WO2015187977A1 - Methods and compositions for treatment of disorders with follistatin polypeptides - Google Patents

Methods and compositions for treatment of disorders with follistatin polypeptides Download PDF

Info

Publication number
WO2015187977A1
WO2015187977A1 PCT/US2015/034245 US2015034245W WO2015187977A1 WO 2015187977 A1 WO2015187977 A1 WO 2015187977A1 US 2015034245 W US2015034245 W US 2015034245W WO 2015187977 A1 WO2015187977 A1 WO 2015187977A1
Authority
WO
WIPO (PCT)
Prior art keywords
follistatin
polypeptide
amino acid
acid sequence
muscle
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2015/034245
Other languages
English (en)
French (fr)
Inventor
Ravindra Kumar
Asya Grinberg
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Acceleron Pharma Inc
Original Assignee
Acceleron Pharma Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to KR1020207018965A priority Critical patent/KR102305109B1/ko
Priority to KR1020207003791A priority patent/KR102132144B1/ko
Priority to EA201692529A priority patent/EA035455B1/ru
Priority to AU2015269333A priority patent/AU2015269333B2/en
Priority to BR112016028520A priority patent/BR112016028520A2/pt
Priority to CN201580041740.2A priority patent/CN106795224B/zh
Priority to CA2950754A priority patent/CA2950754C/en
Priority to MX2016015868A priority patent/MX382908B/es
Priority to KR1020217029755A priority patent/KR20210119546A/ko
Application filed by Acceleron Pharma Inc filed Critical Acceleron Pharma Inc
Priority to KR1020177000297A priority patent/KR102077286B1/ko
Priority to EP20160287.7A priority patent/EP3721892B1/en
Priority to JP2016570806A priority patent/JP6568110B2/ja
Priority to EP15802909.0A priority patent/EP3152237B1/en
Publication of WO2015187977A1 publication Critical patent/WO2015187977A1/en
Anticipated expiration legal-status Critical
Priority to AU2020210315A priority patent/AU2020210315A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4702Regulators; Modulating activity
    • C07K14/4703Inhibitors; Suppressors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • A61P21/04Drugs for disorders of the muscular or neuromuscular system for myasthenia gravis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • A61P21/06Anabolic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4707Muscular dystrophy
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K19/00Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/1703Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • A61K38/1709Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/475Growth factors; Growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto

