT29 cells) were cultured at 37°C with 5% C02 in DMEM + 10% fetal bovine serum + 1 % glutamine + 1 % antibiotics (penicillin-streptomycin- amphotericin) and were seeded in 96-well black tissue culture plates (Greiner Bio-one, Ref:655090) at a density of 4 10 3 cells/well for HT29.
  • the binary toxin candidates to characterize were diluted in order to reach 2 ⁇ g ml of CDTa and 6 ⁇ g ml of CDTb. Further three-fold dilutions were made in microplate (NUNC, Ref: 163320). 50 ⁇ of serial dilutions of binary toxin preparations were added to the black plates and the microplates were incubated at 37°C with 5% C02 for 6 days.
  • the cytotoxicity is expressed in percentage of surface covered by fluorescent staining in each well. No cytotoxic (100% of recovery) effect is obtained with cells alone. And Higher level of cytotoxicity is obtained with binary toxin full activated (CDTa C34+ CDTb C37).
  • Example 14 Immunisation of mice with C. difficile CDTb proteins or CDTa -CDTb fusions in AS01 B formulation- Mice immunisation
  • Groups of 12 female Balb/C mice were immunized IM at days 0, 14 and 28 with 1 ⁇ g of CDTa and CDTb binary toxin purified sub-units and with 2 ⁇ g of CDTa-CDTb fusions. These antigens were injected in an AS01 B formulation.
  • Anti-CDTa and anti-CDTb ELISA titres were determined in individual sera collected at day 42 (Post III 14). Results are shown in Figures 12-13.
  • E-428 mutated CDTa (C44) or non activated CDTb (C46)sub-units were coated at ⁇ g/ml in phosphate buffered saline (PBS) on high-binding microtitre plates (Nunc MAXISORPTM), overnight at 4° C. The plates were blocked with PBS-BSA 1 % for 30 min at RT with agitation. The mice anti-sera are prediluted 1/500 in PBS-BSA0.2%-TWEENTM 0.05%. and then, further twofold dilutions were made in microplates and incubated at RT for 30 min. After washing, bound mouse antibody was detected using Jackson ImmunoLaboratories Inc.
  • peroxidase-conjugated Anti-Mouse (ref: 1 15-035-003) diluted 1 :5000 in PBS-BSAO.2%- tween 0.05%.
  • the detection antibodies were incubated for 30 min. at room temperature (RT) with agitation.
  • the colour was developed using 4 mg O-phenylenediamine (OPD) + 5 ⁇ H 2 0 2 per 10 ml pH 4.5 0.1 M citrate buffer for 15 minutes in the dark at room temperature.
  • OPD O-phenylenediamine
  • the reaction was stopped with 50 ⁇ HCI, and the optical density (OD) was read at 490 nm relative to 620 nm.
  • the level of anti-CDTa or anti-CDTb antibodies is expressed in mid-point titers. A GMT was calculated for the 12 samples in each treatment group.
  • Example 15 CDTb and CDTa-CDTb fusion cytotoxicity inhibition assay
  • HT29 or HCT-1 16 cells Human colonic epithelial cells (HT29 or HCT-1 16 cells) were cultured at 37°C with 5%C0 2 in DMEM +10% fetal bovine serum +1 % glutamine +1 % antibiotics (penicillin-streptomycin- amphotericin) and were seeded in 96-well black tissue culture plates (Greiner Bio-one, Ref : 655090) at a density of 4.10 3 cells/well for HT29 and 1.10 3 cells/well for HCT1 16.
  • mice anti-sera were prediluted 1 :50 in cell media and then, further three-fold dilutions were made in microplate (NUNC, Ref : 163320). 50 ⁇ of serial dilutions of mice pooled antisera were added to the black plates. 50 ⁇ of a mix of CDTa (25ng/ml) and chymotrypsin- activated CDTb (75 ng/ml) were then added and the black plates incubated at 37°C with 5% C0 2 for 6 days.
