WO2015164121A1 - Recombinant listeria vaccine strains and methods of producing the same - Google Patents
Recombinant listeria vaccine strains and methods of producing the same Download PDFInfo
- Publication number
- WO2015164121A1 WO2015164121A1 PCT/US2015/025690 US2015025690W WO2015164121A1 WO 2015164121 A1 WO2015164121 A1 WO 2015164121A1 US 2015025690 W US2015025690 W US 2015025690W WO 2015164121 A1 WO2015164121 A1 WO 2015164121A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- another embodiment
- recombinant
- protein
- gene
- recombinant listeria
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/74—Vectors or expression systems specially adapted for prokaryotic hosts other than E. coli, e.g. Lactobacillus, Micromonospora
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P15/00—Drugs for genital or sexual disorders; Contraceptives
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N1/00—Microorganisms; Compositions thereof; Processes of propagating, maintaining or preserving microorganisms or compositions thereof; Processes of preparing or isolating a composition containing a microorganism; Culture media therefor
- C12N1/36—Adaptation or attenuation of cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N7/00—Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/52—Bacterial cells; Fungal cells; Protozoal cells
- A61K2039/522—Bacterial cells; Fungal cells; Protozoal cells avirulent or attenuated
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/52—Bacterial cells; Fungal cells; Protozoal cells
- A61K2039/523—Bacterial cells; Fungal cells; Protozoal cells expressing foreign proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/57—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
- A61K2039/572—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 cytotoxic response
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/58—Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation
- A61K2039/585—Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation wherein the target is cancer
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/55—Fusion polypeptide containing a fusion with a toxin, e.g. diphteria toxin
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/20011—Papillomaviridae
- C12N2710/20034—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/20011—Papillomaviridae
- C12N2710/20051—Methods of production or purification of viral material
Definitions
- the present invention provides methods of treating, protecting against, and inducing an immune response against a tumor or cancer, comprising the step of administering to a subject a recombinant Listeria strain comprising a nucleic acid encoding a mutant PrfA protein that partially restores PrfA function.
- HR-HPV human papillomavirus
- ICC cervix
- Listeria monocytogenes ⁇ Lm is a food-borne gram-positive bacterium that can occasionally cause disease in humans, in particular elderly individuals, newborns, pregnant women and immunocompromised individuals.
- Lm has the ability to replicate in the cytosol of APCs after escaping from the phagolysosome, mainly through the action of the listeriolysin O (LLO) protein.
- LLO listeriolysin O
- Lm has been extensively investigated as a vector for cancer immunotherapy in pre-clinical models. Immunization of mice with Lm-LLO-E7 induces regression of established tumors expressing E7 and confers long-term protection. The therapeutic efficacy of Lm-LLO-E7 correlates with its ability to induce E7-specific CTLs that infiltrate the tumor site, mature dendritic cells, reduce the number of intratumoral regulatory CD4 + CD25 + T cells and inhibit tumor angiogenesis.
- Lm has also a number of inherent advantages as a vaccine vector.
- the bacterium grows very efficiently in vitro without special requirements and it lacks LPS, which is a major toxicity factor in gram-negative bacteria, such as Salmonella.
- LPS a major toxicity factor in gram-negative bacteria, such as Salmonella.
- Genetically attenuated Lm vectors also offer additional safety as they can be readily eliminated with antibiotics, in case of serious adverse effects and unlike some viral vectors, no integration of genetic material into the host genome occurs.
- there is always great concern about the safety of a live bacterial vaccine such as Lm especially regarding its mechanism of attenuation.
- the PrfA protein controls the expression of a regulon comprising essential virulence genes required by Lm to colonize its vertebrate hosts; hence the prfA mutation strongly impairs PrfA ability to activate expression of PrfA-dependent virulence genes.
- the present invention addresses this concern by providing a prfA mutant Listeria that carries a mutant prfA (D133V) gene in the pGG55 plasmid that restores partial PrfA function.
- the present invention relates to a recombinant Listeria strain, said recombinant Listeria strain comprising a recombinant nucleic acid, said nucleic acid comprising a first open reading frame encoding a recombinant polypeptide comprising a first an N-terminal fragment of an LLO protein fused to a heterologous antigen or fragment thereof, and wherein said recombinant nucleic acid further comprises a second open reading frame encoding a mutant PrfA protein.
- the present invention relates to a recombinant Listeria strain, said recombinant Listeria strain comprising a recombinant nucleic acid, said nucleic acid comprising a first open reading frame encoding a recombinant polypeptide comprising a first an N-terminal fragment of an LLO protein fused to a heterologous antigen or fragment thereof, wherein said recombinant nucleic acid further comprises a second open reading frame encoding a mutant PrfA protein, and wherein said Listeria comprises a genomic mutation or deletion in the prfA gene.
- mutant PrfA protein encoded by said second open reading frame complements said genomic mutation or deletion in said Listeria strain' s PrfA protein. In another embodiment, the mutant PrfA protein encoded by said second open reading frame restores partial PrfA function in said Listeria strain.
- the present invention relates to a method for inducing an immune response against a tumor or a cancer in a subject, the method comprising the step of administering to said subject a recombinant Listeria strain comprising a recombinant nucleic acid, said nucleic acid comprising a first open reading frame encoding a recombinant polypeptide comprising an N-terminal fragment of an LLO protein fused to a heterologous antigen or fragment thereof, is, wherein said recombinant nucleic acid further comprises a second open reading frame encoding a mutant PrfA protein, thereby inducing an immune response against a tumor or a cancer.