Definitions

  • TGF-beta The transforming growth factor-beta (TGF-beta) superfamily contains a variety of growth factors that share common sequence elements and structural motifs. These proteins are known to exert biological effects on a large variety of cell types in both vertebrates and invertebrates. Members of the superfamily perform important functions during embryonic development in pattern formation and tissue specification and can influence a variety of differentiation processes, including adipogenesis, myogenesis, chondrogenesis, cardiogenesis, hematopoiesis,
  • the family is divided into two general branches: the BMP/GDF and the TGF-beta/Activin/BMPIO branches, whose members have diverse, often complementary effects.
  • BMP/GDF the TGF-beta/Activin/BMPIO branches
  • TGF-beta/Activin/BMPIO branches whose members have diverse, often complementary effects.
  • the Piedmontese and Belgian Blue cattle breeds carry a loss-of-function mutation in the GDF8 (also called myostatin) gene that causes a marked increase in muscle mass. Grobet et al., Nat. Genet. 1997, 17(l):71-4.
  • TGF-beta family member Changes in muscle, bone, cartilage and other tissues may be achieved by agonizing or antagonizing signaling that is mediated by an appropriate TGF-beta family member.
  • members of the family may affect more than one tissue, it is desirable in some patient care situations to achieve therapeutic inhibition of members of this family in a localized, rather than systemic, manner.
  • the disclosure provides follistatin polypeptides that are designed to inhibit follistatin ligands (e.g. activin A, activin B, GDF8 and GDF1 1) in proximity to the tissue in which such follistatin polypeptides are administered, while having little or no systemic effects on the patient.
  • follistatin ligands e.g. activin A, activin B, GDF8 and GDF1
  • Follistatin polypeptides described herein include polypeptides comprising an amino acid sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% to any of SEQ ID NOS: 1-4, 7-16 and 26- 43.
  • the follistatin polypeptide is designed to dimerize or form higher order multimers. This may be achieved by fusing the follistatin sequence of a follistatin polypeptide to a domain that confers dimerization or multimerization.
  • An example of such a domain is a constant domain of an immunoglobulin, including, for example, the Fc portion of an immunoglobulin.
  • the follistatin portion is connected directly to the heterologous portion, or an intervening sequence such as a linker may be employed.
  • a linker is the sequence TGGG.
  • the follistatin polypeptide may exhibit heparin binding activity, in the manner that human follistatin-288 has heparin binding activity.
  • the follistatin may have a masked heparin binding domain, in the manner of human follistatin-315.
  • the disclosure provides therapeutically optimized follistatin polypeptides that comprise a portion of an immunoglobulin constant domain from a human IgG that has reduced ADCC or CDC activity relative to native human IgGl . Examples include IgG2,
  • the disclosure provides an optimal active form of follistatin, comprising, consisting essentially of or consisting of the amino acid sequence of SEQ ID NO: 15 or 16 that provides superior protein qualities and activity relative to the native FST(288) and FST(315) forms, particularly in the context of dimeric fusion proteins such as follistatin-Fc proteins.
  • the disclosure provides a polypeptide comprising a first amino acid sequence and a second amino acid sequence, wherein the first amino acid sequence consists of an amino acid sequence selected from the group consisting of SEQ ID NO: 15 and 16, and wherein the second amino acid sequence comprises a constant domain of an immunoglobulin.
  • the linker polypeptide comprises, consists essentially of, or consists of the sequence TGGG.
  • the second amino acid sequence comprises, consists essentially of or consists of, a constant domain of an IgG immunoglobulin.
  • the second amino acid sequence comprises, consists essentially of or consists of a constant domain of an IgG immunoglobulin that has reduced ADCC activity relative to human IgGl .
  • the second amino acid sequence comprises, consists essentially of or consists of a constant domain of an IgG immunoglobulin that has reduced CDC activity relative to human IgGl .
  • the second amino acid sequence comprises, consists essentially of or consists of a constant domain of an IgG immunoglobulin selected from the group: IgGl, IgG2 and IgG4.
  • the second amino acid sequence comprises or consists of an Fc portion of an immunoglobulin, such as an IgG immunoglobulin, which may be an immunoglobulin that has reduced ADCC, CDC or both relative to human IgGl, examples of which include IgG2, IgG4 and an IgG2/4 hybrid or various mutations of any of IgGl, IgG2, IgG3 or IgG4.
  • an immunoglobulin such as an IgG immunoglobulin, which may be an immunoglobulin that has reduced ADCC, CDC or both relative to human IgGl, examples of which include IgG2, IgG4 and an IgG2/4 hybrid or various mutations of any of IgGl, IgG2, IgG3 or IgG4.
  • the disclosure provides follistatin polypeptides that comprise, consist essentially of or consist of an amino acid sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%o, 97%), 98%o,
  • the disclosure provides follistatin polypeptides that comprise, consist essentially of or consist of an amino acid sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence selected from the group of SEQ ID NO: 26-28 and 32-34.
  • the disclosure provides follistatin polypeptides that comprise, consist essentially of or consist of an amino acid sequence that is at least 90%>, 91%>, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence selected from the group of SEQ ID NO: 29-31 and 35-37.
  • Desirable follistatin polypeptides may bind to one or more ligands selected from the group consisting of: myostatin, GDF-11, activin A and activin B with a KD less than InM, ⁇ , 50pM or ⁇ .
  • any of the above mentioned polypeptides may be dimers, including heterodimers or homodimers, or higher order multimers. Any of the above mentioned polypeptides may be incorporated into a pharmaceutical preparation.
  • the disclosure provides nucleic acids encoding any of the follistatin polypeptides disclosed herein and cells comprising such nucleic acids, which cells may be used to produce the follistatin polypeptides.
  • the disclosure provides methods for treating tissues or organs by administering a follistatin polypeptide directly to such tissue.
  • the disclosure provides a method of increasing muscle size or strength in a patient, the method comprising administering an effective amount of a follistatin polypeptide by an intramuscular route of administration to a targeted muscle of a patient in need thereof, wherein the increased muscle size or strength occurs in the targeted muscle, and wherein the follistatin polypeptide does not have a substantial systemic effect on muscle size or strength.
  • the targeted muscle may be damaged, weakened or deficient, as may be the case in a variety of muscle disorders including muscular dystrophies (such as Duchenne muscular dystrophy, Becker's muscular dystrophy and fascioscapulohumeral muscular dystrophy), inflammatory muscle disorders (such as inclusion body myositis), muscle injury or trauma, muscle disuse (as may occur after prolonged bed rest or limb immobilization) and muscle atrophy or weakening as a consequence of aging, cancer or chronic diseases of various types.
  • the methods may also be applied to muscle that is healthy but for which an increase in muscle size or strength of the targeted muscle is desired.
  • a follistatin polypeptide may cause a general decrease in body fat and thereby be useful for treating obesity or other disorders associated with excess body fat, and optionally, follistatin may be administered directly to adipose tissue.
  • the follistatin polypeptide may be administered to only one targeted muscle or to more than one targeted muscle.
  • the methods and follistatin polypeptides may be used to achieve effects on the targeted tissue, e.g. muscle, without substantial effects on other tissues, such as a non-targeted muscle or other organs. As a consequence systemic effects of follistatin may not be observed.
  • a muscle that is contralateral to a targeted muscle may not substantially increase in size or strength or there may be no substantial effect in the patient on a measure selected from the group consisting of: serum FSH levels, liver size, hematocrit, hemoglobin and reticulocyte levels.
  • Figure 1 shows the full, unprocessed amino acid sequence of human follistatin 315 (SEQ ID NO:3).
  • the leader sequence is italicized in bold font, the follistatin N-terminal region (FSN) is indicated by single underlining, and the three follistatin domains (FSDs) are indicated by double underlining.
  • FSN follistatin N-terminal region
  • FSDs three follistatin domains
  • FSDI follistatin domain I
  • FSDIII follistatin domain II
  • FSDIII follistatin domain III
  • Figure 2 shows the effect of 4 weeks treatment, by subcutaneous injection, with either FST(288)-Fc, FST(315)-Fc, or ActRIIB-Fc on lean tissue mass in mice.
  • Vehicle was Tris-buffered saline. Data are means ⁇ SEM. *, P ⁇ 0.05 vs. TBS by unpaired t-test. #, P ⁇ 0.05 vs. FST groups by unpaired t-test.
  • FST(288)-Fc, FST(315)-Fc, and ActRIIB-Fc treatment resulted in significant increases in lean tissue mass compared to vehicle control mice.
  • the increase in lean tissue mass of ActRIIB- Fc treated mice was significantly greater than the increases in lean tissue mass observed in either FST(288)-Fc or FST(315)-Fc treated mice.
  • Figure 3 shows the effect of 4 weeks treatment, by subcutaneous injection twice per week, with either FST(288)-Fc, FST(315)-Fc, or ActRIIB-Fc on grip strength in mice.
  • Vehicle was Tris-buffered saline. Data are means ⁇ SEM. *, P
  • Figure 4 shows the effect of 4 weeks treatment, by subcutaneous injection twice per week, with either FST(288)-IgGl , FST(315)-IgGl, or ActRIIB-Fc on pectoralis (Pecs), tibialis anterior (TA), gastrocnemius (Gastroc), and femoris muscle mass in mice.
  • Vehicle was Tris-buffered saline. Data are means ⁇ SEM. *, P
  • FIG. 5 shows the effect of 4 weeks treatment, by subcutaneous injection, with either FST(288)-IgGl or FST(315)-IgGl on serum levels of follicle- stimulating hormone (FSH).
  • Vehicle was Tris-buffered saline. Data are means ⁇ SEM. *, P ⁇ 0.05 vs. TBS by unpaired t-test.
  • FST(315)-IgGl treatment resulted in a significant decrease in serum FSH levels in comparision to vehicle control mice. In contrast, FST(288)-IgGl treatment had no effect on serum FSH levels
  • Figure 6 shows the effect of 4 weeks treatment, by subcutaneous injection twice weekly, with either FST(288)-IgGl, FST(315)-IgGl, or ActRIIB-mFc on lean tissue mass in mice.
  • Vehicle was Tris-buffered saline. Data are means ⁇ SEM. *, P ⁇ 0.05 vs. TBS by unpaired t-test.
  • ActRIIB-mFc treatment resulted in significant increases in lean tissue mass compared to vehicle control mice. No increases in lean tissue mass were observed in either FST(288)-IgGl or FST(315)- IgGl treated mice.
  • Figure 7 shows the effect of 4 weeks treatment, by intramuscular injection into the right gastrocnemius twice weekly, with either FST(288)-IgGl , FST(315)-IgGl, or ActRIIB-mFc on gastrocnemius muscle mass in mice.
  • Vehicle was Tris-buffered saline.
  • Data are means ⁇ SEM. *, P ⁇ 0.05 vs. TBS by unpaired t- test. #, P ⁇ 0.05 right, injected gastocnemius muscle vs. left, non-injected, gastocnemius muscle by unpaired t-test.
  • FST(288)-IgGl, FST(315)-IgGl, and ActRIIB-mFc treatment significantly increased muscle mass in the right, injected gastocnemius muscle.
  • ActRIIB-mFc treatment also significantly increased muscle mass in the left, non-injected gastocnemius muscle.
  • Figure 8 shows the effect of 3 weeks treatment, by intramuscular injection into the right gastrocnemius twice weekly, with varying doses of FST(288)- IgGl, on gastrocnemius muscle mass in mice, expressed as a ratio over the uninjected, left gastrocnemius.
  • Vehicle was phosphate-buffered saline.
  • Data are means ⁇ SEM. *, P ⁇ 0.05 vs. PBS by unpaired t-test.
  • Increasing doses of FST(288)-IgGl caused an increasing hypertrophy of the injected gastocnemius muscle relative to the uninjected muscle.
  • Figure 9 shows the effect of 4 weeks treatment, by intramuscular injection into the left gastrocnemius twice weekly, with FST(291)-IgGl .
  • Vehicle was phosphate-buffered saline.
  • Data are means ⁇ SEM. *, P ⁇ 0.05 vs. PBS by unpaired t-test.
  • Intramuscular administration of FST(291)-IgG2 caused marked increase in muscle mass in the injected gastocnemius muscle relative to the uninjected muscle and relative to controls.
  • the present disclosure relates to follistatin polypeptides.
  • follistatin refers to a family of follistatin (FST) proteins and follistatin-related proteins, derived from any species.
  • Follistatin is an autocrine glycoprotein that is expressed in nearly all tissues of higher animals. It was initially isolated from follicular fluid and was identified as a protein fraction that inhibited follicle-stimulating hormone (FSH) secretion from the anterior pituitary, and therefore was designated as FSH-suppressing protein (FSP). Subsequently, its primary function has been determined to be the binding and neutralization of members of the TGF- ⁇ superfamily including, for example, activin, a paracrine hormone that enhances secretion of FSH in the anterior pituitary.
  • FSH follistatin-suppressing protein
  • follistatin polypeptide is used to refer to polypeptides comprising any naturally occurring polypeptide of the follistatin family as well as any variants thereof (including mutants, fragments, fusions, and peptidomimetic forms) that retain a useful activity, including, for example, ligand binding (e.g., myostatin, GDF-11, activin A, activin B) or heparin binding.
  • ligand binding e.g., myostatin, GDF-11, activin A, activin B
  • heparin binding e.g., myostatin, GDF-11, activin A, activin B
  • polypeptides include polypeptides comprising an amino acid sequence derived from the sequence of any known follistatin having a sequence at least about 80% identical to the sequence of a follistatin polypeptide, and preferably at least 85%, 90%>, 95%, 97%, 99% or greater identity.
  • follistatin polypeptide may refer to fusion proteins that comprise any of the polypeptides mentioned above along with a heterologous (non-follistatin) portion.
  • An amino acid sequence is understood to be heterologous to follistatin if it is not uniquely found in the long (315 amino acid) form of human follistatin, represented by SEQ ID NO:3.
  • heterologous portions are provided herein, and such heterologous portions may be immediately adjacent, by amino acid sequence, to the follistatin polypeptide portion of a fusion protein, or separated by intervening amino acid sequence, such as a linker or other sequence.
  • Follistatin is a single-chain polypeptide with a range of molecular weights from 31 to 49 kDa based on alternative mRNA splicing and variable glycosylation of the protein.
  • the alternatively spliced mRNAs encode two proteins of 315 amino acids (i.e., FST315) and 288 amino acids (i.e., FST288); follistatin 315 can be further proteolytically degraded to follistatin 303 (FST303).
  • the native human follistatin polypeptide comprises five domains (from the N-terminal side): a signal sequence peptide (amino acids 1-29 of SEQ ID NO: l), an N-terminal domain (FSN) (amino acids 30-94 of SEQ ID NO: l), follistatin domain I (FSDI) (amino acids 95-164 of SEQ ID NO: l), follistatin domain II (FSDII) (amino acids (168-239 of SEQ ID NO: l), and follistatin domain III (FSDIII) (amino acids 245-316 of SEQ ID NO: l).
  • a signal sequence peptide amino acids 1-29 of SEQ ID NO: l
  • FSN N-terminal domain
  • FSN N-terminal domain
  • FSN amino acids 30-94 of SEQ ID NO: l
  • FSDI follistatin domain I
  • FSDIII follistatin domain II
  • FSDIII folli
  • the human follistatin-288 (FST288) precursor has the following amino acid sequence, with the signal peptide indicated in bold, the N-terminal domain (FSN) indicated by single underlining, and the follistatin domains I-III (FSI, FSII, FSIII) indicated by double underlining.
  • the processed (mature) human follistatin variant FST(288) has the following amino acid sequence with the N-terminal domain indicated by single underlining, and the follistatin domains I-III indicated by double underlining.
  • any of the initial amino acids G or N, prior to the first cysteine may be removed by processing or intentionally eliminated without any consequence, and polypeptides comprising such slightly smaller polypeptides are further included.
  • the human follistatin-315 (FST315) precursor has the following amino acid sequence, with the signal peptide indicated in bold, the N-terminal domain (FSN) indicated by single underlining, and the follistatin domains I-III (FSI, FSII, FSIII) indicated by double underlining (NCBI Accession Number AAH04107.1; 344 amino acids).
  • FSN N-terminal domain
  • FSIII, FSIII follistatin domains I-III
  • NCBI Accession Number AAH04107.1; 344 amino acids NCBI Accession Number AAH04107.1; 344 amino acids.
  • the processed (mature) human FST(315) has the following amino acid sequence with the N-terminal domain indicated by single underlining, and the follistatin domains I-III indicated by double underlining. Moreover, it will be appreciated that any of the initial amino acids G or N, prior to the first cysteine may be removed by processing or intentionally eliminated without any consequence, and polypeptides comprising such slightly smaller polypeptides are further included.
  • Follistatin polypeptides of the disclosure may include any naturally occurring domain of a follistatin protein as well as variants thereof (e.g., mutants, fragments, and peptidomimetic forms) that retain a useful activity.
  • FST(315) and FST(288) have high affinity for both activin (activin A and activin B) and myostatin (and the closely related GDFl 1) and that the follistatin domains (e.g., FSN and FSD I-III) are thought to be involved in the binding of such TGF- ⁇ ligands.
  • activin A and activin B activin A and activin B
  • myostatin and the closely related GDFl 1
  • the follistatin domains e.g., FSN and FSD I-III
  • each of these three domains may have a different affinity for these TGF- ⁇ ligands.
  • FSN N-terminal domain
  • FSDI domain contains the heparin binding domain of human follistatin, which has the amino acid sequence of KKCRMNKK KPR (SEQ ID NO: 5). This heparin binding domain can be represented as
  • BBXBXXBBXBXB (SEQ ID NO:6) wherein "B” means a basic amino acid, particularly lysine (K) or arginine (R).
  • B means a basic amino acid, particularly lysine (K) or arginine (R).
  • the present disclosure encompasses, in part, variant follistatin proteins that demonstrate selective binding and/or inhibition of a given TGF- ⁇ ligand relative to the naturally occurring FST protein (e.g., maintaining high-affinity for myostain while having a significantly reduced affinity for activin).
  • the disclosure includes polypeptides comprising the FSN domain, as set forth below, and, for example, one or more heterologous polypeptide, and moreover, it will be appreciated that any of the initial amino acids G or N, prior to the first cysteine may be deleted, as in the example shown below (SEQ ID NO:8).
  • the disclosure includes polypeptides comprising the FSDI domain which contains the minimal core activities of myostatin (and/or
  • GDF11 binding along with heparin binding as set forth below, and, for example, one or more heterologous polypeptide.
  • An FSDI sequence may be advantageously maintained in structural context by expression as a polypeptide further comprising the FSN domain.
  • polypeptides comprising the FSN-FSDI sequence, as set forth below (SEQ ID NO: 10), and, for example, one or more heterologous polypeptide, and moreover, it will be appreciated that any of the initial amino acids G or N, prior to the first cysteine may be removed by processing or intentionally eliminated without any consequence, and polypeptides comprising such slightly smaller polypeptides are further included.
  • CWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMI FNG GAPNCI PCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLD GKTYRNECALLKARCKEQPELEVQYQGRC SEQ ID NO: 10
  • an FSN-FSDI-FSDI construct is sufficient to confer systemic muscle growth when genetically expressed in a mouse, and accordingly the disclosure includes polypeptides comprising the amino acid sequences below and, for example, one or more heterologous polypeptide.
  • FSDII confers activin A and B binding
  • the disclosure provides polypeptides comprising FSDI and FSDII (SEQ ID NO: 12), as well as FSN-FSDI-FSDII constructs (SEQ ID NOS: 13) and, for example, one or more heterologous polypeptide.
  • a follistatin polypeptide of 291 amino acids (representing a truncation of the naturally occurring FST-315) has advantageous properties. Accordingly, unprocessed (SEQ ID NO: 14) and mature FST(291) (SEQ ID NO: 15) polypeptides are included in the disclosure and may be combined with heterologous proteins. Moreover, it will be appreciated that any of the initial amino acids G or N, prior to the first cysteine may be removed by processing or intentionally eliminated without any consequence, and polypeptides comprising such slightly smaller polypeptides are further included, such as the example shown below (SEQ ID NO: 16).
  • the present invention relates to antagonizing a ligand of follistatin (also referred to as a follistatin ligand) with a subject follistatin polypeptide (e.g., an FST-IgG fusion polypeptide).
  • a follistatin polypeptide e.g., an FST-IgG fusion polypeptide
  • compositions and methods of the present disclosure are useful for treating disorders associated with abnormal activity of one or more ligands of follistatin.
  • ligands of follistatin include some TGF- ⁇ family members, such as activin A, activin B, myostatin (GDF8) and GDF11.
  • Follistatin proteins herein may be referred to as FST. If followed by a number, such as FST(288), this indicates that the protein is the 288 form of follistatin. If presented as FST(288)-Fc, this indicates a C-terminal Fc fusion to the FST(288), which may or may not include an intervening linker. The Fc in this instance may be any immunoglobulin Fc portion as that term is defined herein. If presented as FST(288)-IgG2, this indicates a C-terminal Fc fusion to the FST(288) of the Fc portion of human IgG2. [0035] Activins are dimeric polypeptide growth factors and belong to the
  • TGF- ⁇ superfamily There are three activins (A, B, and AB) that are
  • activins C and E have been identified, although the function of these proteins is poorly understood.
  • activins are unique and multifunctional factors that can stimulate hormone production in ovarian and placental cells, support neuronal cell survival, influence cell-cycle progress positively or negatively depending on cell type, and induce mesodermal differentiation at least in amphibian embryos (DePaolo et al., 1991, Proc SocEp Biol Med. 198:500-512; Dyson et al, 1997, Curr Biol. 7:81-84; Woodruff, 1998, Biochem Pharmacol. 55:953- 963).