  • the Hoescht stain was removed from the wells and the cells fluorescence cells was measured using an Axiovision microscope.
  • cytotoxicity inhibition titres were defined as the reciprocal dilution inducing a 50% inhibition of the fluorescent signal.
  • CDTa (aa44-463 SEQ ID NO:1 ) C67 SEQ ID NO: 21 mut E428Q-E430Q
  • CDTa (aa44-463 SEQ ID NO: 1 ) C69 SEQ ID NO: 22 mut R345A-Q350A-N385A-R402A- S388F-E428Q-E430Q
  • CDTa (aa44-463 SEQ ID NO: 1 ) C107 SEQ ID NO: 23 mut R345A-Q350A-N385A-R402A- S388F
  • CDTa (aa44-463 SEQ ID NO: 1 ) C108 SEQ ID NO: 24 mut R345A-Q350A-N385A-R402A- S388F-E430Q
  • Toxin B SEQ ID NO: 30
  • CDTa (aa44-463 of SEQ ID NO: 1 ) C34 SEQ ID NO: 36 truncated CDTb protein with the C1 18 SEQ ID NO: 37 signal peptide, prodomain, receptor
  • CDTb' (minus signal peptide) C46 SEQ ID NO: 38
  • CDTa (aa44-463 SEQ ID NO:1 ) mut C44 SEQ ID NO: 39 E428Q
  • CDTa (aa44-463 SEQ ID NO:1 ) mut C54 SEQ ID NO: 40 E430Q
  • CDTa (aa44-463 SEQ ID NO: 1 ) C68 SEQ ID NO: 41 mut R345A-Q350A-N385A-R402A- E428Q-E430Q
  • CDTa (aa44-463 SEQ ID NO: 1 ) C1 10 SEQ ID NO: 42 mut R345A-Q350A-N385A-R402A- S388F-E428Q Fusion CdtA-E428Q-Cdtb RBD C156 SEQ ID NO:58 short (CDTa: aa44-463 of SEQ ID NO:
  • CDTb aa636-876 of SEQ ID NO: 1 ;
  • CDTa linker (aa44-268 SEQ ID NO: C49 SEQ ID NO:59 1 ) without histag
  • CDTa without linker (aa44-260 SEQ C50 SEQ ID NO:60 ID NO:1 ) without histag
  • CDTa N terminal domain (residue Gulke et SEQ ID NO:61 44 to residue 240) without histag
  • CDTa (aa44-463 SEQ ID NO:1 ) C67 SEQ ID NO:62 mut E428Q-E430Q without histag
  • CDTa (aa44-463 SEQ ID NO: 1 ) C69 SEQ ID NO:63 mut R345A-Q350A-N385A-R402A- without
  • CDTa (aa44-463 SEQ ID NO: 1 ) C107 SEQ ID NO:64 mut R345A-Q350A-N385A-R402A- without
  • CDTa (aa44-463 SEQ ID NO: 1 ) C108 SEQ ID NO:65 mut R345A-Q350A-N385A-R402A- without
  • CDTa (aa44-463 of SEQ ID NO: 1 ) C34 SEQ ID NO:70 without histag
  • CDTb' (minus signal peptide), C46 SEQ ID NO:72 without histag
  • CDTa (aa44-463 SEQ ID NO:1 ) mut C44 SEQ ID NO:73 E428Q, without histag
  • CDTa (aa44-463 SEQ ID NO:1 ) mut C54 SEQ ID NO:74 E430Q, without histag
  • CDTa (aa44-463 SEQ ID NO: 1 ) C68 SEQ ID NO:75 mut R345A-Q350A-N385A-R402A- without
  • CDTa (aa44-463 SEQ ID NO: 1 ) C1 10 SEQ ID NO:76 mut R345A-Q350A-N385A-R402A- without
  • AAAAAATTTAG G AAAC AT AAAAG G ATTAGTAATT GT ATAT CT ATATTGTT GAT ATT AT ATCTAACTTTAGGTGGTTTGTTACCTAATAACATTTATGCACAAGACTTACAAAGCTATA GTGAAAAAGTTTGCAATACTACTTACAAGGCTCCTATAGAAAGACCAGAAGATTTTCTTA AAG AT AAAG AAAAG G CT AAAG AATG G GAAAG AAAAG AAG C AG AAAG AATAG AG C AAAAA CTTGAAAGATCTGAAAAAGAAGCATTAGAATCATATAAAAAAGATTCTGTAGAAATAAGT AAATATTCTCAGACAAGAAATTATTTTTATGATTATCAAATAGAAGCAAATTCTCGAGAAA AAGAATATAAAGAACTTCGAAATGCTATATCAAAAAAATAGATAAACCTATGTATGT CTATTATTTT G AAT CT CC AG AAAAATTT G CATTTAATAAAGT AAT AAG AAC AG AAAAT C AA AAC G AAATTT C ATTAG G ATTAAGT
  • AAAAG G CTTTCACCTCTAG CTCTTAACACAATG G ATCAATTTAG CTCTAG ACTG ATTCC
  • AAAT G CGTAATTATTTAG GAG AT C CAAAT CAG C CTAAAACTAATT ATGTT AATCTTAG G
  • CDTb' (minus signal peptide) ligated to Glutathiones-transferase protein (GST underlined) polypeptide sequence.
  • SEQ ID NO: 10 C123 CDTb sequence with F455R.
  • LVLSVDHHHHHH SEQ ID NO: 11 C126 CDTb sequence in which residues 426 (Glutamate) and 453 (Aspartate) were both mutated into alanine.
  • SEQ ID NO: 20 CDTa N terminal domain (residue 44 to residue 240) polypeptide sequence.
  • SEQ ID NO: 22 C69 MVCNTTYKAPIERPEDFLKDKEKAKEWERKEAERIEQKLERSEKEALESYKKDSVEISKYSQ