- the recombinant Listeria strain comprises a genomic mutation or deletion in the prfA gene.
- Lm-E7 and Lm-LLO-E7 use different expression systems to express and secrete E7.
- Lm-E7 was generated by introducing a gene cassette into the orfZ domain of the L. monocytogenes genome (A). The hly promoter drives expression of the hly signal sequence and the first five amino acids (AA) of LLO followed by HPV-16 E7.
- A Lm-LLO- E7 was generated by transforming the prfA- strain XFL-7 with the plasmid pGG-55.
- pGG-55 has the hly promoter driving expression of a nonhemolytic fusion of LLO-E7.
- pGG-55 also contains the prfA gene to select for retention of the plasmid by XFL-7 in vivo.
- Lm-E7 and Lm-LLO-E7 secrete E7.
- Lm-Gag (lane 1), Lm-E7 (lane 2), Lm- LLO-NP (lane 3), Lm-LLO-E7 (lane 4), XFL-7 (lane 5), and 10403S (lane 6) were grown overnight at 37°C in Luria-Bertoni broth. Equivalent numbers of bacteria, as determined by OD at 600 nm absorbance, were pelleted and 18 ml of each supernatant was TCA precipitated. E7 expression was analyzed by Western blot.
- FIG. 1 Tumor immunotherapeutic efficacy of LLO-E7 fusions. Tumor size in millimeters in mice is shown at 7, 14, 21, 28 and 56 days post tumor-inoculation. Naive mice: open-circles; Lm-LLO-E7: filled circles; Lm-E7: squares; Lm-Gag: open diamonds; and Lm- LLO-NP: filled triangles. [0014] Figure 4. Splenocytes from Lm-LLO-E7-immunized mice proliferate when exposed to TC-1 cells.
- Figure 7A Effect of passaging on bacterial load (virulence) of recombinant Listeria vaccine vectors. Top panel. Lm-Gag. Bottom panel. Lm-LLO-E7.
- Figure 7B Effect of passaging on bacterial load of recombinant Lm-E7 in the spleen. Average CFU of live bacteria per milliliter of spleen homogenate from four mice is depicted.
- Figure 8 shows induction of antigen- specific CD8 + T-cells for HIV-Gag and LLO after administration of passaged Lm-Gag versus unpassaged Lm-Gag.
- Mice were immunized with 10 3 (A, B, E, F) or 10 5 (C, D, G, H) CFU passaged Listeria vaccine vectors, and antigen- specific T-cells were analyzed.
- B, D, F, H unpassaged Listeria vaccine vectors.
- E-H immune response to an LLO peptide.
- I splenocytes from mice immunized with 10 5 CFU passaged Lm-Gag stimulated with a control peptide from HPV E7.
- Figure 9A shows plasmid isolation throughout LB stability study.
- Figure 9B shows plasmid isolation throughout TB stability study.
- Figure 9C shows quantitation of TB stability study.
- Figure 10 shows numbers of viable bacteria chloramphenicol (CAP)-resistant and CAP-sensitive colony-forming units (CFU) from bacteria grown in LB. Dark bars: CAP + ; white bars: CAP " . The two dark bars and two white bars for each time point represent duplicate samples.
- Figure 11 shows numbers of viable bacteria CAP-resistant and CAP-sensitive CFU from bacteria grown in TB. Dark bars: CAP + ; white bars: CAP. The two dark bars and two white bars for each time point represent duplicate samples.
- Figure 12 Actual chromatograms showing the region of the D133V mutation (arrows). The mixture ratio is shown in parentheses.
- Figure 13 Representation of the location of the ADV451, 452 and 453 primers and the segment of the prf A gene amplified in the reaction.
- Figure 14 Specificity of the PCR reaction using primers ADV451 and ADV453.
- Figure 15 Specificity of the PCR reaction using primers ADV452 and ADV453.
- Figure 16 Sensitivity of the PCR reaction to detect the wild-type prf A sequence using the primer ADV452 and 1 ng as the initial amount of DNA.
- Figure 17 Sensitivity of the PCR reaction to detect the wild-type prf A sequence using the primer ADV452 and 5 ng as the initial amount of DNA.
- Figure 18 Average density of the bands from the PCR depicted in figure 16.
- Figure 19 Average density of the bands from the PCR depicted in figure 17.
- Figure 20 Validation of the PCR reaction to detect the wild-type prfA sequence using the primer ADV452.
- Figure 21 Average density of the bands from the PCR depicted in figure 16.
- FIG. 22 Analysis of the D133V prfA mutation in the Lm-LLO-E7.
- A Original image used for densitometry;
- B Image was digitally enhanced to facilitate the visualization of the low density bands.
- the present invention provides, in one embodiment, a recombinant Listeria strain, said recombinant Listeria strain comprising a recombinant nucleic acid, said nucleic acid comprising a first open reading frame encoding a recombinant polypeptide comprising a first an N-terminal fragment of an LLO protein fused to a heterologous antigen or fragment thereof, wherein said recombinant nucleic acid further comprises a second open reading frame encoding a mutant PrfA protein, and wherein said Listeria comprises a genomic mutation or deletion in the prfA gene.
- the mutant PrfA protein encoded by said second open reading frame complements said genomic mutation or deletion in said Listeria strain's prfA gene. In another embodiment, the mutant PrfA protein encoded by said second open reading frame restores partial PrfA function in said Listeria strain. In one embodiment, the mutant PrfA protein encoded by said second open reading frame comprises a point mutation in position 133. In another embodiment, the mutation on residue 133 of the PrfA amino acid sequence is from amino acid D or Asp or Aspartate (or Aspartic acid) to amino acid V or Val or Valine.