  • erythroid differentiation factor isolated from the stimulated human monocytic leukemic cells was found to be identical to activin A (Murata et al., 1988, PNAS, 85:2434). It was suggested that activin A acts as a natural regulator of erythropoiesis in the bone marrow. In several tissues, activin signaling is antagonized by its related heterodimer, inhibin. For example, during the release of follicle- stimulating hormone (FSH) from the pituitary, activin promotes FSH secretion and synthesis, while inhibin prevents FSH secretion and synthesis.
  • FSH follicle- stimulating hormone
  • Activin has also been implicated as a negative regulator of muscle mass and function, and activin antagonists can promote muscle growth or counteract muscle loss in vivo.
  • Link and Nishi Exp Cell Res. 1997 Jun 15;233(2):350-62; He et al, Anat Embryol (Berl). 2005 Jun;209(5):401-7; Souza et al. Mol Endocrinol. 2008 Dec;22(12):2689-702; Am J Physiol Endocrinol Metab. 2009 Jul;297(l):E157-64; Gilson et al. Zhou et al. Cell. 2010 Aug 20;142(4):531-43.
  • GDF8 Growth and Differentiation Factor-8
  • GDF8 is a negative regulator of skeletal muscle mass. GDF8 is highly expressed in the developing and adult skeletal muscle. The GDF8 null mutation in transgenic mice is characterized by a marked hypertrophy and hyperplasia of the skeletal muscle (McPherron et al, Nature, 1997, 387:83-90). Similar increases in skeletal muscle mass are evident in naturally occurring mutations of GDF8 in cattle (Ashmore et al, 1974, Growth, 38:501-507; Swatland and Kieffer, J. Anim. Sci., 1994, 38:752-757; McPherron and Lee, Proc. Natl. Acad.
  • GDF8 can modulate the production of muscle-specific enzymes (e.g., creatine kinase) and modulate myoblast cell proliferation (WO
  • the GDF8 propeptide can noncovalently bind to the mature GDF8 domain dimer, inactivating its biological activity (Miyazono et al. (1988) J. Biol.
  • Absolute and “approximately” shall generally mean an acceptable degree of error for the quantity measured given the nature or precision of the measurements. Typically, exemplary degrees of error are within 20 percent (%), preferably within 10%, and more preferably within 5% of a given value or range of values.
  • the terms “about” and “approximately” may mean values that are within an order of magnitude, preferably within 5-fold and more preferably within 2-fold of a given value.
  • the methods of the invention may include steps of comparing sequences to each other, including wild-type sequence to one or more mutants
  • sequence variants typically comprise alignments of polymer sequences, e.g., using sequence alignment programs and/or algorithms that are well known in the art (for example, BLAST, FASTA and MEGALIGN, to name a few).
  • sequence alignment programs and/or algorithms that are well known in the art (for example, BLAST, FASTA and MEGALIGN, to name a few).
  • sequence alignment programs and/or algorithms that are well known in the art (for example, BLAST, FASTA and MEGALIGN, to name a few).
  • sequence alignment programs and/or algorithms that are well known in the art (for example, BLAST, FASTA and MEGALIGN, to name a few).
  • homologous in all its grammatical forms and spelling variations, refers to the relationship between two proteins that possess a “common evolutionary origin,” including proteins from superfamilies in the same species of organism, as well as homologous proteins from different species of organism. Such proteins (and their encoding nucleic acids) have sequence homology, as reflected by their sequence similarity, whether in terms of percent identity or by the presence of specific residues or motifs and conserved positions.
  • homologous when modified with an adverb such as "highly,” may refer to sequence similarity and may or may not relate to a common evolutionary origin.
  • sequence similarity in all its grammatical forms, refers to the degree of identity or correspondence between nucleic acid or amino acid sequences that may or may not share a common evolutionary origin.
  • the disclosure relates to follistatin polypeptides (e.g., FST-Fc polypeptides), and particularly truncated forms exemplified by polypeptides comprising SEQ ID NO:2, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 16, and variants thereof.
  • the fragments, functional variants, and modified forms have similar, the same or improved biological activities of their corresponding wild- type follistatin polypeptides.
  • a follistatin variant of the disclosure may bind to and inhibit function of a follistatin ligand (e.g., activin A, activin AB, activin B, and GDF8).
  • a follistatin polypeptide modulates growth of tissues, particularly muscle.
  • follistatin polypeptides include polypeptides comprising, consisting essentially of or consisting of the amino acid sequences by any of SEQ ID Nos. 1-16 and 26-43, as well as polypeptides comprising, consisting essentially of or consisting of amino acid sequences that are at least 80%, 85%, 90%>, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to an amino acid sequence of any of SEQ ID Nos. 1-16 and 26-43. Variations on these
  • polypeptides may be prepared according to the following guidance.
  • the numbering of amino acids in the follistatin polypeptides is based on the sequence of SEQ ID NO: l, regardless of whether the native leader sequence is used.
  • follistatin is characterized by three cysteine-rich regions (i.e., FS domains I-III) that are believed to mediate follistatin- ligand binding.
  • FS domains I-III cysteine-rich regions
  • polypeptide constructs comprising only one of the three FS-binding domains (e.g., FSDI) retains strong affinity towards certain follistatin-ligands (e.g., myostatin) and is biologically active in vivo.
  • FSDI polypeptide constructs comprising only one of the three FS-binding domains
  • FSDI follistatin-ligands
  • variant follistatin polypeptides of the disclosure may comprise one or more active portions of a follistatin protein.
  • constructs of the disclosure may begin at a residue corresponding to amino acids 30-95 of SEQ ID NO: 1 and end at a position corresponding to amino acids 316-344 of SEQ ID NO: 1.
  • Other examples include constructs that begin at a position from 30-95 of SEQ ID NO: 1 and end at a position corresponding to amino acids 164-167 or 238-244.
  • Others may include any of SEQ ID Nos. 7-16.
  • variant follistatin proteins of the disclosure include polypeptides that comprise one or more FS domains selected from FSDI (amino acids 95-164 of SEQ ID NO: l (i.e., SEQ ID NO:2), FSDII (amino acids 168-239 of SEQ ID NO: l), or FSDIII (amino acids 245-316 of SEQ ID NO: l) as well as proteins that comprise one or more FS domains selected from a sequence at least 80%, 85%, 90%>, 92%>, 95%>, 96%, 97%, 98% or 99% identical to FSDI (amino acids 95-164 of SEQ ID NO: 1 (i.e., SEQ ID NO:2), FSDII (amino acids 168-239 of SEQ ID NO:l), or FSDIII (amino acids 245-316 of S
  • recombinant proteins maintain the desired activity including, for example, follistatin ligand-binding activity (e.g., myostatin) and biological activity (e.g., inducing muscle mass and/or strength).
  • follistatin variant polypeptides include, for example, polypeptides having domain structures such as FSDI-FSDII-FSDIII, FSDI- FSDIII, FSDI-FSDI-FSDIII, FSDI-FSDII, FSDI-FSDI, FSN-FSDI-FSDII-FSDIII, FSN-FSDI-FSDII, FSN-FSDI-FSDI, FSN-FSDI-FSDIII, FSN-FSDI-FSDI-FSDIII, and polypeptides obtained by fusing other heterologous polypeptides to the N-termini or the C-termini of these polypeptides.
  • follistatin variants of the disclosure have reduced or abolished binding affinity for one or more follistatin ligands.
  • the disclosure provides follistatin variants that have reduced or abolished binding affinity for activin.
  • the disclosure provides follistatin variants that have reduced or abolished binding affinity for activin but retain high affinity for myostatin.
  • the disclosure provides follistatin variants that do not comprise a sequence corresponding to the FSDII domain or functionally active FSDII domain.
  • follistatin polypeptides of the disclosure may include a variant obtained through partial or complete deletion of the FSDII domain.
  • such follistatin variants include the deletion of one or more cysteine residues within the FSDII region or substitution with non-cysteine amino acids.
  • the follistatin proteins of the disclosure may comprise a signal sequence.
  • the signal sequence can be a native signal sequence of a follistatin protein (e.g., amino acids 1-29 of SEQ ID NO: 1) or a signal sequence from another protein, such as tissue plasminogen activator (TP A) signal sequence or a honey bee melatin (HBM) signal sequence.
  • TP A tissue plasminogen activator
  • HBM honey bee melatin
  • N-linked glycosylation sites may be added to a follistatin polypeptide, and may increase the serum half-life of an FST-Fc fusion protein.
  • N-X-S/T sequences may be generally introduced at positions outside the ligand-binding pocket.
  • N-X-S/T sequences may be introduced into the linker between the follistatin sequence and the Fc or other fusion component. Such a site may be introduced with minimal effort by introducing an N in the correct position with respect to a pre-existing S or T, or by introducing an S or T at a position
  • a follistatin variant may include one or more additional, non-endogenous N-linked glycosylation consensus sequences.
  • the present disclosure contemplates making functional variants by modifying the structure of a follistatin polypeptide for such purposes as enhancing therapeutic efficacy, or stability (e.g., ex vivo shelf life and resistance to proteolytic degradation in vivo).
  • Modified follistatin polypeptides can also be produced, for instance, by amino acid substitution, deletion, or addition.
  • Whether a change in the amino acid sequence of a follistatin polypeptide results in a functional homolog can be readily determined by assessing the ability of the variant follistatin polypeptide to produce a response in cells in a fashion similar to the wild-type follistatin polypeptide, or to bind to one or more ligands, such as activin or myostatin in a fashion similar to wild-type follistatin.
  • the present invention contemplates specific mutations of the follistatin polypeptides so as to alter the glycosylation of the polypeptide.
  • Such mutations may be selected so as to introduce or eliminate one or more glycosylation sites, such as O-linked or N-linked glycosylation sites.
  • Asparagine-linked glycosylation recognition sites generally comprise a tripeptide sequence, asparagine-X-threonine (where "X" is any amino acid) which is specifically recognized by appropriate cellular glycosylation enzymes.
  • the alteration may also be made by the addition of, or substitution by, one or more serine or threonine residues to the sequence of the wild-type follistatin polypeptide (for O-linked glycosylation sites).
  • a variety of amino acid substitutions or deletions at one or both of the first or third amino acid positions of a glycosylation recognition site (and/or amino acid deletion at the second position) results in non-glycosylation at the modified tripeptide sequence.
  • sugar(s) may be attached to (a) arginine and histidine; (b) free carboxyl groups; (c) free sulfhydryl groups such as those of cysteine; (d) free hydroxyl groups such as those of serine, threonine, or hydroxyproline; (e) aromatic residues such as those of phenylalanine, tyrosine, or tryptophan; or (f) the amide group of glutamine.
  • Removal of one or more carbohydrate moieties present on an ActRIIB polypeptide may be accomplished chemically and/or enzymatically.
  • Chemical deglycosylation may involve, for example, exposure of the follistatin polypeptide to the compound trifluoromethanesulfonic acid, or an equivalent compound. This treatment results in the cleavage of most or all sugars except the linking sugar (N-acetylglucosamine or N-acetylgalactosamine), while leaving the amino acid sequence intact. Chemical deglycosylation is further described by Hakimuddin et al. (1987) Arch.
  • follistatin polypeptides can be adjusted, as appropriate, depending on the type of expression system used, as mammalian, yeast, insect and plant cells may all introduce differing glycosylation patterns that can be affected by the amino acid sequence of the peptide.
  • follistatin proteins for use in humans will be expressed in a mammalian cell line that provides proper glycosylation, such as HEK293 or CHO cell lines, although other mammalian expression cell lines are expected to be useful as well.
  • This disclosure further contemplates a method of generating variants, particularly sets of combinatorial variants of an follistatin polypeptide, including, optionally, truncation variants; pools of combinatorial mutants are especially useful for identifying functional variant sequences.
  • the purpose of screening such combinatorial libraries may be to generate, for example, follistatin polypeptide variants that have altered properties, such as altered pharmacokinetics, or altered ligand binding.
  • a variety of screening assays are provided below, and such assays may be used to evaluate variants.
  • a follistatin polypeptide variant may be screened for ability to bind to a follistatin polypeptide, to prevent binding of a follistatin ligand to a follistatin polypeptide.
  • a follistatin polypeptide or its variants may also be tested in a cell-based or in vivo assay. For example, the effect of a follistatin polypeptide variant on the expression of genes involved in muscle production may be assessed. This may, as needed, be performed in the presence of one or more recombinant follistatin ligand proteins (e.g., activin A), and cells may be transfected so as to produce a follistatin polypeptide and/or variants thereof, and optionally, a follistatin ligand. Likewise, a follistatin polypeptide may be administered to a mouse or other animal, and one or more muscle properties, such as muscle mass or strength may be assessed. Such assays are well known and routine in the art. A responsive reporter gene may be used in such cell lines to monitor effects on downstream signaling.
  • Combinatorially-derived variants can be generated which have a selective potency relative to a naturally occurring follistatin polypeptide.
  • Such variant proteins when expressed from recombinant DNA constructs, can be used in gene therapy protocols.
  • mutagenesis can give rise to variants which have intracellular half-lives dramatically different than the corresponding a wild-type follistatin polypeptide.
  • the altered protein can be rendered either more stable or less stable to proteolytic degradation or other processes which result in destruction of, or otherwise inactivation of a native follistatin polypeptide.
  • Such variants, and the genes which encode them can be utilized to alter follistatin polypeptide levels by modulating the half-life of the follistatin polypeptides. For instance, a short half-life can give rise to more transient biological effects and, when part of an inducible expression system, can allow tighter control of recombinant follistatin polypeptide levels within the cell.
  • the follistatin polypeptides of the disclosure may further comprise post-translational modifications in addition to any that are naturally present in the follistatin polypeptides.
  • modifications include, but are not limited to, acetylation, carboxylation, glycosylation, phosphorylation, lipidation, and acylation.
  • the modified follistatin polypeptides may contain non- amino acid elements, such as polyethylene glycols, lipids, poly- or mono-saccharide, and phosphates. Effects of such non-amino acid elements on the functionality of a follistatin polypeptide may be tested as described herein for other follistatin polypeptide variants.
  • follistatin polypeptide When a follistatin polypeptide is produced in cells by cleaving a nascent form of the follistatin polypeptide, post-translational processing may also be important for correct folding and/or function of the protein.
  • Different cells such as CHO, HeLa, MDCK, 293, WI38, NIH-3T3 or HEK293 have specific cellular machinery and characteristic mechanisms for such post-translational activities and may be chosen to ensure the correct modification and processing of the follistatin polypeptides.
  • follistatin polypeptides include fusion proteins having at least a portion of a follistatin polypeptide and one or more fusion domains.
  • fusion domains include, but are not limited to, polyhistidine, Glu-Glu, glutathione S transferase (GST), thioredoxin, protein A, protein G, an immunoglobulin heavy chain constant region (e.g., an Fc), maltose binding protein (MBP), or human serum albumin.
  • GST glutathione S transferase
  • a fusion domain may be selected so as to confer a desired property. For example, some fusion domains are particularly useful for isolation of the fusion proteins by affinity chromatography.
  • relevant matrices for affinity chromatography such as glutathione-, amylase-, and nickel- or cobalt- conjugated resins are used.
  • Many of such matrices are available in "kit” form, such as the Pharmacia GST purification system and the QIAexpressTM system
  • a fusion domain may be selected so as to facilitate detection of the follistatin polypeptides.
  • detection domains include the various fluorescent proteins (e.g., GFP) as well as "epitope tags," which are usually short peptide sequences for which a specific antibody is available.
  • epitope tags for which specific monoclonal antibodies are readily available include FLAG, influenza virus haemagglutinin (HA), and c-myc tags.
  • the fusion domains have a protease cleavage site, such as for Factor Xa or Thrombin, which allows the relevant protease to partially digest the fusion proteins and thereby liberate the recombinant proteins therefrom. The liberated proteins can then be isolated from the fusion domain by subsequent chromatographic separation.
  • a follistatin polypeptide is fused with a domain that stabilizes the follistatin polypeptide in vivo (a "stabilizer” domain).
  • stabilizing is meant anything that increases serum half- life, regardless of whether this is because of decreased destruction, decreased clearance by the kidney, or other pharmacokinetic effect.
  • Fusions with the Fc portion of an immunoglobulin are known to confer desirable pharmacokinetic properties on a wide range of proteins. Likewise, fusions to human serum albumin can confer desirable properties. Other types of fusion domains that may be selected include multimerizing (e.g., dimerizing, tetramerizing) domains and functional domains (that confer an additional biological function, such as further stimulation of muscle growth).
  • the present disclosure provides fusion proteins comprising follistatin polypeptides fused to a polypeptide comprising a constant domain of an immunoglobulin, such as a CHI, CH2 or CH3 domain of an immunoglobulin, such as a CHI, CH2 or CH3 domain of an immunoglobulin, such as a CHI, CH2 or CH3 domain of an immunoglobulin, such as a CHI, CH2 or CH3 domain of an immunoglobulin, such as a CHI, CH2 or CH3 domain of an immunoglobulin, such as a CHI, CH2 or CH3 domain of an immunoglobulin, such as a CHI, CH2 or CH3 domain of an immunoglobulin, such as a CHI, CH2 or CH3 domain of an immunoglobulin, such as a CHI, CH2 or CH3 domain of an immunoglobulin, such as a CHI, CH2 or CH3 domain of an immunoglobulin, such as a CHI, CH2 or CH3 domain of an
  • an Fc domain derived from human IgGl and IgG2 are provided below (SEQ ID NO: 17 and SEQ ID NO: 18, respectively).
  • an IgG2, IgG4 or IgG2/4 Fc domain is particularly advantageous for fusion with follistatin polypeptides that retain heparin binding activity because these Fc species have reduced CDC and/or ADCC activity which may be harmful to the cells to which these heparin binding polypeptides may adhere.
  • Other mutations are known that decrease either CDC or ADCC activity, and collectively, any of these variants are included in the disclosure and may be used as advantageous components of a follistatin fusion protein.
  • the Fc domain of SEQ ID NO: 17 has one or more mutations at residues such as Asp-265, Lys-322, and Asn-434 (numbered in accordance with the corresponding full-length IgGl).
  • the mutant Fc domain having one or more of these mutations e.g., Asp-265 mutation
  • the mutant Fc domain having one or more of these mutations has increased ability of binding to the MHC class I-related Fc-receptor (FcRN) relative to a wildtype Fc domain.
  • a follistatin polypeptide may be placed C-terminal to a heterologous domain, or, alternatively, a heterologous domain may be placed C-terminal to a follistatin polypeptide.
  • the follistatin polypeptide domain and the heterologous domain need not be adjacent in a fusion protein, and additional domains or amino acid sequences may be included C- or N-terminal to either domain or between the domains.
  • an immunoglobulin Fc domain or simply “Fc” is understood to mean the carboxyl-terminal portion of an immunoglobulin chain constant region, preferably an immunoglobulin heavy chain constant region, or a portion thereof.
  • an immunoglobulin Fc region may comprise 1) a CHI domain, a CH2 domain, and a CH3 domain, 2) a CHI domain and a CH2 domain, 3) a CHI domain and a CH3 domain, 4) a CH2 domain and a CH3 domain, or 5) a combination of two or more domains and an immunoglobulin hinge region.
  • the immunoglobulin Fc region comprises at least an immunoglobulin Fc region
  • a follistatin polypeptide may comprise only a domain of an immunoglobulin, such as a CHI domain, a CH2 domain or a CH3 domain. Many of these domains confer desirable pharmacokinetic properties as well as dimerization or higher order multimerization.
  • the class of immunoglobulin from which the heavy chain constant region is derived is IgG (Igy) ( ⁇ subclasses 1, 2, 3, or 4).
  • IgG immunoglobulin
  • Other classes of immunoglobulin, IgA (Iga), IgD (Ig5), IgE (Igs) and IgM (3 ⁇ 4 ⁇ ) may be used.
  • IgA immunoglobulin heavy chain constant region
  • IgD Ig5
  • IgE Igs
  • IgM 3 ⁇ 4 ⁇
  • the choice of appropriate immunoglobulin heavy chain constant region is discussed in detail in U.S. Pat. Nos. 5,541,087 and 5,726,044.
  • the choice of particular immunoglobulin heavy chain constant region sequences from certain immunoglobulin classes and subclasses to achieve a particular result is considered to be within the level of skill in the art.
  • the portion of the DNA construct encoding the immunoglobulin Fc region preferably comprises at least a portion of a hinge domain, and preferably at least a portion of a CH 3 domain of Fc gamma or the homologous domains in any of IgA, IgD, IgE, or IgM.
  • substitution or deletion of amino acids within the immunoglobulin heavy chain constant regions may be useful in the practice of the methods and compositions disclosed herein.
  • One example would be to introduce amino acid substitutions in the upper CH2 region to create an Fc variant with reduced affinity for Fc receptors (Cole et al. (1997) J. Immunol. 159:3613).
  • the C-terminal lysine, or K will be removed and thus any of the polypeptides described herein may omit the C-terminal K that is found in an Fc domain, such as those shown in SEQ ID NO: 17 or SEQ ID NO: 18.
  • the follistatin polypeptides of the present disclosure contain one or more modifications that are capable of stabilizing the follistatin polypeptides.
  • modifications enhance the in vitro half- life of the follistatin polypeptides, enhance circulatory half-life of the follistatin polypeptides or reducing proteolytic degradation of the follistatin polypeptides.
  • stabilizing modifications include, but are not limited to, fusion proteins (including, for example, fusion proteins comprising a follistatin polypeptide and a stabilizer domain), modifications of a glycosylation site (including, for example, addition of a