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Organic Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Immunology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Genetics & Genomics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Epidemiology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Communicable Diseases (AREA)
  • Oncology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
PCT/EP2015/064324 2014-06-25 2015-06-25 Clostridium difficile immunogenic composition Ceased WO2015197737A1 (en)

Priority Applications (15)

Application Number Priority Date Filing Date Title
EP19192151.9A EP3636278A3 (en) 2014-06-25 2015-06-25 Clostridium difficile immunogenic composition
BR112016030096-3A BR112016030096B1 (pt) 2014-06-25 2015-06-25 Composição imunogênica, vacina, e, uso de uma composição imunogênica ou de uma vacina
CA2952118A CA2952118C (en) 2014-06-25 2015-06-25 Clostridium difficile immunogenic composition
PL15733404T PL3160500T3 (pl) 2014-06-25 2015-06-25 Immunogenna kompozycja clostridium difficile
HRP20191864TT HRP20191864T1 (hr) 2014-06-25 2015-06-25 Imunogeni pripravci protiv bakterije clostridium difficile
EP15733404.6A EP3160500B1 (en) 2014-06-25 2015-06-25 Clostridium difficile immunogenic composition
JP2016575190A JP6688233B2 (ja) 2014-06-25 2015-06-25 クロストリジウム・ディフィシル免疫原性組成物
US15/320,190 US20170218031A1 (en) 2014-06-25 2015-06-25 Clostridium difficile immunogenic composition
CN201580039744.7A CN106536544B (zh) 2014-06-25 2015-06-25 艰难梭菌免疫原性组合物
MX2016017094A MX374380B (es) 2014-06-25 2015-06-25 Composicion inmunógena de clostridium difficile.
LT15733404T LT3160500T (lt) 2014-06-25 2015-06-25 Clostridium difficile imunogeninė kompozicija
ES15733404T ES2749701T3 (es) 2014-06-25 2015-06-25 Composición inmunógena de Clostridium difficile
DK15733404T DK3160500T3 (da) 2014-06-25 2015-06-25 Clostridium difficile immunogen sammensætning
SI201530954T SI3160500T1 (sl) 2014-06-25 2015-06-25 Imunogeni sestavek proti Clostridium difficile
CY20191101061T CY1122145T1 (el) 2014-06-25 2019-10-09 Ανοσογονικη συνθεση για clostridium difficile

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
GBGB1411306.2A GB201411306D0 (en) 2014-06-25 2014-06-25 Immunogenic composition
GB1411306.2 2014-06-25
GB1411371.6 2014-06-26
GB201411371A GB201411371D0 (en) 2014-06-26 2014-06-26 Immunogenic composition

Publications (1)

Publication Number Publication Date
WO2015197737A1 true WO2015197737A1 (en) 2015-12-30

Family

ID=53498986

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2015/064324 Ceased WO2015197737A1 (en) 2014-06-25 2015-06-25 Clostridium difficile immunogenic composition

Country Status (17)

Country Link
US (1) US20170218031A1 (https=)
EP (2) EP3636278A3 (https=)
JP (2) JP6688233B2 (https=)
CN (1) CN106536544B (https=)
BE (1) BE1022949B1 (https=)
BR (1) BR112016030096B1 (https=)
CY (1) CY1122145T1 (https=)
DK (1) DK3160500T3 (https=)
ES (1) ES2749701T3 (https=)
HR (1) HRP20191864T1 (https=)
HU (1) HUE045936T2 (https=)
LT (1) LT3160500T (https=)
MX (1) MX374380B (https=)
PL (1) PL3160500T3 (https=)
PT (1) PT3160500T (https=)
SI (1) SI3160500T1 (https=)
WO (1) WO2015197737A1 (https=)