- the present invention further provides immunogenic compositions comprising a recombinant Listeria strain provided herein and methods of using the same, including methods of treating, protecting against, and inducing an immune response against a disease, where in some embodiments, the disease is a tumor or cancer.
- the present invention also provides methods for inducing an anti-disease cytotoxic T- cell (CTL) response in a subject and treating disorders, and symptoms associated with said disease comprising administering a recombinant Listeria strain provided herein, wherein in some embodiments the disease is a tumor or a cancer.
- CTL cytotoxic T- cell
- a recombinant Listeria provided herein is an attenuated
- Attenuation and “attenuated” may encompass a bacterium, virus, parasite, infectious organism, prion, tumor cell, gene in the infectious organism, and the like, that is modified to reduce toxicity to a host.
- the host can be a human or animal host, or an organ, tissue, or cell.
- the bacterium to give a non-limiting example, can be attenuated to reduce binding to a host cell, to reduce spread from one host cell to another host cell, to reduce extracellular growth, or to reduce intracellular growth in a host cell.
- Attenuation can be assessed by measuring, e.g., an indicum or indicia of toxicity, the LD a , the rate of clearance from an organ, or the competitive index (see, e.g., Auerbuch, et al. (2001) Infect. Immunity 69:5953-5957).
- an attenuation results an increase in the LD so and/or an increase in the rate of clearance by at least 25%; more generally by at least 50%; most generally by at least 100% (2-fold); normally by at least 5-fold; more normally by at least 10-fold; most normally by at least 50-fold; often by at least 100-fold; more often by at least 500-fold; and most often by at least 1000-fold; usually by at least 5000-fold; more usually by at least 10,000-fold; and most usually by at least 50,000-fold; and most often by at least 100,000-fold.
- Attenuated gene may encompass a gene that mediates toxicity, pathology, or virulence, to a host, growth within the host, or survival within the host, where the gene is mutated in a way that mitigates, reduces, or eliminates the toxicity, pathology, or virulence. The reduction or elimination can be assessed by comparing the virulence or toxicity mediated by the mutated gene with that mediated by the non-mutated (or parent) gene.
- “Mutated gene” encompasses deletions, point mutations, and frameshift mutations in regulatory regions of the gene, coding regions of the gene, non- coding regions of the gene, or any combination thereof.
- a method for inducing an immune response against a tumor or a cancer in a subject comprising the step of administering to said subject a composition comprising a recombinant Listeria strain provided herein, thereby inducing an immune response against a tumor or a cancer.
- the present invention provides a method of treating a tumor or cancer in a subject, comprising the step of administering to the subject a composition comprising a recombinant Listeria strain provided herein.
- the present invention provides a method of protecting a subject against a tumor or cancer, comprising the step of administering to the subject the recombinant Listeria strain provided herein.
- the recombinant Listeria strain expresses the recombinant polypeptide.
- the recombinant Listeria strain comprises a plasmid that encodes the recombinant polypeptide.
- the recombinant Listeria strain comprises a genomic mutation or deletion in the prfA gene.
- the methods provided herein further comprise the step of boosting a subject with a composition comprising a recombinant Listeria strain of the present invention.
- the method further comprises the step of boosting the subject with an immunogenic composition comprising a heterologous antigen or fragment thereof provided herein.
- the method further comprises the step of boosting the subject with an immunogenic composition that directs a cell of the subject to express the heterologous antigen.
- the cell is a tumor cell.
- the cell is an antigen-presenting cell.
- the method further comprises the step of boosting the subject with a vaccine comprising a recombinant Listeria strain of the present invention.
- the fragment thereof in the context of LLO proteins and ActA proteins provided herein refer to a peptide or polypeptide comprising an amino acid sequence of at least 5 contiguous amino acid residues of the LLO or ActA proteins.
- the term refers to a peptide or polypeptide comprising an amino acid sequence of at least of at least 10 contiguous amino acid residues, at least 15 contiguous amino acid residues, at least 20 contiguous amino acid residues, at least 25 contiguous amino acid residues, at least 40 contiguous amino acid residues, at least 50 contiguous amino acid residues, at least 60 contiguous amino residues, at least 70 contiguous amino acid residues, at least 80 contiguous amino acid residues, at least 90 contiguous amino acid residues, at least 100 contiguous amino acid residues, at least 125 contiguous amino acid residues, at least 150 contiguous amino acid residues, at least 175 contiguous amino acid residues, at least 200 contiguous amino acid residues
- a "fragment” is a functional fragment that comprises a biological activity (e.g. to elicit an immune response against a heterologous antigen expressed by a tumor cell, either when administered alone or when administered in the context of a fusion protein as further described herein.
- the fragment is functional in a non-fused form.
- the present invention in certain embodiments, provides codon optimization of a nucleic acid heterologous to Listeria, or of a nucleic acid endogenous to Listeria.
- the optimal codons utilized by L. monocytogenes for each amino acid are shown US Patent Publication
- a nucleic acid is codon- optimized if at least one codon in the nucleic acid is replaced with a codon that is more frequently used by L. monocytogenes for that amino acid than the codon in the original sequence.
- N-terminal LLO protein fragment and heterologous antigen are, in one embodiment, fused directly to one another.
- the genes encoding the N-terminal LLO protein fragment and the heterologous antigen are fused directly to one another.
- the N-terminal LLO protein fragment and the heterologous antigen are attached via a linker peptide.