  • a follistatin polypeptide is fused to a stabilizer domain such as an IgG molecule (e.g., an Fc domain).
  • stabilizer domain not only refers to a fusion domain (e.g., Fc) as in the case of fusion proteins, but also includes nonproteinaceous modifications such as a carbohydrate moiety, or nonproteinaceous polymer, such as polyethylene glycol.
  • the present invention makes available isolated and/or purified forms of the follistatin polypeptides, which are isolated from, or otherwise substantially free of, other proteins.
  • follistatin polypeptides (unmodified or modified) of the disclosure can be produced by a variety of art-known techniques.
  • follistatin polypeptides can be synthesized using standard protein chemistry techniques such as those described in Bodansky, M. Principles of Peptide Synthesis, Springer Verlag, Berlin (1993) and Grant G. A. (ed.), Synthetic Peptides: A User's Guide, W. H. Freeman and Company, New York (1992).
  • automated peptide synthesizers are commercially available (e.g., Advanced
  • the follistatin polypeptides, fragments or variants thereof may be recombinantly produced using various expression systems (e.g., E. coli, Chinese Hamster Ovary cells, COS cells, baculo virus) as is well known in the art (also see below).
  • various expression systems e.g., E. coli, Chinese Hamster Ovary cells, COS cells, baculo virus
  • the modified or unmodified follistatin polypeptides may be produced by digestion of naturally occurring or recombinantly produced full-length follistatin polypeptides by using, for example, a protease, e.g., trypsin, thermolysin, chymotrypsin, pepsin, or paired basic amino acid converting enzyme (PACE).
  • a protease e.g., trypsin, thermolysin, chymotrypsin, pepsin, or paired basic amino acid converting enzyme (PACE).
  • PACE paired basic amino acid converting enzyme
  • follistatin polypeptides may be produced from naturally occurring or recombinantly produced full-length follistatin polypeptides such as standard techniques known in the art, such as by chemical cleavage (e.g., cyanogen bromide, hydroxylamine). 3. Nucleic Acids Encoding Follistatin Polypeptides
  • the invention provides isolated and/or recombinant nucleic acids encoding any of the follistatin polypeptides disclosed herein.
  • the subject nucleic acids may be single-stranded or double stranded.
  • Such nucleic acids may be DNA or RNA molecules. These nucleic acids are may be used, for example, in methods for making follistatin polypeptides.
  • Variant nucleotide sequences include sequences that differ by one or more nucleotide substitutions, additions or deletions, such as allelic variants; and will, therefore, include coding sequences that differ from the nucleotide sequence of the coding sequence designated in SEQ ID NOs: 19-22.
  • the disclosure provides isolated or recombinant nucleic acid sequences that are at least 80%, 85%, 90%>, 95%, 96% 97%, 98%, 99%, or 100% identical to SEQ ID NOs: 19-22, and particularly those portions thereof that are derived from follistatin (nucleotides corresponding to amino acids 95- 164 of SEQ ID NO: 1).
  • follistatin nucleotides corresponding to amino acids 95- 164 of SEQ ID NO: 1
  • nucleic acid sequences complementary to SEQ ID NOs: 19-22, and variants of SEQ ID NO: 19-22 are also within the scope of this disclosure.
  • the nucleic acid sequences of the disclosure can be isolated, recombinant, and/or fused with a heterologous nucleotide sequence, or in a DNA library.
  • nucleic acids of the invention also include nucleotide sequences that hybridize under highly stringent conditions to the nucleotide sequence designated in SEQ ID NOs: 19-22, complement sequence of SEQ ID NOs: 19-22, or fragments thereof (e.g., nucleotides 19-22).
  • appropriate stringency conditions that promote DNA hybridization can be varied.
  • appropriate stringency conditions which promote DNA hybridization can be varied. For example, one could perform the hybridization at 6.0 x sodium chloride/sodium citrate (SSC) at about 45 °C, followed by a wash of 2.0 x SSC at 50 °C.
  • the salt concentration in the wash step can be selected from a low stringency of about 2.0 x SSC at 50 °C to a high stringency of about 0.2 x SSC at 50 °C.
  • the temperature in the wash step can be increased from low stringency conditions at room temperature, about 22 °C, to high stringency conditions at about 65 °C. Both temperature and salt may be varied, or temperature or salt concentration may be held constant while the other variable is changed.
  • the invention provides nucleic acids which hybridize under low stringency conditions of 6 x SSC at room temperature followed by a wash at 2 x SSC at room temperature.
  • Isolated nucleic acids that differ from the nucleic acids as set forth in SEQ ID NOs: 19-22 due to degeneracy in the genetic code are also within the scope of the disclosure.
  • a number of amino acids are designated by more than one triplet. Codons that specify the same amino acid, or synonyms (for example, CAU and CAC are synonyms for histidine) may result in "silent" mutations that do not affect the amino acid sequence of the protein.
  • CAU and CAC are synonyms for histidine
  • nucleotides up to about 3-5% of the nucleotides
  • nucleic acids encoding a particular protein may exist among individuals of a given species due to natural allelic variation. Any and all such nucleotide variations and resulting amino acid polymorphisms are within the scope of this disclosure.
  • the recombinant nucleic acids of the disclosure may be operably linked to one or more regulatory nucleotide sequences in an expression construct.
  • Regulatory nucleotide sequences will generally be appropriate to the host cell used for expression.
  • suitable regulatory sequences are known in the art for a variety of host cells.
  • said one or more regulatory nucleotide sequences may include, but are not limited to, promoter sequences, leader or signal sequences, ribosomal binding sites, transcriptional start and termination sequences, translational start and termination sequences, and enhancer or activator sequences. Constitutive or inducible promoters as known in the art are contemplated by the disclosure.
  • the promoters may be either naturally occurring promoters, or hybrid promoters that combine elements of more than one promoter.
  • An expression construct may be present in a cell on an episome, such as a plasmid, or the expression construct may be inserted in a chromosome.
  • the expression vector contains a selectable marker gene to allow the selection of transformed host cells. Selectable marker genes are well known in the art and will vary with the host cell used.
  • the subject nucleic acid is provided in an expression vector comprising a nucleotide sequence encoding a follistatin polypeptide and operably linked to at least one regulatory sequence. Regulatory sequences are art- recognized and are selected to direct expression of the follistatin polypeptide.
  • regulatory sequence includes promoters, enhancers, and other expression control elements.
  • Exemplary regulatory sequences are described in Goeddel; Gene Expression Technology: Methods in Enzymology, Academic Press, San Diego, CA (1990).
  • any of a wide variety of expression control sequences that control the expression of a DNA sequence when operatively linked to it may be used in these vectors to express DNA sequences encoding a follistatin polypeptide.
  • Such useful expression control sequences include, for example, the early and late promoters of SV40, tet promoter, adenovirus or cytomegalovirus immediate early promoter, RSV promoters, the lac system, the trp system, the TAC or TRC system, T7 promoter whose expression is directed by T7 RNA polymerase, the major operator and promoter regions of phage lambda, the control regions for fd coat protein, the promoter for 3-phosphoglycerate kinase or other glycolytic enzymes, the promoters of acid phosphatase, e.g., Pho5, the promoters of the yeast a-mating factors, the polyhedron promoter of the baculovirus system and other sequences known to control the expression of genes of prokaryotic or eukaryotic cells or their viruses, and various combinations thereof.
  • the design of the expression vector may depend on such factors as the choice of the host cell to be transformed and/or the type of protein desired to be expressed. Moreover, the vector's copy number, the ability to control that copy number and the expression of any other protein encoded by the vector, such as antibiotic markers, should also be considered.
  • a recombinant nucleic acid of the disclosure can be produced by ligating the cloned gene, or a portion thereof, into a vector suitable for expression in either prokaryotic cells, eukaryotic cells (yeast, avian, insect or mammalian), or both.
  • Expression vehicles for production of a recombinant follistatin polypeptide include plasmids and other vectors.
  • suitable vectors include plasmids of the types: pBR322-derived plasmids, pEMBL-derived plasmids, pEX-derived plasmids, pBTac-derived plasmids and pUC-derived plasmids for expression in prokaryotic cells, such as E. coli.
  • Some mammalian expression vectors contain both prokaryotic sequences to facilitate the propagation of the vector in bacteria, and one or more eukaryotic transcription units that are expressed in eukaryotic cells.
  • the pcDNAI/amp, pcDNAI/neo, pRc/CMV, pSV2gpt, pSV2neo, pSV2-dhfr, pTk2, pRSVneo, pMSG, pSVT7, pko-neo and pHyg derived vectors are examples of mammalian expression vectors suitable for transfection of eukaryotic cells.
  • vectors are modified with sequences from bacterial plasmids, such as pBR322, to facilitate replication and drug resistance selection in both prokaryotic and eukaryotic cells.
  • bacterial plasmids such as pBR322
  • derivatives of viruses such as the bovine papilloma virus (BPV-1), or Epstein-Barr virus (pHEBo, pREP-derived and p205) can be used for transient expression of proteins in eukaryotic cells.
  • BBV-1 bovine papilloma virus
  • pHEBo Epstein-Barr virus
  • pREP-derived and p205 Epstein-Barr virus
  • examples of other viral (including retroviral) expression systems can be found below in the description of gene therapy delivery systems.
  • the various methods employed in the preparation of the plasmids and in transformation of host organisms are well known in the art.
  • baculovirus expression systems include pVL-derived vectors (such as pVL1392, pVL1393 and pVL941), pAcUW-derived vectors (such as pAcUWl), and pBlueBac-derived vectors (such as the ⁇ -gal containing pBlueBac III).
  • a vector will be designed for production of the subject follistatin polypeptides in CHO cells, such as a Pcmv-Script vector (Stratagene, La Jolla, Calif), pcDNA4 vectors (Invitrogen, Carlsbad, Calif.) and pCI- neo vectors (Promega, Madison, Wise).
  • the subject gene constructs can be used to cause expression of the subject follistatin polypeptides in cells propagated in culture, e.g., to produce proteins, including fusion proteins or variant proteins, for purification.
  • This disclosure also pertains to a host cell transfected with a recombinant gene including a coding sequence (e.g., SEQ ID NOs: 19-22) for one or more of the subject follistatin polypeptides.
  • the host cell may be any prokaryotic or eukaryotic cell.
  • a follistatin polypeptide of the disclosure may be expressed in bacterial cells such as E. coli, insect cells (e.g., using a baculovirus expression system), yeast, or mammalian cells. Other suitable host cells are known to those skilled in the art.
  • the present disclosure further pertains to methods of producing the subject follistatin polypeptides.
  • a host cell transfected with an expression vector encoding a follistatin polypeptide can be cultured under appropriate conditions to allow expression of the follistatin polypeptide to occur.
  • the follistatin polypeptide may be secreted and isolated from a mixture of cells and medium containing the follistatin polypeptide.
  • the follistatin polypeptide may be retained cytoplasmically or in a membrane fraction and the cells harvested, lysed and the protein isolated.
  • a cell culture includes host cells, media and other byproducts. Suitable media for cell culture are well known in the art.
  • the subject follistatin polypeptides can be isolated from cell culture medium, host cells, or both, using techniques known in the art for purifying proteins, including ion-exchange chromatography, gel filtration chromatography, ultrafiltration, electrophoresis, and immunoaffinity purification with antibodies specific for particular epitopes of the follistatin polypeptides.
  • the follistatin polypeptide is a fusion protein containing a domain that facilitates its purification.
  • a fusion gene coding for a purification leader sequence such as a poly-(His)/enterokinase cleavage site sequence at the N-terminus of the desired portion of the recombinant follistatin polypeptide, can allow
  • the purification leader sequence can then be subsequently removed by treatment with enterokinase to provide the purified follistatin polypeptide (e.g., see Hochuli et al, (1987) J. Chromatography 411 : 177; and Janknecht et al, PNAS USA 88:8972).
  • the fusion gene can be synthesized by conventional techniques including automated DNA synthesizers.
  • PCR amplification of gene fragments can be carried out using anchor primers that give rise to complementary overhangs between two consecutive gene fragments that can subsequently be annealed to generate a chimeric gene sequence (see, for example, Current Protocols in Molecular Biology, eds. Ausubel et al, John Wiley & Sons: 1992).
  • compositions of the present disclosure including for example FST(288)-IgGl, FST(288)-IgG2, FST(291)-IgGl, FST(291)- IgG2, FST(315)-IgGl, FST(315)-IgG2, and any of the other follistatin polypeptides disclosed herein, can be used for treating or preventing a disease or condition that is described in this section, including diseases or disorders that are associated with abnormal activity of a follistatin polypeptide and/or a follistatin ligand (e.g., GDF8).
  • a follistatin polypeptide e.g., GDF8
  • follistatin-associated conditions These diseases, disorders or conditions are generally referred to herein as "follistatin- associated conditions.”
  • the present disclosure provides methods of treating or preventing an individual in need thereof through administering to the individual a therapeutically effective amount of a follistatin polypeptide as described above. These methods are particularly aimed at therapeutic and
  • a therapeutic that "prevents" a disorder or condition refers to a compound that, in a statistical sample, reduces the occurrence of the disorder or condition in the treated sample relative to an untreated control sample, or delays the onset or reduces the severity of one or more symptoms of the disorder or condition relative to the untreated control sample.
  • treating includes amelioration or elimination of the condition once it has been established.
  • Follistatin-ligand complexes play essential roles in tissue growth as well as early developmental processes such as the correct formation of various structures or in one or more post-developmental capacities including sexual development, pituitary hormone production, and creation of muscle.
  • follistatin- associated conditions include abnormal tissue growth and developmental defects.
  • Exemplary conditions for treatment include neuromuscular disorders (e.g., muscular dystrophy and muscle atrophy), congestive obstructive pulmonary disease (and muscle wasting associated with COPD), muscle wasting syndrome, sarcopenia, and cachexia.
  • Other exemplary conditions include musculodegenerative and neuromuscular disorders, tissue repair (e.g., wound healing), and neurodegenerative diseases (e.g., amyotrophic lateral sclerosis).
  • compositions e.g., FST-Fc polypeptides
  • muscle dystrophy refers to a group of degenerative muscle diseases characterized by gradual weakening and deterioration of skeletal muscles and sometimes the heart and respiratory muscles. Muscular dystrophies are genetic disorders characterized by progressive muscle wasting and weakness that begin with microscopic changes in the muscle. As muscles degenerate over time, the person's muscle strength declines.
  • Exemplary muscular dystrophies that can be treated with a regimen including the subject follistatin polypeptides include: Duchenne Muscular Dystrophy (DMD), Becker Muscular Dystrophy (BMD), Emery-Dreifuss Muscular Dystrophy (EDMD), Limb-Girdle Muscular Dystrophy (LGMD), Facioscapulohumeral Muscular
  • DMD Duchenne Muscular Dystrophy
  • BMD Becker Muscular Dystrophy
  • EDMD Emery-Dreifuss Muscular Dystrophy
  • LGMD Limb-Girdle Muscular Dystrophy
  • FSH or FSHD FLS or FSHD
  • MMD Myotonic Dystrophy
  • OPMD Oculopharyngeal Muscular Dystrophy
  • DD Distal Muscular Dystrophy
  • CMD Congenital Muscular Dystrophy
  • DMD Duchenne Muscular Dystrophy
  • BMD Becker Muscular Dystrophy
  • DMD is one of the most frequent inherited diseases in males, affecting one in 3,500 boys.
  • DMD occurs when the dystrophin gene, located on the short arm of the X chromosome, is broken. Since males only carry one copy of the X chromosome, they only have one copy of the dystrophin gene. Without the dystrophin protein, muscle is easily damaged during cycles of contraction and relaxation. While early in the disease muscle compensates by regeneration, later on muscle progenitor cells cannot keep up with the ongoing damage and healthy muscle is replaced by non-functional fibro-fatty tissue.
  • BMD results from different mutations in the dystrophin gene.
  • BMD patients have some dystrophin, but it is either insufficient in quantity or poor in quality. Having some dystrophin protects the muscles of those with BMD from degenerating as badly or as quickly as those of people with DMD.
  • GDF8 a follistatin ligand
  • polypeptides may act as GDF8 inhibitors (antagonists), and constitute an alternative means of blocking the functions of GDF8 in vivo in DMD and BMD patients.
  • ALS also called Lou Gehrig's disease (motor neuron disease) is a chronic, incurable, and unstoppable CNS disorder that attacks the motor neurons, components of the CNS that connect the brain to the skeletal muscles.
  • the motor neurons deteriorate and eventually die, and though a person's brain normally remains fully functioning and alert, the command to move never reaches the muscles.
  • Most people who get ALS are between 40 and 70 years old.
  • the first motor neurons that weaken are those leading to the arms or legs.
  • CMT Charcot-Marie-Tooth Disease
  • foot deformity very high arched feet
  • foot drop inability to hold foot horizontal
  • "Slapping" gait feet slap on the floor when walking because of foot drop
  • loss of muscle in the lower legs numbness in the feet; difficulty with balance; or weakness in the arms and hands.
  • Muscles of patients with a variety of systemic muscle disorders may be treated with the follistatin polypeptides disclosed herein, including: Lambert-Eaton Myasthenic Syndrome (LEMS); Metabolic Dystrophies; Spinal Muscular Atrophy (SMA); Dermatomyositis (DM); Distal Muscular Dystrophy (DD); Emery-Dreifuss Muscular Dystrophy (EDMD); Endocrine Myopathies; Friedreich's Ataxia (FA); Inherited Myopathies; Mitochondrial Myopathy; Myasthenia Gravis (MG);
  • LEMS Lambert-Eaton Myasthenic Syndrome
  • SMA Spinal Muscular Atrophy
  • DM Dermatomyositis
  • DD Distal Muscular Dystrophy
  • EDMD Emery-Dreifuss Muscular Dystrophy
  • Endocrine Myopathies ; Friedreich's Ataxia (FA); Inherited Myopathies; Mitochondrial Myopathy; Myas
  • Muscles of patients with a post-surgical or disuse atrophy of one or muscles may be treated with the follistatin polypeptides disclosed herein including atrophy after: Hip Fracture; Total Hip Arthroplasty (THA); Total Knee Arthroplasty (TKA) or Rotator Cuff surgery.
  • Muscles of patients suffering from a variety of other diseases that cause muscle loss or weakening may be treated with the follistatin polypeptides disclosed herein, including muscles of patients with the following diseases:
  • sarcopenia various types of cancer, including lung, colon and ovarian cancer, patients on long term ventilation assistance, diabetes, chronic obstructive pulmonary disorder, renal failure, cardiac failure, trauma and disorders of the peripheral nerves.
  • GDF8 expression correlates inversely with fat-free mass in humans and that increased expression of the GDF8 gene is associated with weight loss in men with AIDS wasting syndrome.
  • compounds e.g., follistatin polypeptides
  • a pharmaceutically acceptable carrier e.g., a follistatin polypeptide can be administered alone or as a component of a pharmaceutical formulation (i.e., a therapeutic composition).
  • the subject compounds may be formulated for administration in any convenient way for use in human or veterinary medicine.
  • the therapeutic method of the invention includes administering the composition topically, systemically, or locally as an implant or device.
  • the therapeutic composition for use in this invention is, of course, in a pyrogen-free, physiologically acceptable form.
  • the composition may desirably be encapsulated or injected in a viscous form for delivery to a target tissue site (e.g., bone, cartilage, muscle, fat or neurons), for example, a site having tissue damage. Topical administration may be suitable for wound healing and tissue repair.
  • Therapeutically useful agents other than the follistatin polypeptides may alternatively or additionally, be administered simultaneously or sequentially with the subject compounds (e.g., follistatin polypeptides) in the methods of the invention.
  • compositions of the present invention may include a matrix capable of delivering one or more therapeutic compounds (e.g., follistatin polypeptides) to a target tissue site, providing a structure for the developing tissue and optimally capable of being resorbed into the body.
  • the matrix may provide slow release of the follistatin polypeptides.
  • Such matrices may be formed of materials presently in use for other implanted medical applications.
  • the choice of matrix material is based on biocompatibility, biodegradability, mechanical properties, cosmetic appearance and interface properties. The particular application of the subject compositions will define the appropriate formulation.
  • Potential matrices for the compositions may be biodegradable and chemically defined calcium sulfate, tricalciumphosphate, hydroxyapatite, polylactic acid and polyanhydrides.
  • Other potential materials are biodegradable and biologically well defined, such as bone or dermal collagen.
  • Further matrices are comprised of pure proteins or extracellular matrix components.
  • Other potential matrices are nonbiodegradable and chemically defined, such as sintered hydroxyapatite, bioglass, aluminates, or other ceramics.
  • Matrices may be comprised of combinations of any of the above-mentioned types of material, such as polylactic acid and hydroxyapatite or collagen and tricalciumphosphate.
  • the bioceramics may be altered in composition, such as in calcium-aluminate-phosphate and processing to alter pore size, particle size, particle shape, and biodegradability.
  • an agent may also be administered as a bolus, electuary or paste.