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20190125470A (ko) * 2017-03-15 2019-11-06 노바백스, 인코포레이티드 클로스트리듐 디피실에 대한 면역 반응을 유도하기 위한 방법 및 조성물
WO2019243307A1 (en) 2018-06-19 2019-12-26 Glaxosmithkline Biologicals Sa Immunogenic composition
RU2781057C2 (ru) * 2017-03-15 2022-10-04 Новавакс, Инк. Способы и композиции для индукции иммунного ответа против clostridium difficile
WO2023203063A1 (en) 2022-04-21 2023-10-26 Glaxosmithkline Biologicals Sa Bacteriophage

Citations (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4235877A (en) 1979-06-27 1980-11-25 Merck & Co., Inc. Liposome particle containing viral or bacterial antigenic subunit
US4436727A (en) 1982-05-26 1984-03-13 Ribi Immunochem Research, Inc. Refined detoxified endotoxin product
US4751180A (en) 1985-03-28 1988-06-14 Chiron Corporation Expression using fused genes providing for protein product
US4866034A (en) 1982-05-26 1989-09-12 Ribi Immunochem Research Inc. Refined detoxified endotoxin
US4877611A (en) 1986-04-15 1989-10-31 Ribi Immunochem Research Inc. Vaccine containing tumor antigens and adjuvants
GB2220211A (en) 1988-06-29 1990-01-04 Ribi Immunochem Research Inc Modified lipopolysaccharides
EP0362278A1 (en) 1987-06-05 1990-04-11 THE UNITED STATES OF AMERICA as represented by the Secretary United States Department of Commerce Autocrine motility factors in cancer diagnosis and management
US4935233A (en) 1985-12-02 1990-06-19 G. D. Searle And Company Covalently linked polypeptide cell modulators
EP0382271A1 (en) 1989-02-04 1990-08-16 Akzo Nobel N.V. Tocols as adjuvant in vaccine
WO1994021292A1 (en) 1993-03-23 1994-09-29 Smithkline Beecham Biologicals (S.A.) Vaccine compositions containing 3-o deacylated monophosphoryl lipid a
EP0671948A1 (en) 1992-06-25 1995-09-20 Smithkline Beecham Biolog VACCINE COMPOSITION CONTAINING ADJUVANTS.
WO1996012802A1 (en) 1989-10-31 1996-05-02 Ophidian Pharmaceuticals, Inc. Vaccine and antitoxin for treatment and prevention of c. difficile disease
WO1996033739A1 (en) 1995-04-25 1996-10-31 Smithkline Beecham Biologicals S.A. Vaccines containing a saponin and a sterol
WO1996038591A1 (en) 1995-06-02 1996-12-05 Incyte Pharmaceuticals, Inc. IMPROVED METHOD FOR OBTAINING FULL-LENGTH cDNA SEQUENCES
WO2000061762A1 (en) 1999-04-09 2000-10-19 Techlab, Inc. RECOMBINANT TOXIN A/TOXIN B VACCINE AGAINST $i(CLOSTRIDIUM DIFFICILE)
WO2001073030A2 (en) 2000-03-28 2001-10-04 Diadexus, Inc. Compositions and methods of diagnosing, monitoring, staging, imaging and treating colon cancer
WO2005004791A2 (en) * 2002-11-08 2005-01-20 President And Fellows Of Harvard College Compounds and methods for the treatment and prevention of bacterial infection
WO2013112867A1 (en) 2012-01-27 2013-08-01 Merck Sharp & Dohme Corp. Vaccines against clostridium difficile comprising recombinant toxins
WO2014096393A1 (en) * 2012-12-23 2014-06-26 Glaxosmithkline Biologicals S.A. Immunogenic composition comprising elements of c. difficile cdtb and/or cdta proteins

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2012349753A1 (en) * 2011-12-08 2014-06-19 Novartis Ag Clostridium difficile toxin-based vaccine
EP2928489B1 (en) * 2012-12-05 2019-02-27 GlaxoSmithKline Biologicals S.A. Immunogenic composition