- the N-terminal LLO protein fragment and the heterologous antigen are attached via a heterologous peptide.
- the N-terminal LLO protein fragment is N-terminal to the heterologous antigen.
- the N-terminal LLO protein fragment is the N- terminal-most portion of the fusion protein.
- recombinant Listeria strains expressing LLO-antigen fusions induce anti-tumor immunity (Example 1), elicit antigen- specific T cell proliferation (Example 2), generate antigen-specific, and tumor-infiltrating T cells (Example 3).
- the present invention provides a method of treating a tumor or cancer in a subject, comprising the step of administering to the subject a recombinant Listeria strain, the recombinant Listeria strain comprising a recombinant polypeptide comprising an N-terminal fragment of an LLO protein and an HPV E7 antigen, whereby the recombinant Listeria strain induces an immune response against the E7 antigen, thereby treating a tumor or cancer in a subject.
- the recombinant Listeria strain expresses the recombinant polypeptide.
- the recombinant Listeria strain comprises a plasmid that encodes the recombinant polypeptide.
- the present invention provides a method of protecting a subject against a tumor or cancer, comprising the step of administering to the subject a recombinant Listeria strain, the recombinant Listeria strain comprising a recombinant polypeptide comprising an N-terminal fragment of an LLO protein and an HPV E7 antigen, whereby the recombinant Listeria strain induces an immune response against the E7 antigen, thereby protecting a subject against a tumor or cancer.
- the recombinant Listeria strain expresses the recombinant polypeptide.
- the recombinant Listeria strain comprises a plasmid that encodes the recombinant polypeptide.
- the present invention provides a method for inducing an immune response against a tumor or cancer in a subject, comprising the step of administering to the subject a recombinant Listeria strain, the recombinant Listeria strain comprising a recombinant polypeptide comprising an N-terminal fragment of an LLO protein and an HPV E7 antigen, thereby inducing an immune response against a tumor or cancer in a subject.
- the recombinant Listeria strain expresses the recombinant polypeptide.
- the recombinant Listeria strain comprises a plasmid that encodes the recombinant polypeptide.
- the present invention provides a method of treating a tumor or cancer in a subject, comprising the step of administering to the subject a recombinant Listeria strain, the recombinant Listeria strain comprising a recombinant polypeptide comprising an N-terminal fragment of an ActA protein and heterologous antigen, whereby the recombinant Listeria strain induces an immune response against the heterologous antigen, thereby treating a tumor or cancer in a subject.
- the recombinant Listeria strain expresses the recombinant polypeptide.
- the recombinant Listeria strain comprises a plasmid that encodes the recombinant polypeptide.
- the present invention provides a method of protecting a subject against a tumor or cancer, comprising the step of administering to the subject a recombinant Listeria strain, the recombinant Listeria strain comprising a recombinant polypeptide comprising an N-terminal fragment of an ActA protein and a heterologous antigen, whereby the recombinant Listeria strain induces an immune response against the heterologous antigen, thereby protecting a subject against a tumor or cancer.
- the recombinant Listeria strain expresses the recombinant polypeptide.
- the recombinant Listeria strain comprises a plasmid that encodes the recombinant polypeptide.
- the present invention provides a method for inducing an immune response against a tumor or cancer in a subject, comprising the step of administering to the subject a recombinant Listeria strain, the recombinant Listeria strain comprising a recombinant polypeptide comprising an N-terminal fragment of an heterologous protein and a heterologous antigen, thereby inducing an immune response against a tumor or cancer in a subject.
- the recombinant Listeria strain expresses the recombinant polypeptide.
- the recombinant Listeria strain comprises a plasmid that encodes the recombinant polypeptide.
- the N-terminal ActA protein fragment and the heterologous antigen are, in another embodiment, fused directly to one another.
- the genes encoding the N- terminal ActA protein fragment and heterologous antigen are fused directly to one another.
- the N-terminal ActA protein fragment and heterologous antigen are attached via a linker peptide.
- the N-terminal ActA protein fragment and heterologous antigen are attached via a heterologous peptide.
- the N-terminal ActA protein fragment is N-terminal to the heterologous antigen.
- the N-terminal ActA protein fragment is the N-terminal-most portion of the fusion protein.
- the present invention provides a method of inducing an immune response against a tumor or cancer in a subject, comprising the step of administering to the subject a recombinant Listeria strain, the recombinant Listeria strain comprising a recombinant polypeptide comprising a PEST amino acid sequence-containing peptide and a heterologous antigen, whereby the recombinant Listeria strain induces an immune response against the heterologous antigen, thereby treating a tumor or cancer in a subject.
- the recombinant Listeria strain expresses the recombinant polypeptide.
- the recombinant Listeria strain comprises a plasmid that encodes the recombinant polypeptide.
- the method protects a subject against a tumor or cancer. In another embodiment, the method treats a tumor or cancer in said subject.
- the PEST amino acid sequence-containing peptide and heterologous antigen are, in another embodiment, fused directly to one another.
- the genes encoding the PEST amino acid sequence-containing peptide and heterologous antigen are fused directly to one another.
- the PEST amino acid sequence- containing peptide and heterologous antigen are attached via a linker peptide.
- the PEST amino acid sequence-containing peptide and heterologous antigen are attached via a heterologous peptide.
- the PEST amino acid sequence- containing peptide is N-terminal to the heterologous antigen.
- the PEST amino acid sequence-containing peptide is the N-terminal-most portion of the fusion protein.