  • one or more therapeutic compounds of the present invention may be mixed with one or more pharmaceutically acceptable carriers, such as sodium citrate or dicalcium phosphate, and/or any of the following: (1) fillers or extenders, such as starches, lactose, sucrose, glucose, mannitol, and/or silicic acid; (2) binders, such as, for example, carboxymethylcellulose, alginates, gelatin, polyvinyl pyrrolidone, sucrose, and/or acacia; (3) humectants, such as glycerol; (4) disintegrating agents, such as agar-agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates, and sodium carbonate; (5) solution retarding agents, such as paraffin; (6) absorption accelerators, such as quaternary ammonium compounds; (7) wetting
  • pharmaceutically acceptable carriers such as sodium citrate or dicalcium phosphate, and/or any of the following: (1) fillers or extenders, such as star
  • compositions may also comprise buffering agents.
  • Solid compositions of a similar type may also be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugars, as well as high molecular weight polyethylene glycols.
  • Liquid dosage forms for oral administration include pharmaceutically acceptable emulsions, microemulsions, solutions, suspensions, syrups, and elixirs.
  • the liquid dosage forms may contain inert diluents commonly used in the art, such as water or other solvents, solubilizing agents and emulsifiers, such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3-butylene glycol, oils (in particular, cottonseed, groundnut, corn, germ, olive, castor, and sesame oils), glycerol, tetrahydrofuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, and mixtures thereof.
  • inert diluents commonly used in the art, such as water or other solvents, solubilizing agents and emulsifiers, such as eth
  • the oral compositions can also include adjuvants such as wetting agents, emulsifying and suspending agents, sweetening, flavoring, coloring, perfuming, and preservative agents.
  • adjuvants such as wetting agents, emulsifying and suspending agents, sweetening, flavoring, coloring, perfuming, and preservative agents.
  • Suspensions in addition to the active compounds, may contain suspending agents such as ethoxylated isostearyl alcohols, polyoxyethylene sorbitol, and sorbitan esters, microcrystalline cellulose, aluminum metahydroxide, bentonite, agar-agar and tragacanth, and mixtures thereof.
  • suspending agents such as ethoxylated isostearyl alcohols, polyoxyethylene sorbitol, and sorbitan esters, microcrystalline cellulose, aluminum metahydroxide, bentonite, agar-agar and tragacanth, and mixtures thereof.
  • Certain compositions disclosed herein
  • the topical formulations may further include one or more of the wide variety of agents known to be effective as skin or stratum corneum penetration enhancers.
  • agents known to be effective as skin or stratum corneum penetration enhancers include 2-pyrrolidone, N-methyl-2- pyrrolidone, dimethylacetamide, dimethylformamide, propylene glycol, methyl or isopropyl alcohol, dimethyl sulfoxide, and azone.
  • Additional agents may further be included to make the formulation cosmetically acceptable. Examples of these are fats, waxes, oils, dyes, fragrances, preservatives, stabilizers, and surface active agents. Keratolytic agents such as those known in the art may also be included. Examples are salicylic acid and sulfur.
  • Dosage forms for the topical or transdermal administration include powders, sprays, ointments, pastes, creams, lotions, gels, solutions, patches, and inhalants.
  • the active compound may be mixed under sterile conditions with a pharmaceutically acceptable carrier, and with any preservatives, buffers, or propellants that may be required.
  • the ointments, pastes, creams and gels may contain, in addition to a subject compound of the invention (e.g., a follistatin polypeptide), excipients, such as animal and vegetable fats, oils, waxes, paraffins, starch, tragacanth, cellulose derivatives, polyethylene glycols, silicones, bentonites, silicic acid, talc and zinc oxide, or mixtures thereof.
  • excipients such as animal and vegetable fats, oils, waxes, paraffins, starch, tragacanth, cellulose derivatives, polyethylene glycols, silicones, bentonites, silicic acid, talc and zinc oxide, or mixtures thereof.
  • Powders and sprays can contain, in addition to a subject compound, excipients such as lactose, talc, silicic acid, aluminum hydroxide, calcium silicates, and polyamide powder, or mixtures of these substances.
  • Sprays can additionally contain customary propellants, such as chlorofluorohydrocarbons and volatile unsubstituted hydrocarbons, such as butane and propane.
  • compositions suitable for parenteral administration may comprise one or more follistatin polypeptides in combination with one or more pharmaceutically acceptable sterile isotonic aqueous or nonaqueous solutions, dispersions, suspensions or emulsions, or sterile powders which may be reconstituted into sterile injectable solutions or dispersions just prior to use, which may contain antioxidants, buffers, bacteriostats, solutes which render the formulation isotonic with the blood of the intended recipient or suspending or thickening agents.
  • aqueous and nonaqueous carriers examples include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate.
  • polyols such as glycerol, propylene glycol, polyethylene glycol, and the like
  • vegetable oils such as olive oil
  • injectable organic esters such as ethyl oleate.
  • Proper fluidity can be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
  • compositions of the invention may also contain adjuvants, such as preservatives, wetting agents, emulsifying agents and dispersing agents.
  • microorganisms Prevention of the action of microorganisms may be ensured by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like. It may also be desirable to include isotonic agents, such as sugars, sodium chloride, and the like into the compositions. In addition, prolonged absorption of the injectable pharmaceutical form may be brought about by the inclusion of agents that delay absorption, such as aluminum monostearate and gelatin. [0112] It is understood that the dosage regimen will be determined by the attending physician, considering various factors that modify the action of the subject compounds of the invention (e.g., follistatin polypeptides). The various factors will depend upon the disease to be treated.
  • various antibacterial and antifungal agents for example, paraben, chlorobutanol, phenol sorbic acid, and the like. It may also be desirable to include isotonic agents, such as sugars, sodium chloride, and the like into the compositions. In addition, prolonged
  • the present invention also provides gene therapy for the in vivo production of follistatin polypeptides or other compounds disclosed herein. Such therapy would achieve its therapeutic effect by introduction of the follistatin polynucleotide sequences into cells or tissues having the disorders as listed above. Delivery of follistatin polynucleotide sequences can be achieved using a recombinant expression vector such as a chimeric virus or a colloidal dispersion system. Preferred for therapeutic delivery of follistatin polynucleotide sequences is the use of targeted liposomes.
  • RNA virus such as a retrovirus
  • retroviral vector is a derivative of a murine or avian retrovirus.
  • retroviral vectors in which a single foreign gene can be inserted include, but are not limited to: Moloney murine leukemia virus (MoMuLV), Harvey murine sarcoma virus (HaMuSV), murine mammary tumor virus (MuMTV), and Rous Sarcoma Virus (RSV).
  • MoMuLV Moloney murine leukemia virus
  • HaMuSV Harvey murine sarcoma virus
  • MuMTV murine mammary tumor virus
  • RSV Rous Sarcoma Virus
  • a number of additional retroviral vectors can incorporate multiple genes. All of these vectors can transfer or incorporate a gene for a selectable marker so that transduced cells can be identified and generated.
  • Retroviral vectors can be made target- specific by attaching, for example, a sugar, a glycolipid, or a protein. Preferred targeting is accomplished by using an antibody. Those of skill in the art will recognize that specific polynucleotide sequences can be inserted into the retroviral genome or attached to a viral envelope to allow target specific delivery of the retroviral vector containing the follistatin polynucleotide. In one preferred embodiment, the vector is targeted to bone, cartilage, muscle or neuron cells/tissues.
  • tissue culture cells can be directly transfected with plasmids encoding the retroviral structural genes gag, pol and env, by conventional calcium phosphate transfection. These cells are then transfected with the vector plasmid containing the genes of interest. The resulting cells release the retroviral vector into the culture medium.
  • colloidal dispersion systems include macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil- in- water emulsions, micelles, mixed micelles, and liposomes.
  • the preferred colloidal system of this invention is a liposome.
  • Liposomes are artificial membrane vesicles which are useful as delivery vehicles in vitro and in vivo. RNA, DNA and intact virions can be encapsulated within the aqueous interior and be delivered to cells in a biologically active form (see e.g., Fraley, et al, Trends Biochem. Sci., 6:77, 1981).
  • compositions of the liposome is usually a combination of phospholipids, usually in combination with steroids, especially cholesterol. Other phospholipids or other lipids may also be used.
  • the physical characteristics of liposomes depend on pH, ionic strength, and the presence of divalent cations.
  • lipids useful in liposome production include phosphatidyl compounds, such as phosphatidylglycerol, phosphatidylcholine, phosphatidylserine,
  • phosphatidylethanolamine sphingolipids
  • cerebrosides sphingolipids
  • gangliosides phosphatidylethanolamine
  • Illustrative phospholipids include egg phosphatidylcholine, dipalmitoylphosphatidylcholine, and distearoylphosphatidylcholine.
  • the targeting of liposomes is also possible based on, for example, organ-specificity, cell-specificity, and organelle-specificity and is known in the art.
  • Follistatin is known to have complex pharmacokinetic behavior.
  • the short form FST(288) is reported to be more effective at blocking ligands and binds to cell surfaces in part due to its unmasked heparin binding domain.
  • FST(315) is thought to be less effective but less attracted to cell surfaces due to the acid rich C-terminal amino acid sequence, which neutralizes the heparin binding domain.
  • follistatin is generally reported as having systemic effects. Applicants sought to determine whether a follistatin construct could be designed that would tend to have effects in the tissue of administration (such as an injected muscle), and whether dimerization of follistatin would provide enhanced tissue retention.
  • the Fc domains of immunoglobulins are known to form dimers.
  • Applicants generated fusion proteins containing FST(288) or FST(315) fused to an Fc portion of an IgGl .
  • a TGGG linker sequence was selected to join each follistatin polypeptide to the Fc portion.
  • Follistatin leader MVRARHQPGGLCLLLLLLCQFMEDRSAQA (SEQ ID NO: 23)
  • the selected FST-Fc proteins incorporate the follistatin leader.
  • the FST(288)-IgGl fusion has the unprocessed and mature amino acid sequences shown below.
  • the initial "GN” sequence may be removed, yielding the following polypeptide. (SEQ ID NO: 28)
  • the FST(315)-IgGl fusion has the unprocessed and mature amino acid sequences shown below.
  • the initial "GN” sequence may be removed, yielding the following polypeptide. (SEQ ID NO: 31)
  • Proteins were expressed in HEK-293 cells or CHO cells and purified from conditioned media by filtration and protein A chromatography. In some instances anion exchange and hydrophobic interaction chromatography and/or gel filtration was also used.
  • Protein activity was assessed by binding to activin A or GDF11. In each case, the proteins bind with a K D of less than 10 pM.
  • follistatin-Fc proteins were determined the ability of follistatin-Fc proteins to increase muscle mass and strength in wild-type mice after systemic administration.
  • An ActRIIB-Fc fusion protein that is well-known to stimulate substantial whole-body increases in lean muscle mass was used as a positive control.
  • C57BL/6 mice were dosed (10 mg/kg; subcutaneously (s.c.)) twice/week for four weeks with the FST(288)-IgGl protein, the human FST(315)- IgGl protein, or the human ActRIIB-Fc protein.
  • Mice were subjected to whole-body nuclear magnetic resonance (NMR) scanning to determine the percent change of whole body lean tissue mass. ActRIIB-Fc treated mice exhibited a significant (approximately 35%) increase in lean tissue when compared to the vehicle-control group.
  • Mice treated with either the FST(288)-IgGl or FST(315)-IgGl protein exhibited little increase in lean tissue mass compared to the control cohort. See Figure 2.
  • mice were also examined for changes in muscle strength.
  • the force a mouse exerts when pulling a force transducer is measured to determine forelimb grip strength.
  • mice treated with the ActRIIB-Fc protein exhibited increased muscle strength.
  • grip strength there was no increase in grip strength observed in either the FST(288)-IgGl or FST(315)- IgGl treatment groups. See Figure 3.
  • Example 3 The Effect of Systemic Administration of Follistatin-Fc Proteins on FSH levels.
  • Follistatin is primarily characterized for its ability to bind and inhibit members of the TGF-beta superfamily of signaling proteins.
  • follistatin is known to be a potent inhibitor of activin activity.
  • Activin is a potent inducer of follicle-stimulating hormone (FSH) production.
  • FSH follicle-stimulating hormone
  • FST(288)-IgGl resulted in circulating levels of the drug at 3.836 ( ⁇ 5.22) ⁇ g/mL. Similar treatment with FST(315)-IgGl resulted in substantially higher serum levels of the drug at 19.31 ( ⁇ 1.85) ⁇ g/mL. As indicated in Figure 5, FST(288)-IgGl did not have any significant effects on serum levels of FSH, suggesting that this FST(288)- IgGl treatment regime does not significantly affect systemic activin activity. In contrast, FST(315)-IgGl treatment resulted in a decrease in circulating levels of FSH, indicating that systemic administration of FST(315)-IgGl has an effect on systemic activin signaling.
  • mice were dosed (50 micrograms; i.m. into the right gastrocnemius muscle) twice/week for four weeks with the FST(288)-Fc protein, the FST(315)-Fc protein, or the human ActRIIB-Fc protein.
  • mice were subjected to whole-body nuclear magnetic resonance (NMR) scanning to determine the percent change of whole body lean tissue mass. ActRIIB-Fc treated mice exhibited a significant increase in lean tissue when compared to the vehicle-control group.
  • neither mice treated with the FST(288)-Fc nor FST(315)-Fc protein exhibited a significant increase in lean tissue mass compared to the control cohort.
  • both the right, injected gastrocnemius muscle and the left, contralateral gastrocnemius muscle were dissected and weighed.
  • ActRIIB-Fc treatment significantly increased muscle mass in both the right and left gastrocnemius muscles in comparison to vehicle-treated mice. Therefore, ActRIIB-Fc has systemic effects on increasing muscle mass even when restricted to local administration in a single muscle.
  • both FST(288)-Fc and FST(315)-Fc resulted in significant increases in muscle mass of the right gastrocnemius muscle but had no effect on the mass of the contralateral muscle.
  • follistatin protein is a potent stimulator of muscle mass when directly administered into a muscle. Furthermore, follistatin appears to have a distinct advantage over other agents like ActRIIB-Fc in that its effects on muscle mass are localized to the site of administration, indicating that follistatin can be used for targeted therapy of a selected muscle, or muscle groups, without affecting the normal growth/activity of surrounding, non-targeted muscles.
  • Applicants also closely monitored the serum levels of follistatin-Fc fusion protein after i.m. administration.
  • Treatment with FST(288)-IgGl resulted in a circulating levels of the drug at 0.156 ( ⁇ 0.245) ⁇ g/mL.
  • Similar treatment with FST(315)-IgGl resulted in slightly higher serum levels of the drug at 3.58 ( ⁇ 1.73) ⁇ g/mL, but these levels were substantially lower than those observed after systemic administration of FST(315)-IgGl .
  • FST(288)-IgGl and FST(315)-IgGl circulate in patient serum at lower levels after i.m.
  • FST(315)-IgGl would be particularly well-suited for promoting targeted muscle growth in patients that are reproductively active or have a desire to minimize effects on the reproductive system.
  • follistatin-Fc fusion proteins such as FST(288)-IgGl and FST(315)-IgGl have poor systemic effects on muscle and other tissues, and particularly FST(288) forms of the protein are active at the site of injection.
  • FST(288) binds to cells by virtue of the heparin binding domain and this binding can be eliminated by exogenous heparin.
  • immunoglobulin domains known to mediate CDC and ADCC effects on targeted cells may cause damage to cells treated with the heparin-binding follistatin constructs. Such damage could manifest as an immune reaction in the targeted tissue or in decreased growth of the targeted tissue.
  • the FST(288)-IgG2 fusion has the unprocessed and mature amino acid sequences shown below.
  • the initial "GN” sequence may be removed, yielding the following polypeptide. (SEQ ID NO: 34)
  • the FST(315)-IgG2 fusion has the unprocessed and mature amino acid sequences shown below.
  • the initial "GN” sequence may be removed, yielding the following polypeptide. (SEQ ID NO: 37)
  • Proteins were expressed in HEK-293 cells or CHO cells and purified from conditioned media by filtration and protein A chromatography. In some instances anion exchange and hydrophobic interaction chromatography and/or gel filtration was also used.
  • Protein activity was assessed by binding to activin A or GDF11. In each case, the proteins bind with a K D of less than 10 pM. These data indicate that Follistatin-IgG2 fusion proteins can be generated and expressed and retain picomolar ligand binding activity.
  • FST(288) a variety of truncations between the C-terminus of FST(288) and FST(315) were generated.
  • One of these truncations, ending at amino acid 291 and termed FST(291) showed superior expression properties compared to other forms and retained the desired heparin binding activity, despite containing a small portion of the masking domain of FST(315).
  • This form was fused to the Fc portion of human IgGl and IgG2 to generate FST(291)-IgGl and FST(291)-IgG2.
  • a TGGG linker sequence was selected to join each follistatin polypeptide to the Fc portion.
  • the FST(291)-IgGl fusion has the unprocessed and mature amino acid sequences shown below.
  • the initial "GN” sequence may be removed, yielding the following polypeptide. (SEQ ID NO: 40)
  • the FST(291)-IgG2 fusion has the unprocessed and mature amino acid sequences shown below.
  • the initial "GN” sequence may be removed, yielding the following polypeptide. (SEQ ID NO: 43)
  • Proteins were expressed in HEK-293 cells or CHO cells and purified from conditioned media by filtration and protein A chromatography. In some instances anion exchange and hydrophobic interaction chromatography and/or gel filtration was also used.
  • Protein activity was assessed by binding to activin A or GDF1 1. In each case, the proteins bind with a K D of less than 10 pM. [0156] Additional truncation experiments were conducted to identify
  • Follistatin-IgG2 constructs in the context of the TGGG linker, exhibiting an optimal ligand and heparin binding activity, so as to generate a polypeptide with high potency, a strong tendency towards retention in the treated tissue and low tendency to produce inflammatory or immune reaction in the treated tissue.
  • FST(278)-IgG2, FST(284)-IgG2, FST(291)-IgG2 and FST(303)-IgG2 and compared to each other and to FST(288)-IgG2 and FST- (315)-IgG2.
  • Heparin binding was assessed by measuring protein recovery from cells in the presence or absence of heparin, quantitated by ELIS A and expressed as a ratio of protein recovered in the presence of heparin to the protein recovered in the absence of heparin.
  • FST(278)-IgG2, FST(284)-IgG2, FST(288)- IgG2 and FST(291)-IgG2 all show similar ratios of 3.00-4.00, while FST(303)-IgG2 and FST(315)-IgG2 show ratios of 1.50 and 0.97, respectively. This indicates that as more amino acids are included between position 291 and 303, the heparin binding activity is sharply reduced.
  • C57BL/6 mice were dosed (100 micrograms in 50 microliters; i.m. into the left gastrocnemius muscle) twice/week for four weeks with vehicle (PBS), FST(291)-IgG2 or a control Fc from IgGl .
  • vehicle PBS
  • FST(291)-IgG2 a control Fc from IgGl
  • both the left, injected gastrocnemius muscle and the right, contralateral gastrocnemius muscle were dissected and weighed.
  • FST(291)-IgG2 treatment significantly increased muscle mass in the injected left gastrocnemius muscles, to a remarkable degree, in comparison to vehicle-treated mice, with no effect observed on the contralateral muscle.
  • FST(291)-IgG2 has restricted effect on the injected muscle group with little or no systemic effect.
  • Similar experiments have been conducted but injecting different muscle groups, including the triceps and the tibialis anterior. In each case, selective hypertrophy of the injected muscle was observed.
  • FST(291)-IgG2 caused approximately a 42% increase in the injected muscle versus the contralateral muscle
  • FST(288)-IgGl caused approximately a 22% increase in injected muscle versus the contralateral muscle.
  • FST(291)-IgG2 is an optimal compound for promoting targeted muscle growth in patients in need thereof.
  • Example 8 The Effect of Local Administration of FST(291)-IgG2 Protein on Muscle in a Mouse Model of Duchenne Muscular Dystrophy
  • mice Two separate studies were performed with mdx mice and the wild- type background strain, C57BL/10SnJ (WT).
  • treatment either FST(291)-IgG2 or vehicle control
  • mice reached 6 weeks of age In the first study, treatment was initiated when mice reached 6 weeks of age.
  • mice reached 4 weeks of age In both studies, mice received 100 ⁇ g FST(291)-IgG2 intramuscularly into the left gastrocnemius muscle, twice per week, in a fixed volume of 50 per injection. Four-week old mice were treated for 4 weeks, and 6-week old mice were treated for 6 weeks.
  • FST(291)-IgG2 increased muscle mass by 34.2% and 16.4% in 6-week old WT and mdx mice, respectively. Muscle mass increases of 62.8% and 41.8% were observed in 4-week old WT and mdx mice, respectively.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biochemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Public Health (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biophysics (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Zoology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Neurology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Physical Education & Sports Medicine (AREA)
  • General Chemical & Material Sciences (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Toxicology (AREA)
  • Immunology (AREA)
  • Epidemiology (AREA)
  • Endocrinology (AREA)
  • Marine Sciences & Fisheries (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)
  • Medicinal Preparation (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
PCT/US2015/034245 2014-06-04 2015-06-04 Methods and compositions for treatment of disorders with follistatin polypeptides Ceased WO2015187977A1 (en)