Patent Citations (21)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4235877A (en) 1979-06-27 1980-11-25 Merck & Co., Inc. Liposome particle containing viral or bacterial antigenic subunit
US4436727A (en) 1982-05-26 1984-03-13 Ribi Immunochem Research, Inc. Refined detoxified endotoxin product
US4866034A (en) 1982-05-26 1989-09-12 Ribi Immunochem Research Inc. Refined detoxified endotoxin
US4751180A (en) 1985-03-28 1988-06-14 Chiron Corporation Expression using fused genes providing for protein product
US4935233A (en) 1985-12-02 1990-06-19 G. D. Searle And Company Covalently linked polypeptide cell modulators
US4877611A (en) 1986-04-15 1989-10-31 Ribi Immunochem Research Inc. Vaccine containing tumor antigens and adjuvants
EP0362278A1 (en) 1987-06-05 1990-04-11 THE UNITED STATES OF AMERICA as represented by the Secretary United States Department of Commerce Autocrine motility factors in cancer diagnosis and management
US4912094B1 (en) 1988-06-29 1994-02-15 Ribi Immunochem Research Inc. Modified lipopolysaccharides and process of preparation
US4912094A (en) 1988-06-29 1990-03-27 Ribi Immunochem Research, Inc. Modified lipopolysaccharides and process of preparation
GB2220211A (en) 1988-06-29 1990-01-04 Ribi Immunochem Research Inc Modified lipopolysaccharides
EP0382271A1 (en) 1989-02-04 1990-08-16 Akzo Nobel N.V. Tocols as adjuvant in vaccine
WO1996012802A1 (en) 1989-10-31 1996-05-02 Ophidian Pharmaceuticals, Inc. Vaccine and antitoxin for treatment and prevention of c. difficile disease
EP0671948A1 (en) 1992-06-25 1995-09-20 Smithkline Beecham Biolog VACCINE COMPOSITION CONTAINING ADJUVANTS.
WO1994021292A1 (en) 1993-03-23 1994-09-29 Smithkline Beecham Biologicals (S.A.) Vaccine compositions containing 3-o deacylated monophosphoryl lipid a
WO1996033739A1 (en) 1995-04-25 1996-10-31 Smithkline Beecham Biologicals S.A. Vaccines containing a saponin and a sterol
WO1996038591A1 (en) 1995-06-02 1996-12-05 Incyte Pharmaceuticals, Inc. IMPROVED METHOD FOR OBTAINING FULL-LENGTH cDNA SEQUENCES
WO2000061762A1 (en) 1999-04-09 2000-10-19 Techlab, Inc. RECOMBINANT TOXIN A/TOXIN B VACCINE AGAINST $i(CLOSTRIDIUM DIFFICILE)
WO2001073030A2 (en) 2000-03-28 2001-10-04 Diadexus, Inc. Compositions and methods of diagnosing, monitoring, staging, imaging and treating colon cancer
WO2005004791A2 (en) * 2002-11-08 2005-01-20 President And Fellows Of Harvard College Compounds and methods for the treatment and prevention of bacterial infection
WO2013112867A1 (en) 2012-01-27 2013-08-01 Merck Sharp & Dohme Corp. Vaccines against clostridium difficile comprising recombinant toxins
WO2014096393A1 (en) * 2012-12-23 2014-06-26 Glaxosmithkline Biologicals S.A. Immunogenic composition comprising elements of c. difficile cdtb and/or cdta proteins

Non-Patent Citations (75)