- the present invention provides a method for vaccinating a subject against an HPV, comprising the step of administering to the subject a prfA mutant recombinant Listeria strain provided herein, wherein the Listeria expresses an HPV antigen and wherein the Listeria comprises a plasmid that expresses a mutant PrfA protein.
- the recombinant Listeria strain expresses a recombinant polypeptide comprising said HPV antigen.
- the recombinant Listeria strain comprises a plasmid that encodes the recombinant polypeptide.
- provided herein is a method of increasing a ratio of T effector cells to regulatory T cells (Tregs) in the spleen and tumor microenvironments of a subject, comprising administering the immunogenic composition provided herein.
- increasing a ratio of T effector cells to regulatory T cells (Tregs) in the spleen and tumor microenvironments in a subject allows for a more profound anti-tumor response in the subject.
- a mutant PrfA protein provided herein comprises a D133V amino acid mutation. In another embodiment, the mutant PrfA protein consists of a D133V amino acid mutation.
- a nucleic acid comprising an open reading frame encoding a mutant PrfA protein provided herein is in a plasmid in said recombinant Listeria. In another embodiment, the plasmid comprising a nucleic acid encoding a mutant PrfA protein provided herein is an integrative plasmid. In another embodiment, the plasmid comprising a nucleic acid encoding a mutant PrfA protein provided herein is an episomal or extrachromosomal plasmid.
- a prfA mutant recombinant Listeria provided herein comprises a partial deletion in or a complete deletion of the chromosomal prfA gene.
- the prfA mutant Listeria comprises a loss-of-function mutation in the prfA gene.
- a mutant PrfA protein provided herein complements a genomic deletion, inactivation or mutation in the prfA gene in a recombinant Listeria. In another embodiment, a mutant PrfA protein provided herein complements a genomic deletion, inactivation or mutation in the prfA gene in the recombinant Listeria provided herein. In another embodiment, a mutant PrfA protein provided herein restores partial prfA function in a recombinant Listeria comprising a genomic deletion, inactivation or mutation of the prfA gene. In another embodiment, a mutant PrfA protein provided herein restores a loss-of PrfA function mutation in a recombinant Listeria. [0062] In one embodiment, a wild-type PrfA protein is encoded by the following wild-type nucleic acid sequence set forth in SEQ ID NO: 31.
- a wild-type PrfA protein comprises an amino acid sequence set forth in SEQ ID NO: 32.
- a nucleic acid sequence encoding a mutant prfA sequence is set forth in SEQ ID NO: 33.
- a mutant PrfA protein provided herein comprises an amino acid sequence set forth in SEQ ID NO: 34.
- SEQ ID NO: 34 represents a mutant PrfA protein comprising a D133V mutation.
- a mutant PrfA protein is homologous to SEQ ID NO: 34 and comprises a D133V mutation. In another embodiment, a mutant PrfA protein is at least 90% homologous with SEQ ID NO: 34 and comprises a D133V mutation. In another embodiment, a mutant PrfA protein is at least 85% homologous with SEQ ID NO: 34, and comprises a D133V mutation.
- the subject is at risk for developing an HPV-mediated carcinogenesis (e.g. a cervical, head and neck or anal cancer).
- an HPV-mediated carcinogenesis e.g. a cervical, head and neck or anal cancer.
- the subject is HPV-positive.
- the subject exhibits cervical intraepithelial neoplasia. In another embodiment, the subject exhibits a squamous intraepithelial lesion. In another embodiment, the subject exhibits a dysplasia in the cervix.
- the HPV that is the target of methods of the present invention is, in another embodiment, an HPV 16.
- the HPV is an HPV- 18.
- the HPV is selected from HPV- 16 and HPV- 18.
- the HPV is an HPV-31.
- the HPV is an HPV-35.
- the HPV is an HPV-39.
- the HPV is an HPV-45.
- the HPV is an HPV-51.
- the HPV is an HPV-52.
- the HPV is an HPV-58.
- the HPV is a high-risk HPV type.
- the HPV is a mucosal HPV type.
- Each possibility represents a separate embodiment of the present invention.
- the present invention provides a method of vaccinating a subject against an antigen of interest, the method comprising the step of intravenously administering to the subject an immunogenic composition, comprising a fusion of an immunogenic peptide to the antigen of interest, wherein the immunogenic peptide is selected from (a) an N-terminal fragment of an LLO protein; (b) an ActA protein or N-terminal fragment thereof; and (c) a PEST amino acid sequence-containing peptide, thereby vaccinating a subject against an antigen of interest.
- the present invention provides a method of vaccinating a subject against an antigen of interest, the method comprising the step of administering intravenously to the subject a recombinant Listeria strain comprising a recombinant polypeptide, the recombinant polypeptide comprising an immunogenic peptide fused to the antigen of interest, wherein the immunogenic peptide is selected from (a) an N-terminal fragment of an LLO protein; (b) an ActA protein or N-terminal fragment thereof; and (c) a PEST amino acid sequence-containing peptide, thereby vaccinating a subject against an antigen of interest.
- the present invention provides a method of inducing a CTL response in a subject against an antigen of interest, the method comprising the step of administering to the subject a recombinant Listeria strain comprising or expressing the antigen of interest, thereby inducing a CTL response in a subject against an antigen of interest.
- the step of administering is intravenous or oral administration.
- vaccines of the present invention are efficacious at inducing immune responses against HPV antigens E7 and E6.
- the present invention provides a method for inducing a regression of a cancer in a subject, comprising the step of administering to the subject a composition comprising a recombinant Listeria strain provided herein.