Priority Applications (14)

Application Number Priority Date Filing Date Title
KR1020217029755A KR20210119546A (ko) 2014-06-04 2015-06-04 폴리스타틴 폴리펩티드를 이용한 장애의 치료방법 및 치료를 위한 조성물
EA201692529A EA035455B1 (ru) 2014-06-04 2015-06-04 Способы и композиции для лечения расстройств с использованием фоллистатиновых полипептидов
AU2015269333A AU2015269333B2 (en) 2014-06-04 2015-06-04 Methods and compositions for treatment of disorders with follistatin polypeptides
BR112016028520A BR112016028520A2 (pt) 2014-06-04 2015-06-04 métodos e composições para o tratamento de transtornos com polipeptídeos de folistatina
CN201580041740.2A CN106795224B (zh) 2014-06-04 2015-06-04 用促滤泡素抑制素多肽治疗病症的方法和组合物
CA2950754A CA2950754C (en) 2014-06-04 2015-06-04 Methods and compositions for treatment of disorders with follistatin polypeptides
MX2016015868A MX382908B (es) 2014-06-04 2015-06-04 Polipéptidos de folistatina y sus usos.
KR1020207018965A KR102305109B1 (ko) 2014-06-04 2015-06-04 폴리스타틴 폴리펩티드를 이용한 장애의 치료방법 및 치료를 위한 조성물
KR1020177000297A KR102077286B1 (ko) 2014-06-04 2015-06-04 폴리스타틴 폴리펩티드를 이용한 장애의 치료방법 및 치료를 위한 조성물
KR1020207003791A KR102132144B1 (ko) 2014-06-04 2015-06-04 폴리스타틴 폴리펩티드를 이용한 장애의 치료방법 및 치료를 위한 조성물
EP20160287.7A EP3721892B1 (en) 2014-06-04 2015-06-04 Methods and compositions for treatment of disorders with follistatin polypeptides
JP2016570806A JP6568110B2 (ja) 2014-06-04 2015-06-04 フォリスタチンポリペプチドによる障害の処置のための方法および組成物
EP15802909.0A EP3152237B1 (en) 2014-06-04 2015-06-04 Methods and compositions for treatment of disorders with follistatin polypeptides
AU2020210315A AU2020210315A1 (en) 2014-06-04 2020-08-03 Methods and compositions for treatment of disorders with follistatin polypeptides