* Cited by examiner, † Cited by third party
Title
"Dorland's Illustrated Medical Dictionary, 25th ed.", 1974, W.B. SANDERS COMPANY
"Merck index, 10th ed.", ., article "entry no.8619"
ADENOVIRUS: A MEDICAL DICTIONARY, BIBLIOGRAPHY, AND ANNOTATED RESEARCH GUIDE TO INTERNET REFERENCES, 2004
ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410
ALTSCHUL ET AL., NUC. ACIDS RES., vol. 25, 1977, pages 3389 - 3402
AUSUBEL ET AL., CURRENT PROTOCOLS IN MOLECULAR BIOLOGY
AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 1995
BARTLETT ET AL., AM. J. CLIN. NUTR., vol. 11, no. 2521-6, 1980
BEIPBARTH ET AL., BIOINFORMATICS, vol. 21, no. 1, 2005, pages I29 - I37
BENJAMIN LEWIN: "Genes V", 1994, OXFORD UNIVERSITY PRESS, ISBN: 0-19-854287-9
BIOINFORMATICS, vol. 16, 2000, pages 404 - 405
BIOINFORMATICS, vol. 22, 2006, pages 195 - 201
BROGLIE ET AL., SCIENCE, vol. 224, 1984, pages 838 - 843
CARUTHERS, M. H. ET AL., NUCL. ACIDS RES. SYMP. SER., 1980, pages 215 - 223
COLBERE-GARAPIN ET AL., J. MOL. BIOL., vol. 150, 1981, pages 1 - 14
CORUZZI ET AL., EMBO J., vol. 3, 1984, pages 1671 - 1680
CREIGHTON, PROTEINS, 1984
CREIGHTON, PROTEINS, STRUCTURES AND MOLECULAR PRINCIPLES, 1983
DALSGAARD ET AL.: "Archiv. fur die gesamte Virusforschung", vol. 44, 1974, SPRINGER VERLAG, article "Saponin adjuvants", pages: 243 - 254
DEVEREAUX ET AL., NUC. ACIDS RES., vol. 12, 1984, pages 387 - 395
ENGELHARD ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 91, 1994, pages 3224 - 3227
FENG; DOOLITTLE, J. MOL. EVOL., vol. 35, 1987, pages 351 - 360
GLOVER, D. M.: "DNA cloning", 1985, IRL PRESS, article HANAHAN D: "Plasmid transformation by Simanis.", pages: 109 - 135
GRANT ET AL., METHODS ENZYMOL., vol. 153, 1987, pages 516 - 544
HAMPTON ET AL.: "Serological Methods, a Laboratory Manual", 1990
HARTMAN; MULLIGAN, PROC. NATL. ACAD. SCI. U.S.A., vol. 85, 1988, pages 8047 - 51
HELLER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 94, 1997, pages 2150 - 2155
HENIKOFF; HENIKOFF, PROC. NATL. ACAD. SCI. USA, vol. 89, 1989, pages 10915
HIGGINS; SHARP, CABIOS, vol. 5, 1989, pages 151 - 153
HOBBS, MCGRAW HILL YEARBOOK OF SCIENCE AND TECHNOLOGY, 1992, pages 191 - 196
HORN ET AL., NUCL. ACIDS RES. SYMP. SER., 1980, pages 225 - 232
KANOKPORN SRISUCHARITPANIT ET AL: "Expression and purification of the active soluble form of binary toxin for structural analysis", PROTEIN EXPRESSION AND PURIFICATION, vol. 82, no. 2, 20 February 2012 (2012-02-20), pages 368 - 372, XP028477061, ISSN: 1046-5928, [retrieved on 20120220], DOI: 10.1016/J.PEP.2012.02.009 *
KARAS ET AL., JOURNAL OF INFECTION, vol. 561, 2010, pages 1 - 9
KARLIN; ALTSCHUL, PROC. NAT'1. ACAD. SCI. USA, vol. 90, 1993, pages 5873 - 5787
KENDREW ET AL.: "The Encyclopedia of Molecular Biology", 1994, BLACKWELL SCIENCE LTD., ISBN: 0-632-02182-9
KROLL ET AL., DNA CELL BIOL., vol. 12, 1993, pages 441 - 453
LAGERSTROM ET AL., PCR METHODS APPLIC., vol. 1, 1991, pages 111 - 19
LOGAN; SHENK, PROC. NATL. ACAD. SCI. U.S.A., vol. 81, 1984, pages 3655 - 3659
LOWY ET AL., CELL, vol. 22, 1990, pages 817 - 23
LYERLY ET AL., CURRENT MICROBIOLOGY, vol. 21, 1990, pages 29 - 32
MADDOX ET AL., J. EXP. MED., vol. 158, 1983, pages 1211 - 1216
MARATEA ET AL., GENE, vol. 40, 1985, pages 39 - 46
MERRIFIELD, J. AM. CHEM. SOC., vol. 85, 1963, pages 2149 - 2146
MURPHY ET AL., PROC. NATL. ACAD. SCI. USA, vol. 83, 1986, pages 8258 - 8262
NEEDLEMAN; WUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 443
PARKER ET AL., NUCL. ACIDS. RES., vol. 19, 1991, pages 3055 - 60
PAUL: "Fundamental Immunology, 3rd ed.", 1993, pages: 243 - 247
PEARSON; LIPMAN, PROC. NAT'L. ACAD. SCI. USA, vol. 85, 1988, pages 2444
PERELLE, M. ET AL., INFECT. IMMUN., vol. 65, 1997, pages 1402 - 1407
PNAS, vol. 101, 2004, pages 16756 - 16761
PORATH ET AL., PROT. EXP. PURIF., vol. 3, 1992, pages 263 - 281
POWELL M.F. & NEWMAN M.J.: "Vaccine Design", 1995, PLENUM PRESS, article "The subunit and adjuvant approach"
PROTEIN EXPRESSION AND PURIFICATION, vol. 74, 2010, pages 42 - 48
RHODES ET AL., METHODS MOL. BIOL., vol. 55, 1995, pages 121 - 131
ROBERGE ET AL., SCIENCE, vol. 269, 1995, pages 202 - 204
ROBERT A. MEYERS: "Molecular Biology and Biotechnology: a Comprehensive Desk Reference", 1995, VCH PUBLISHERS, INC., ISBN: 1-56081-569-8
ROMAS ET AL., YEAST, vol. 8, 1992, pages 423 - 88
SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 2000
SCHARF. ET AL., RESULTS PROBL. CELL DIFFER., vol. 20, 1994, pages 125 - 162
SCHENA ET AL., PROC. NATL. ACAD. SCI. USA, vol. 93, 1996, pages 10614 - 10619
SHAH ET AL., EXPERT REV. ANTI INFECT. THER., vol. 8, no. 5, 2010, pages 555 - 564
SMITH; WATERMAN, ADV. APPL. MATH., vol. 2, 1981, pages 482
STOUTE ET AL., NEW ENGL. J. MED., vol. 336, 1997, pages 86 - 91
SUNDRIYAL A ET AL: "Expression, purification and cell cytotoxicity of actin-modifying binary toxin from Clostridium difficile", PROTEIN EXPRESSION AND PURIFICATION, ACADEMIC PRESS, SAN DIEGO, CA, vol. 74, no. 1, 1 November 2010 (2010-11-01), pages 42 - 48, XP027226634, ISSN: 1046-5928, [retrieved on 20100428], DOI: 10.1016/J.PEP.2010.04.014 *
SUNDRIYAL ET AL., PROTEIN EXPRESSION AND PURIFICATION, vol. 74, 2010, pages 42 - 48
T. NEUMEYER ET AL: "Clostridium botulinum C2 Toxin: IDENTIFICATION OF THE BINDING SITE FOR CHLOROQUINE AND RELATED COMPOUNDS AND INFLUENCE OF THE BINDING SITE ON PROPERTIES OF THE C2II CHANNEL", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 283, no. 7, 11 December 2007 (2007-12-11), pages 3904 - 3914, XP055207643, ISSN: 0021-9258, DOI: 10.1074/jbc.M709807200 *
TAKAMATSU, EMBO J., vol. 6, 1987, pages 307 - 311
THE J. OF BIOL. CHEM., vol. 276, 2001, pages 8371 - 8376
THE J. OF BIOL. CHEM., vol. 283, 2008, pages 3904 - 3914
TRIGLIA ET AL., NUCL. ACIDS RES., vol. 16, 1988, pages 8186
VAN HEEKE; SCHUSTER, J. BIOL. CHEM., vol. 264, 1989, pages 5503 - 5509
WIGLER ET AL., CELL, vol. 11, 1977, pages 223 - 32
WIGLER ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 77, 1980, pages 3567 - 70
WINTER ET AL., RESULTS PROBL. CELL DIFFER., vol. 17, 1991, pages 85 - 105
WOLD, ADENOVIRUS METHODS AND PROTOCOLS, 1998