- the present invention provides a method for reducing an incidence of relapse of a cancer in a subject, comprising the step of administering to the subject a composition comprising a recombinant Listeria strain provided herein.
- the present invention provides a method for suppressing a formation of a tumor in a subject, comprising the step of administering to the subject a composition comprising recombinant Listeria strain provided herein.
- the present invention provides a method for inducing a remission of a cancer in a subject, comprising the step of administering to the subject a composition comprising a recombinant Listeria strain provided herein.
- the present invention provides a method for impeding a growth of a tumor in a subject, comprising the step of administering to the subject a composition comprising a recombinant Listeria strain provided herein.
- the present invention provides a method for reducing a size of a tumor in a subject, comprising the step of administering to the subject a composition comprising a recombinant Listeria strain provided herein.
- a disease is an infectious disease, an autoimmune disease, a respiratory disease, a pre-cancerous condition or a cancer.
- pre-cancerous condition may encompass dysplasias, preneoplastic nodules; macroregenerative nodules (MRN); low-grade dysplastic nodules (LG-DN); high-grade dysplastic nodules (HG-DN); biliary epithelial dysplasia; foci of altered hepatocytes (FAH); nodules of altered hepatocytes (NAH); chromosomal imbalances; aberrant activation of telomerase; re-expression of the catalytic subunit of telomerase; expression of endothelial cell markers such as CD31, CD34, and BNH9 (see, e.g., Terracciano and Tomillo (2003) Pathologica 95:71-82; Su and Bannasch (2003) Toxicol.
- Pathol. 31 126-133; Rocken and Carl-McGrath (2001) Dig. Dis. 19:269-278; Kotoula, et al. (2002) Liver 22:57-69; Frachon, et al. (2001) J. Hepatol. 34:850-857; Shimonishi, et al. (2000) J. Hepatobiliary Pancreat. Surg. 7:542-550; Nakanuma, et al. (2003) J. Hepatobiliary Pancreat. Surg. 10:265-281).
- Methods for diagnosing cancer and dysplasia are disclosed (see, e.g., Riegler (1996) Semin. Gastrointest. Dis.
- an infectious disease is one caused by, but not limited to, any one of the following pathogens: BCG/Tuberculosis, Malaria, Plasmodium falciparum, Plasmodium malariae, Plasmodium vivax, Rotavirus, Cholera, Diptheria- Tetanus, Pertussis, Haemophilus influenzae, Hepatitis B, Human papilloma virus, Influenza seasonal), Influenza A (H1N1) Pandemic, Measles and Rubella, Mumps, Meningococcus A+C, Oral Polio Vaccines, mono, bi and trivalent, Pneumococcal, Rabies, Tetanus Toxoid, Yellow Fever, Bacillus anthracis (anthrax), Clostridium botulinum toxin (botulism), Yersinia pestis (plague), Variola major (smallpox) and other related pox viruses, Francisella tularensis
- the infectious disease is a livestock infectious disease.
- livestock diseases can be transmitted to man and are called "zoonotic diseases.”
- these diseases include, but are not limited to, Foot and mouth disease, West Nile Virus, rabies, canine parvovirus, feline leukemia virus, equine influenza virus, infectious bovine rhinotracheitis (IBR), pseudorabies, classical swine fever (CSF), IBR, caused by bovine herpesvirus type 1 (BHV-1) infection of cattle, and pseudorabies (Aujeszky's disease) in pigs, toxoplasmosis, anthrax, vesicular stomatitis virus, rhodococcus equi, Tularemia, Plague (Yersinia pestis), trichomonas.
- the disease provided herein is a respiratory or inflammatory disease.
- the respiratory or inflammatory disease is chronic obstructive pulmonary disease
- live attenuated Listeria strains are capable of alleviating asthma symptoms without co-administration of other therapeutic agents, such as anti-inflammatory agents or bronchodilators.
- the methods provided herein further comprise the step of co-administering to a subject a live attenuated Listeria strain and one or more therapeutic agents.
- the therapeutic agent is an anti-asthmatic agent.
- the agent is an anti-inflammatory agent, a non-steroidal anti- inflammatory agent, an antibiotic, an antichlolinerginc agent, a bronchodilator, a corticosteroid, a short-acting beta-agonist, a long-acting beta-agonist, combination inhalers, an antihistamine, or combinations thereof.
- a disease is a cancer or a tumor.
- the tumor is cancerous.
- the cancer is breast cancer.
- the cancer is a cervical cancer.
- the cancer is a Her2 containing cancer.
- the cancer is a melanoma.
- the cancer is pancreatic cancer.
- the cancer is ovarian cancer.
- the cancer is gastric cancer.
- the cancer is a carcinomatous lesion of the pancreas.
- the cancer is pulmonary adenocarcinoma. In another embodiment, it is a glioblastoma multiforme.
- the cancer is colorectal adenocarcinoma. In another embodiment, the cancer is pulmonary squamous adenocarcinoma. In another embodiment, the cancer is gastric adenocarcinoma. In another embodiment, the cancer is an ovarian surface epithelial neoplasm (e.g. a benign, proliferative or malignant variety thereof). In another embodiment, the cancer is an oral squamous cell carcinoma. In another embodiment, the cancer is non-small-cell lung carcinoma. In another embodiment, the cancer is an endometrial carcinoma. In another embodiment, the cancer is a bladder cancer. In another embodiment, the cancer is a head and neck cancer. In another embodiment, the cancer is a prostate carcinoma.
- ovarian surface epithelial neoplasm e.g. a benign, proliferative or malignant variety thereof.
- the cancer is an oral squamous cell carcinoma.