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201462007908P 2014-06-04 2014-06-04
US62/007,908 2014-06-04

Publications (1)

Publication Number Publication Date
WO2015187977A1 true WO2015187977A1 (en) 2015-12-10

Family

ID=54767384

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2015/034245 Ceased WO2015187977A1 (en) 2014-06-04 2015-06-04 Methods and compositions for treatment of disorders with follistatin polypeptides

Country Status (12)

Country Link
US (2) US10023621B2 (OSRAM)
EP (2) EP3152237B1 (OSRAM)
JP (3) JP6568110B2 (OSRAM)
KR (4) KR102132144B1 (OSRAM)
CN (2) CN113583104A (OSRAM)
AU (2) AU2015269333B2 (OSRAM)
BR (1) BR112016028520A2 (OSRAM)
CA (1) CA2950754C (OSRAM)
EA (2) EA202090632A1 (OSRAM)
MA (2) MA51074A (OSRAM)
MX (2) MX382908B (OSRAM)
WO (1) WO2015187977A1 (OSRAM)

Cited By (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2016154601A1 (en) * 2015-03-26 2016-09-29 Acceleron Pharma Inc. Follistatin-related fusion proteins and uses thereof
WO2017152090A3 (en) * 2016-03-04 2017-10-19 Shire Human Genetic Therapies, Inc. Recombinant follistatin-fc fusion proteins and use in treating duchenne muscular dystrophy
US9919030B2 (en) 2008-06-26 2018-03-20 Acceleron Pharma Inc. Follistatin fusion proteins and uses thereof
US9957309B2 (en) 2013-01-25 2018-05-01 Shire Human Genetic Therapies, Inc. Follistatin in treating duchenne muscular dystrophy
CN108218985A (zh) * 2017-12-12 2018-06-29 山西农业大学 一种利用特征多肽制备fst蛋白特异性抗体的方法及其应用
US10010498B2 (en) 2014-06-04 2018-07-03 Acceleron Pharma Inc. Methods for treatment of amyotrophic lateral sclerosis with follistatin fusion proteins
US10023621B2 (en) 2014-06-04 2018-07-17 Acceleron Pharma Inc. Follistatin-related fusion proteins
WO2019046903A1 (en) * 2017-09-08 2019-03-14 Baker Heart and Diabetes Institute THERAPEUTIC METHOD FOR INCREASING MUSCLE MASS IN A SUBJECT
WO2019191204A1 (en) * 2018-03-28 2019-10-03 Acceleron Pharma Inc. Follistatin polypeptides for the treatment of muscle contracture
WO2020046466A1 (en) * 2018-08-29 2020-03-05 Myos Rens Technology, Inc. Methods for alleviating, inhibiting or reversing muscle disuse atrophy in mammals
WO2023242251A1 (en) 2022-06-15 2023-12-21 UCB Biopharma SRL Follistatin-fc fusion proteins
WO2023242271A1 (en) 2022-06-15 2023-12-21 UCB Biopharma SRL Fusion protein for the prevention, treatment or amelioration of kidney diseases
WO2024121351A1 (en) * 2022-12-07 2024-06-13 Lodberg Andreas Extracellular matrix binding compounds for the localized loading of therapeutic or diagnostic agents
US12458693B2 (en) 2020-11-04 2025-11-04 Keros Therapeutics, Inc. Methods of treating iron overload with a BMP inhibitor
US12508262B2 (en) 2020-04-30 2025-12-30 Keros Therapeutics, Inc. Methods of using ALK2 inhibitors

Families Citing this family (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
ES2649983T3 (es) 2005-11-23 2018-01-16 Acceleron Pharma, Inc. Antagonistas de activina-ActRIIa en su uso para promover el crecimiento óseo
CN114699529A (zh) 2014-06-13 2022-07-05 阿塞勒隆制药公司 用于治疗溃疡的方法和组合物
US10905766B2 (en) 2017-03-23 2021-02-02 Oregon State University Therapeutic compositions and methods for treatment of muscle wasting diseases
KR101822633B1 (ko) * 2017-08-22 2018-01-26 (주)진셀팜 폴리스타틴 유래 생리활성 펩타이드, 및 이의 용도
EP3765601A1 (en) * 2018-03-16 2021-01-20 Immusoft Corporation B cells genetically engineered to secrete follistatin and methods of using the same to treat follistatin-related diseases, conditions, disorders and to enhance muscle growth and strength
CN111902157B (zh) * 2018-03-21 2023-08-04 松阳生技股份有限公司 促进局部肌肉增长、减缓或防止局部肌肉萎缩的组合物及其用途
US20210207135A1 (en) * 2018-05-17 2021-07-08 Housey Pharmaceutical Research Laboratories, L.L.C. Inhibition of follistatin
US20240101621A1 (en) * 2021-01-26 2024-03-28 Immunis, Inc. Molecular superstructure and methods of use thereof
WO2025157262A1 (en) * 2024-01-25 2025-07-31 Sichuan Real & Best Biotech Co., Ltd. Nucleic acids encoding follistatin and uses thereof

Citations (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1987005330A1 (en) 1986-03-07 1987-09-11 Michel Louis Eugene Bergh Method for enhancing glycoprotein stability
US5541087A (en) 1994-09-14 1996-07-30 Fuji Immunopharmaceuticals Corporation Expression and export technology of proteins as immunofusins
WO2000043781A2 (en) 1999-01-21 2000-07-27 Metamorphix, Inc. Growth differentiation factor inhibitors and uses therefor
WO2005033134A2 (en) * 2003-09-30 2005-04-14 Regeneron Pharmaceuticals, Inc. Secreted protein therapeutics and uses thereof
WO2006012627A2 (en) 2004-07-23 2006-02-02 Acceleron Pharma Inc. Actrii receptor polypeptides, methods and compositions
WO2007067616A2 (en) * 2005-12-06 2007-06-14 Amgen Inc Uses of myostatin antagonists
WO2009158035A2 (en) * 2008-06-26 2009-12-30 Acceleron Pharma Inc. Methods for dosing an activin-actriia antagonist and monitoring of treated patients
WO2013151665A2 (en) * 2012-04-02 2013-10-10 modeRNA Therapeutics Modified polynucleotides for the production of proteins associated with human disease
WO2014116981A1 (en) 2013-01-25 2014-07-31 Shire Human Genetic Therapies, Inc. Follistatin in treating duchenne muscular dystrophy
WO2014187807A1 (en) 2013-05-21 2014-11-27 Arcarios B.V. Follistatin derivatives

Family Cites Families (43)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5041538A (en) 1987-08-28 1991-08-20 The Salk Institute For Biological Studies Mammalian follistatin
US5182375A (en) 1987-08-28 1993-01-26 The Salk Institute For Biological Studies DNA encoding follistatin
JP3670276B2 (ja) * 1991-02-08 2005-07-13 プロゲニクス・ファーマスーティカルズ、インコーポレイテッド CD4― ガンマ・2キメラ及びCD4 ― IgG2・キメラ
CA2144081C (en) 1992-09-16 2004-11-30 Filip Roos Protection against liver damage by hgf
JPH09503673A (ja) 1993-10-14 1997-04-15 プレジデント・アンド・フエローズ・オブ・ハーバード・カレツジ ニューロン細胞の誘導および維持法
US6686198B1 (en) 1993-10-14 2004-02-03 President And Fellows Of Harvard College Method of inducing and maintaining neuronal cells
US5545616A (en) 1994-09-22 1996-08-13 Genentech, Inc. Method for predicting and/or preventing preterm labor
GB2306481A (en) 1995-10-21 1997-05-07 Univ Manchester Pharmaceutical comprising a stimulator of activin and/or inhibin
US6656475B1 (en) 1997-08-01 2003-12-02 The Johns Hopkins University School Of Medicine Growth differentiation factor receptors, agonists and antagonists thereof, and methods of using same
AU8666398A (en) 1997-08-01 1999-02-22 Johns Hopkins University School Of Medicine, The Methods to identify growth differentiation factor (gdf) receptors
US6891082B2 (en) 1997-08-01 2005-05-10 The Johns Hopkins University School Of Medicine Transgenic non-human animals expressing a truncated activintype II receptor
US6004937A (en) 1998-03-09 1999-12-21 Genetics Institute, Inc. Use of follistatin to modulate growth and differentiation factor 8 [GDF-8] and bone morphogenic protein 11 [BMP-11]
AU777783B2 (en) 1999-04-19 2004-10-28 Kyowa Hakko Kogyo Co. Ltd. Proliferation inhibitor for androgen-independent tumor
WO2001009368A1 (en) 1999-07-30 2001-02-08 The General Hospital Corporation Follistatin antagonists
JP4487376B2 (ja) 2000-03-31 2010-06-23 味の素株式会社 腎疾患治療剤
AUPR638101A0 (en) 2001-07-13 2001-08-09 Bioa Pty Limited Composition and method for treatment of disease
CN1993048A (zh) * 2002-02-21 2007-07-04 惠氏公司 包含促滤泡素抑制素结构域的蛋白质
EP1572909A4 (en) 2002-02-21 2007-06-06 Wyeth Corp PROTEIN CONTAINING A DOMAINE OF FOLLISTATIN
BR0307871A (pt) 2002-02-21 2005-04-12 Wyeth Corp Proteìnas contendo domìnio de folistatina
EP1646400B1 (en) 2003-03-21 2010-07-21 Celldex Therapeutics Limited Treatment of allergic diseases using a modulator of the notch signaling pathway
RU2322261C2 (ru) 2003-06-02 2008-04-20 Уайт Применение ингибиторов миостатика (gdf8) в сочетании с кортикостероидами для лечения нервно-мышечных заболеваний
WO2005025601A1 (en) 2003-09-15 2005-03-24 Monash University Follistatin isoforms and uses thereof
WO2005032578A1 (en) 2003-10-06 2005-04-14 Monash University Therapeutic method
JP4688483B2 (ja) 2004-04-15 2011-05-25 株式会社テクノネットワーク四国 フォリスタチン変異体ポリペプチド
AU2005272646A1 (en) 2004-08-12 2006-02-23 Wyeth Combination therapy for diabetes, obesity, and cardiovascular diseases using GDF-8 inhibitors
NZ538097A (en) 2005-02-07 2006-07-28 Ovita Ltd Method and compositions for improving wound healing
PL2407486T3 (pl) 2005-08-19 2018-05-30 Wyeth Llc Przeciwciała antagonistyczne względem GDF-8 i zastosowania w leczeniu ALS i innych zaburzeń związanych z GDF-8
WO2008030367A2 (en) 2006-09-01 2008-03-13 The General Hospital Corporation Selective myostatin inhibitors
EP2097095B1 (en) 2006-11-29 2016-01-27 Nationwide Children's Hospital Myostatin inhibition for enhancing muscle and/or improving muscle function
US8895016B2 (en) 2006-12-18 2014-11-25 Acceleron Pharma, Inc. Antagonists of activin-actriia and uses for increasing red blood cell levels
CN104524548A (zh) 2006-12-18 2015-04-22 阿塞勒隆制药公司 活化素-actrii拮抗剂及在提高红细胞水平中的用途
US20100028332A1 (en) 2006-12-18 2010-02-04 Acceleron Pharma Inc. Antagonists of actriib and uses for increasing red blood cell levels
JP6157046B2 (ja) 2008-01-07 2017-07-05 アムジェン インコーポレイテッド 静電的ステアリング(electrostaticsteering)効果を用いた抗体Fcヘテロ二量体分子を作製するための方法
DK2318028T3 (da) * 2008-06-26 2020-05-04 Acceleron Pharma Inc Antagonister af opløselig activin-aktriia og anvendelser til øgning af røde blodcelleniveauer
EP3202459B1 (en) * 2009-09-09 2021-04-14 Acceleron Pharma Inc. Actriib antagonists and dosing and uses thereof for treating obesity or type 2 diabetes by regulating body fat content
KR101603001B1 (ko) 2010-08-25 2016-03-11 에프. 호프만-라 로슈 아게 Il-18r1에 대한 항체 및 그의 용도
ES2758994T3 (es) 2010-11-05 2020-05-07 Zymeworks Inc Diseño anticuerpo heterodimérico estable con mutaciones en el dominio Fc
EP2844271B1 (en) 2012-05-17 2018-02-28 Paranta Biosciences Limited Use of follistatin or of an activin inhibitor for preventing or treating tissue graft dysfunction
US9943574B2 (en) * 2012-06-27 2018-04-17 Arthrogen B.V. Combination for treating an inflammatory disorder
EA202090632A1 (ru) 2014-06-04 2020-07-31 Акселерон Фарма Инк. Способы и композиции для лечения расстройств с использованием фоллистатиновых полипептидов
US10010498B2 (en) 2014-06-04 2018-07-03 Acceleron Pharma Inc. Methods for treatment of amyotrophic lateral sclerosis with follistatin fusion proteins
EP3274457A4 (en) * 2015-03-26 2018-08-08 Acceleron Pharma Inc. Follistatin-related fusion proteins and uses thereof
CN110914294A (zh) 2017-05-12 2020-03-24 夏尔人类遗传性治疗公司 重组卵泡抑素-fc融合蛋白及其在治疗杜氏肌营养不良中的用途