Cited By (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP7149285B2 (ja) 2017-03-15 2022-10-06 ノババックス,インコーポレイテッド Clostridium difficileに対する免疫応答を誘導するための方法および組成物
JP2020509770A (ja) * 2017-03-15 2020-04-02 ノババックス,インコーポレイテッド Clostridium difficileに対する免疫応答を誘導するための方法および組成物
EP3595709A4 (en) * 2017-03-15 2020-12-23 Novavax, Inc. METHODS AND COMPOSITIONS FOR INDUCING IMMUNE RESPONSES TO CLOSTRIDIUM DIFFICILE
US11123419B2 (en) * 2017-03-15 2021-09-21 Novavax, Inc. Methods and compositions for inducing immune responses against Clostridium difficile
RU2781057C2 (ru) * 2017-03-15 2022-10-04 Новавакс, Инк. Способы и композиции для индукции иммунного ответа против clostridium difficile
KR20190125470A (ko) * 2017-03-15 2019-11-06 노바백스, 인코포레이티드 클로스트리듐 디피실에 대한 면역 반응을 유도하기 위한 방법 및 조성물
RU2781057C9 (ru) * 2017-03-15 2022-11-10 Новавакс, Инк. Способы и композиции для индукции иммунного ответа против clostridium difficile
JP2022179543A (ja) * 2017-03-15 2022-12-02 ノババックス,インコーポレイテッド Clostridium difficileに対する免疫応答を誘導するための方法および組成物
JP7397145B2 (ja) 2017-03-15 2023-12-12 ノババックス,インコーポレイテッド Clostridium difficileに対する免疫応答を誘導するための方法および組成物
KR102640722B1 (ko) * 2017-03-15 2024-02-26 노바백스, 인코포레이티드 클로스트리듐 디피실에 대한 면역 반응을 유도하기 위한 방법 및 조성물
US11938179B2 (en) 2017-03-15 2024-03-26 Novavax, Inc. Methods and compositions for inducing immune responses against Clostridium difficile
WO2019243307A1 (en) 2018-06-19 2019-12-26 Glaxosmithkline Biologicals Sa Immunogenic composition
WO2023203063A1 (en) 2022-04-21 2023-10-26 Glaxosmithkline Biologicals Sa Bacteriophage