- the cancer is non-small-cell lung carcinoma.
- the cancer is an endometrial carcinoma
- the cancer is oropharyngeal cancer. In another embodiment, the cancer is lung cancer. In another embodiment, the cancer is anal cancer. In another embodiment, the cancer is colorectal cancer. In another embodiment, the cancer is esophageal cancer.
- the cervical tumor targeted by methods of the present invention is, in another embodiment, a squamous cell carcinoma. In another embodiment, the cervical tumor is an adenocarcinoma. In another embodiment, the cervical tumor is an adenosquamous carcinoma. In another embodiment, the cervical tumor is a small cell carcinoma. In another embodiment, the cervical tumor is any other type of cervical tumor known in the art.
- a cervical tumor targeted by methods of the present invention is, in one embodiment, a squamous cell carcinoma.
- the cervical tumor is an adenocarcinoma.
- the cervical tumor is an adenosquamous carcinoma.
- the cervical tumor is a small cell carcinoma.
- the cervical tumor is any other type of cervical tumor known in the art. Each possibility represents a separate embodiment of the present invention.
- tumor antigen “antigenic polypeptide,” or “foreign antigen” are used interchangeably herein and include tumor antigens, tumor-associated antigens, angiogenic antigens, or infectious disease antigens.
- an antigen provided herein is a self-antigen that is present in the host but the host does not elicit an immune response against it because of immunologic tolerance.
- the antigen is Human Papilloma Virus-E7 (HPV-E7) antigen, which in one embodiment, is from HPV16 (in one embodiment, GenBank Accession No. AAD33253) and in another embodiment, from HPV18 (in one embodiment, GenBank Accession No. P06788).
- the antigenic polypeptide is HPV-E6, which in one embodiment, is from HPV16 (in one embodiment, GenBank Accession No. AAD33252, AAM51854, AAM51853, or AAB67615) and in another embodiment, from HPV18 (in one embodiment, GenBank Accession No. P06463).
- the antigenic polypeptide is a Her/2-neu antigen.
- the antigenic polypeptide is Prostate Specific Antigen (PSA) (in one embodiment, GenBank Accession No. CAD30844, CAD54617, AAA58802, or NP_001639).
- the antigenic polypeptide is Stratum Corneum Chymotryptic Enzyme (SCCE) antigen (in one embodiment, GenBank Accession No. AAK69652, AAK69624, AAG33360, AAF01139, or AAC37551).
- the antigenic polypeptide is Wilms tumor antigen 1 , which in another embodiment is WT-1 Telomerase (GenBank Accession. No. P49952, P22561, NP_659032, CAC39220.2, or EAW68222.1).
- the antigenic polypeptide is hTERT or Telomerase (GenBank Accession. No. NM003219 (variant 1), NM198255 (variant 2), NM 198253 (variant 3), or NM 198254 (variant 4).
- the antigenic polypeptide is Proteinase 3 (in one embodiment, GenBank Accession No. M29142, M75154, M96839, X55668, NM 00277, M96628 or X56606).
- the antigenic polypeptide is Tyrosinase Related Protein 2 (TRP2) (in one embodiment, GenBank Accession No. NP_001913, AB 173976, AAP33051, or Q95119).
- the antigenic polypeptide is High Molecular Weight Melanoma Associated Antigen (HMW-MAA) (in one embodiment, GenBank Accession No. NP_001888, AAI28111, or AAQ62842).
- the antigenic polypeptide is Testisin (in one embodiment, GenBank Accession No. AAF79020, AAF79019, AAG02255, AAK29360, AAD41588, or NP_659206).
- the antigenic polypeptide is NY-ESO-1 antigen (in one embodiment, GenBank Accession No. CAA05908, P78358, AAB49693, or NP_640343).
- the antigenic polypeptide is PSCA (in one embodiment, GenBank Accession No. AAH65183, NP_005663, NP_082492, 043653, or CAB97347).
- the antigenic polypeptide is Interleukin (IL) 13 Receptor alpha (in one embodiment, GenBank Accession No. NP_000631, NP_001551, NP_032382, NP-598751, NP_001003075, or NP_999506).
- the antigenic polypeptide is Carbonic anhydrase IX (CAIX) (in one embodiment, GenBank Accession No.
- the antigenic polypeptide is carcinoembryonic antigen (CEA) (in one embodiment, GenBank Accession No. AAA66186, CAA79884, CAA66955, AAA51966, AAD15250, or AAA51970.).
- the antigenic polypeptide is MAGE-A (in one embodiment, GenBank Accession No. NP_786885, NP_786884, NP_005352, NP_004979, NP_005358, or NP 005353).
- the antigenic polypeptide is survivin (in one embodiment, GenBank Accession No. AAC51660, AAY15202, ABF60110, NP_001003019, or NP 001082350).
- the antigenic polypeptide is GP100 (in one embodiment, GenBank Accession No. AAC60634, YP_655861, or AAB31176).
- the antigenic polypeptide is any other antigenic polypeptide known in the art.
- the antigenic peptide of the compositions and methods of the present invention comprise an immunogenic portion of the antigenic polypeptide. Each possibility represents a separate embodiment of the present invention.
- the antigen is telomerase (TERT).
- the antigen is LMP-1.
- the antigen is p53.
- the antigen is mesothelin.
- the antigen is EGFRVIII.
- the antigen is carboxic anhydrase IX (CAIX).
- the antigen is PSMA.
- the antigen is HMW-MAA.
- the antigen is HIV-1 Gag.
- the antigen is Tyrosinase related protein 2.