Patent Citations (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1987005330A1 (en) 1986-03-07 1987-09-11 Michel Louis Eugene Bergh Method for enhancing glycoprotein stability
US5541087A (en) 1994-09-14 1996-07-30 Fuji Immunopharmaceuticals Corporation Expression and export technology of proteins as immunofusins
US5726044A (en) 1994-09-14 1998-03-10 Fuji Immunopharmaceuticals Corp. Expression and export technology of proteins as immunofusins
WO2000043781A2 (en) 1999-01-21 2000-07-27 Metamorphix, Inc. Growth differentiation factor inhibitors and uses therefor
WO2005033134A2 (en) * 2003-09-30 2005-04-14 Regeneron Pharmaceuticals, Inc. Secreted protein therapeutics and uses thereof
WO2006012627A2 (en) 2004-07-23 2006-02-02 Acceleron Pharma Inc. Actrii receptor polypeptides, methods and compositions
WO2007067616A2 (en) * 2005-12-06 2007-06-14 Amgen Inc Uses of myostatin antagonists
WO2009158035A2 (en) * 2008-06-26 2009-12-30 Acceleron Pharma Inc. Methods for dosing an activin-actriia antagonist and monitoring of treated patients
WO2009158025A2 (en) * 2008-06-26 2009-12-30 Acceleron Pharma Inc. Methods for dosing an actriib antagonist and monitoring of treated patients
US20150158923A1 (en) 2008-06-26 2015-06-11 Acceleron Pharma, Inc. Follistatin Fusion Proteins and Uses Thereof
WO2013151665A2 (en) * 2012-04-02 2013-10-10 modeRNA Therapeutics Modified polynucleotides for the production of proteins associated with human disease
WO2014116981A1 (en) 2013-01-25 2014-07-31 Shire Human Genetic Therapies, Inc. Follistatin in treating duchenne muscular dystrophy
WO2014187807A1 (en) 2013-05-21 2014-11-27 Arcarios B.V. Follistatin derivatives

Non-Patent Citations (41)

* Cited by examiner, † Cited by third party
Title
"Current Protocols in Molecular Biology", 1992, W. H. FREEMAN AND COMPANY
"Molecular Cloning A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS
"NCBI", Database accession no. BC004107.2
AM J PHYSIOL ENDOCRINOL METAB., vol. 297, no. l, July 2009 (2009-07-01), pages E157 - 64
APLINWRISTON, CRC CRIT. REV. BIOCHEM., 1981, pages 259 - 306
ASHMORE ET AL., GROWTH, vol. 38, 1974, pages 501 - 507
BODANSKY, M.: "Principles of Peptide Synthesis", 1993, SPRINGER
BROWN ET AL., GROWTH FACTORS, vol. 3, 1990, pages 35 - 43
COLE ET AL., J. IMMUNOL., vol. 159, 1997, pages 3613
DATTA-MANNAN A. ET AL.: "An Engineered Human Follistatin Variant: Insights into the Pharmacokinetic and Pharmocodynamic Relationships of a Novel Molecule with Broad Therapeutic Potential", THE JOURNAL OF PHARMACOLOGY AND EXPERIMENTAL THERAPEUTICS, vol. 344, no. 3, 2013, pages 616 - 623, XP009171518, ISSN: 1521-0103 *
DATTA-MANNAN ET AL., J. PHARMACOL. EXP. THER., vol. 344, 2013, pages 616 - 623
DEPAOLO ET AL., PROC SOCEP BIOL MED., vol. 198, 1991, pages 500 - 512
DYSON ET AL., CURR BIOL., vol. 7, 1997, pages 81 - 84
EDGE ET AL., ANAL. BIOCHEM., vol. 118, 1981, pages 131
FRALEY ET AL., TRENDS BIOCHEM. SCI., vol. 6, 1981, pages 77
GAMER ET AL., DEV. BIOL., vol. 208, 1999, pages 222 - 232
GOEDDEL: "Gene Expression Technology: Methods in Enzymology", 1990, ACADEMIC PRESS
GONZALEZ-CADAVID ET AL., PNAS, vol. 95, 1998, pages 14938 - 43
GROBET ET AL., NAT. GENET., vol. 17, no. l, 1997, pages 71 - 4
HAKIMUDDIN ET AL., ARCH. BIOCHEM. BIOPHYS., vol. 259, 1987, pages 52
HE ET AL., ANAT EMBRYOL (BERL, vol. 209, no. 5, June 2005 (2005-06-01), pages 401 - 7
HOCHULI ET AL., J. CHROMATOGRAPHY, vol. 411, 1987, pages 177
JANKNECHT ET AL., PNAS USA, vol. 88, pages 8972
KAMBADUR ET AL., GENOME RES., vol. 7, 1997, pages 910 - 915
LINKNISHI, EXP CELL RES., vol. 233, no. 2, 15 June 1997 (1997-06-15), pages 350 - 62
MANNINO ET AL., BIOTECHNIQUES, vol. 6, 1988, pages 682
MCPHERRON ET AL., NATURE, vol. 387, 1997, pages 83 - 90
MCPHERRONLEE, PROC. NATL. ACAD. SCI. USA, vol. 94, 1997, pages 12457 - 12461
MURATA ET AL., PNAS, vol. 85, 1988, pages 2434
NAKATANI ET AL., THE FASEB JOURNAL, vol. 22477-487, 2008
PNAS, U.S.A., vol. 85, no. 12, 1988, pages 4218 - 4222
SCHUELKE ET AL., N ENGL J MED, vol. 350, 2004, pages 2682 - 8
See also references of EP3152237A4
SOUZA ET AL., MOL ENDOCRINOL., vol. 22, no. 12, December 2008 (2008-12-01), pages 2689 - 702
SWATLANDKIEFFER, J. ANIM. SCI., vol. 38, 1994, pages 752 - 757
THOTAKURA ET AL., METH. ENZYMOL., vol. 138, 1987, pages 350
WAKEFIELD ET AL., J. BIOL. CHEM., vol. 263, 1988, pages 7646 - 7654
WOODRUFF, BIOCHEM PHARMACOL., vol. 55, 1998, pages 953 - 963
YADEN B. C. ET AL.: "Follistatin: A Novel Therapeutic for the Improvement of Muscle Regeneration", THE JOURNAL OF PHARMACOLOGY AND EXPERIMENTAL THERAPEUTICS, vol. 349, no. 2, 2014, pages 355 - 371, XP055240847 *
YADEN ET AL., J. PHARMACOL. EXP. THER., vol. 349, no. 2, 2014, pages 355 - 71
ZHOU ET AL., CELL, vol. 142, no. 4, 20 August 2010 (2010-08-20), pages 531 - 43

Cited By (25)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9919030B2 (en) 2008-06-26 2018-03-20 Acceleron Pharma Inc. Follistatin fusion proteins and uses thereof
US9957309B2 (en) 2013-01-25 2018-05-01 Shire Human Genetic Therapies, Inc. Follistatin in treating duchenne muscular dystrophy
US10723772B2 (en) 2013-01-25 2020-07-28 Shire Human Genetic Therapies, Inc. Follistatin in treating duchenne muscular dystrophy
US11497792B2 (en) 2014-06-04 2022-11-15 Acceleron Pharma Inc. Methods for treatment of Duchenne muscular dystrophy with follistatin polypeptides
US10765626B2 (en) 2014-06-04 2020-09-08 Acceleron Pharma Inc. Methods for treatment of charcot-marie-tooth disease with follistatin polypeptides
US10010498B2 (en) 2014-06-04 2018-07-03 Acceleron Pharma Inc. Methods for treatment of amyotrophic lateral sclerosis with follistatin fusion proteins
US10023621B2 (en) 2014-06-04 2018-07-17 Acceleron Pharma Inc. Follistatin-related fusion proteins
US10954279B2 (en) 2014-06-04 2021-03-23 Acceleron Pharma Inc. Methods and compositions for treatment of disorders with follistatin polypeptides
WO2016154601A1 (en) * 2015-03-26 2016-09-29 Acceleron Pharma Inc. Follistatin-related fusion proteins and uses thereof
US9975934B2 (en) 2015-03-26 2018-05-22 Acceleron Pharma Inc. Follistatin-related fusion proteins
US11001614B2 (en) 2015-03-26 2021-05-11 Acceleron Pharma Inc. Method for treating a muscle-related disorder with follistatin-related fusion proteins
CN109153708A (zh) * 2016-03-04 2019-01-04 夏尔人类遗传性治疗公司 重组卵泡抑素-fc融合蛋白及其在治疗杜氏肌营养不良症中的应用
JP2019509735A (ja) * 2016-03-04 2019-04-11 シャイアー ヒューマン ジェネティック セラピーズ インコーポレイテッド デュシェンヌ型筋ジストロフィー治療における組換えフォリスタチン−Fc融合タンパク質及び使用
WO2017152090A3 (en) * 2016-03-04 2017-10-19 Shire Human Genetic Therapies, Inc. Recombinant follistatin-fc fusion proteins and use in treating duchenne muscular dystrophy
WO2019046903A1 (en) * 2017-09-08 2019-03-14 Baker Heart and Diabetes Institute THERAPEUTIC METHOD FOR INCREASING MUSCLE MASS IN A SUBJECT
CN108218985B (zh) * 2017-12-12 2021-04-30 山西农业大学 一种利用特征多肽制备fst蛋白特异性抗体的方法及其应用
CN108218985A (zh) * 2017-12-12 2018-06-29 山西农业大学 一种利用特征多肽制备fst蛋白特异性抗体的方法及其应用
WO2019191204A1 (en) * 2018-03-28 2019-10-03 Acceleron Pharma Inc. Follistatin polypeptides for the treatment of muscle contracture
WO2020046466A1 (en) * 2018-08-29 2020-03-05 Myos Rens Technology, Inc. Methods for alleviating, inhibiting or reversing muscle disuse atrophy in mammals
US12246042B2 (en) 2018-08-29 2025-03-11 Myos Corp. Methods for alleviating, inhibiting or reversing muscle disuse atrophy in mammals
US12508262B2 (en) 2020-04-30 2025-12-30 Keros Therapeutics, Inc. Methods of using ALK2 inhibitors
US12458693B2 (en) 2020-11-04 2025-11-04 Keros Therapeutics, Inc. Methods of treating iron overload with a BMP inhibitor
WO2023242251A1 (en) 2022-06-15 2023-12-21 UCB Biopharma SRL Follistatin-fc fusion proteins
WO2023242271A1 (en) 2022-06-15 2023-12-21 UCB Biopharma SRL Fusion protein for the prevention, treatment or amelioration of kidney diseases
WO2024121351A1 (en) * 2022-12-07 2024-06-13 Lodberg Andreas Extracellular matrix binding compounds for the localized loading of therapeutic or diagnostic agents

Also Published As

Publication number Publication date
KR20210119546A (ko) 2021-10-05
CN113583104A (zh) 2021-11-02
JP2019203017A (ja) 2019-11-28
KR20170005891A (ko) 2017-01-16
KR102305109B1 (ko) 2021-09-27
KR102077286B1 (ko) 2020-02-13
MX382908B (es) 2025-03-13
CA2950754C (en) 2021-10-26
CA2950754A1 (en) 2015-12-10
US10954279B2 (en) 2021-03-23
CN106795224B (zh) 2021-05-18
JP6568110B2 (ja) 2019-08-28
KR20200084064A (ko) 2020-07-09
JP2021095416A (ja) 2021-06-24
AU2015269333A1 (en) 2016-12-15
MA51074A (fr) 2020-10-14
MX2021006017A (es) 2021-07-06
JP6856716B2 (ja) 2021-04-07
CN106795224A (zh) 2017-05-31
MX2016015868A (es) 2017-04-05
EP3152237B1 (en) 2020-04-01
AU2020210315A1 (en) 2020-08-27
EP3721892B1 (en) 2024-05-22
EA035455B1 (ru) 2020-06-18
MA51075A (fr) 2020-10-14
EP3721892A1 (en) 2020-10-14
EA201692529A1 (ru) 2017-05-31
EP3152237A1 (en) 2017-04-12
EA202090632A1 (ru) 2020-07-31
JP2017518303A (ja) 2017-07-06
BR112016028520A2 (pt) 2017-10-24
KR102132144B1 (ko) 2020-07-09
US10023621B2 (en) 2018-07-17
KR20200017548A (ko) 2020-02-18
US20180340013A1 (en) 2018-11-29
US20160185836A1 (en) 2016-06-30
EP3152237A4 (en) 2017-11-01
AU2015269333B2 (en) 2020-05-07

Similar Documents

Publication Publication Date Title
US10954279B2 (en) Methods and compositions for treatment of disorders with follistatin polypeptides
US11497792B2 (en) Methods for treatment of Duchenne muscular dystrophy with follistatin polypeptides
US20220169996A1 (en) Truncated actriib-fc fusion proteins
EP3293198B1 (en) Variants derived from actriib and uses therefor
HK1236544A1 (en) Methods and compositions for treatment of disorders with follistatin polypeptides
HK1236544B (en) Methods and compositions for treatment of disorders with follistatin polypeptides
HK1238658A1 (en) Methods and compositions for treatment of disorders with follistatin polypeptides
HK1238658B (zh) 用促滤泡素抑制素多肽治疗病症的方法和组合物

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 15802909

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2950754

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2016570806

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: MX/A/2016/015868

Country of ref document: MX

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 122020017248

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2015269333

Country of ref document: AU

Date of ref document: 20150604

Kind code of ref document: A

REEP Request for entry into the european phase

Ref document number: 2015802909

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2015802909

Country of ref document: EP

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112016028520

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: 201692529

Country of ref document: EA

ENP Entry into the national phase

Ref document number: 20177000297

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 112016028520

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20161205