Also Published As

Publication number Publication date
EP3160500B1 (en) 2019-08-21
CA2952118A1 (en) 2015-12-30
DK3160500T3 (da) 2019-11-11
BE1022949A1 (fr) 2016-10-21
MX2016017094A (es) 2017-05-03
HUE045936T2 (hu) 2020-01-28
CN106536544B (zh) 2020-04-07
PT3160500T (pt) 2019-11-11
CN106536544A (zh) 2017-03-22
EP3160500A1 (en) 2017-05-03
EP3636278A2 (en) 2020-04-15
MX374380B (es) 2025-03-06
BR112016030096A2 (pt) 2017-08-22
HRP20191864T1 (hr) 2020-01-10
CY1122145T1 (el) 2020-11-25
BE1022949B1 (fr) 2016-10-21
PL3160500T3 (pl) 2020-02-28
ES2749701T3 (es) 2020-03-23
SI3160500T1 (sl) 2019-11-29
JP2017520573A (ja) 2017-07-27
BR112016030096B1 (pt) 2023-10-03
JP6688233B2 (ja) 2020-04-28
JP2020100625A (ja) 2020-07-02
BR112016030096A8 (pt) 2021-07-06
US20170218031A1 (en) 2017-08-03
LT3160500T (lt) 2019-10-25
EP3636278A3 (en) 2020-07-15

Similar Documents

Publication Publication Date Title
EP2934579B1 (en) Immunogenic composition comprising elements of c. difficile cdtb and/or cdta proteins
KR102393038B1 (ko) OspA의 돌연변이체 단편 및 이에 관련된 방법 및 용도
JP2018104446A (ja) 免疫原性組成物
WO2015125118A1 (en) Uspa2 protein constructs and uses thereof
WO2010064243A1 (en) GLUTAMYL tRNA SYNTHETASE (GtS) FRAGMENTS
JP2020100625A (ja) クロストリジウム・ディフィシル免疫原性組成物
CN104508120A (zh) 编码肝素结合血凝素(hbha)融合蛋白质的重组分枝杆菌和其用途
CA2952118C (en) Clostridium difficile immunogenic composition
JP2001149085A (ja) マイコプラズマ属のMycoplasmahyopneumoniaeのmhp3遺伝子の核酸およびタンパク質ならびにそれらの使用
BE1022553A1 (fr) Mutants de spy0269
JP2015532594A (ja) Staphylococcusaureusに対する免疫化のための安定化されたタンパク質
AU2002339236B2 (en) Groel chimeric protein and vaccine
WO2026050864A1 (en) Vaccines and methods for the treatment of neisseria gonorrhoeae infections
US20050063984A1 (en) Antigenic peptide fragments of vapa protein, and uses thereof
BE1022553B1 (fr) Mutants de spy0269

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 15733404

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2952118

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: MX/A/2016/017094

Country of ref document: MX

Ref document number: 15320190

Country of ref document: US

ENP Entry into the national phase

Ref document number: 2016575190

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112016030096

Country of ref document: BR

REEP Request for entry into the european phase

Ref document number: 2015733404

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2015733404

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 112016030096

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20161221