- the antigen is selected from Her-2, HIV-1 Gag, LMP-1, p53, PSMA, carcinoembryonic antigen (CEA), LMP-1, kallikrein-related peptidase 3 (KLK3), KLK9, Muc, Tyrosinase related protein 2, Mucl, FAP, IL-13R alpha 2, PSA (prostate-specific antigen), gp-100, heat-shock protein 70 (HSP-70), beta-HCG, EGFR-III, Granulocyte colony-stimulating factor (G-CSF), Angiogenin, Angiopoietin-1, Del-1, Fibroblast growth factors: acidic (aFGF) or basic (bFGF), Follistatin, Granulocyte colony- stimulating factor (G-CSF), Hepatocyte growth factor (HGF)/scatter factor (SF), Interleukin-8 (IL-8), Leptin, Midkine, Placental growth factor, Platelet-derived endothelial cell
- the antigen is a chimeric Her2/neu antigen as disclosed in US Patent Application Publication No. 2011/0142791, which is incorporated by reference herein in its entirety.
- the use of fragments of antigens provided herein is also encompassed by the present invention.
- the tumor antigen provided herein is a tumor-associated antigen, which in one embodiment, is one of the following tumor antigens: a MAGE (Melanoma- Associated Antigen E) protein, e.g. MAGE 1, MAGE 2, MAGE 3, MAGE 4, a tyrosinase; a mutant ras protein; a mutant p53 protein; p97 melanoma antigen, a ras peptide or p53 peptide associated with advanced cancers; the HPV 16/18 antigens associated with cervical cancers, KLH antigen associated with breast carcinoma, CEA (carcinoembryonic antigen) associated with colorectal cancer, a MARTI antigen associated with melanoma, or the PSA antigen associated with prostate cancer.
- the antigen for the compositions and methods provided herein are melanoma-associated antigens, which in one embodiment are TRP-2, MAGE-1, MAGE- 3, gp-100, tyrosinase, HSP-70, beta-HCG, or a combination thereof. It is to be understood that a skilled artisan would be able to use any heterologous antigen not mentioned herein but known in the art for use in the methods and compositions provided herein. It is also to be understood that the present invention provides, but is not limited by, an attenuated Listeria comprising a nucleic acid that encodes at least one of the antigens disclosed herein.
- the present invention encompasses nucleic acids encoding mutants, muteins, splice variants, fragments, truncated variants, soluble variants, extracellular domains, intracellular domains, mature sequences, and the like, of the disclosed antigens.
- nucleic acids encoding epitopes, oligo- and polypeptides of these antigens.
- codon optimized embodiments that is, optimized for expression in Listeria.
- the selected nucleic acid sequence can encode a full length or a truncated gene, a fusion or tagged gene, and can be a cDNA, a genomic DNA, or a DNA fragment, preferably, a cDNA. It can be mutated or otherwise modified as desired. These modifications include codon optimizations to optimize codon usage in the selected host cell or bacteria, i.e. Listeria.
- the selected sequence can also encode a secreted, cytoplasmic, nuclear, membrane bound or cell surface polypeptide.
- vascular endothelial growth factor is an important signaling protein involved in both vasculogenesis (the formation of the embryonic circulatory system) and angiogenesis (the growth of blood vessels from pre-existing vasculature).
- VEGF activity is restricted mainly to cells of the vascular endothelium, although it does have effects on a limited number of other cell types (e.g. stimulation monocyte/macrophage migration).
- VEGF has been shown to stimulate endothelial cell mitogenesis and cell migration.
- VEGF also enhances microvascular permeability and is sometimes referred to as vascular permeability factor.
- all of the members of the VEGF family stimulate cellular responses by binding to tyrosine kinase receptors (the VEGFRs) on the cell surface, causing them to dimerize and become activated through transphosphorylation.
- the VEGF receptors have an extracellular portion consisting of 7 immunoglobulin-like domains, a single transmembrane spanning region and an intracellular portion containing a split tyrosine-kinase domain.
- VEGF- A is a VEGFR-2 (KDR/Flk-l) ligand as well as a VEGFR-1 (Flt-l) ligand.
- VEGFR- mediates almost all of the known cellular responses to VEGF.
- the function of VEGFR-1 is less well defined, although it is thought to modulate VEGFR-2 signaling, in one embodiment, via sequestration of VEGF from VEGFR-2 binding, which in one embodiment, is particularly important during vasculogenesis in the embryo.
- VEGF-C and VEGF-D are ligands of the VEGFR-3 receptor, which in one embodiment, mediates lymphangiogenesis.
- the antigen of the present invention is a VEGF receptor or a fragment thereof, which in one embodiment, is a VEGFR-2 and, in another embodiment, a VEGFR-1, and, in another embodiment, VEGFR-3.
- vascular Endothelial Growth Factor Receptor 2 is highly expressed on activated endothelial cells (ECs) and participates in the formation of new blood vessels.
- VEGFR2 binds all 5 isoforms of VEGF.
- signaling of VEGF through VEGFR2 on ECs induces proliferation, migration, and eventual differentiation.
- the mouse homologue of VEGFR2 is the fetal liver kinase gene-1 (Flk-l), which is a strong therapeutic target, and has important roles in tumor growth, invasion, and metastasis.
- VEGFR2 is also referred to as kinase insert domain receptor (a type III receptor tyrosine kinase) (KDR), cluster of differentiation 309 (CD309), FLK1, Ly73, Krd-1, VEGFR, VEGFR-2, or 6130401C07.
- KDR kinase insert domain receptor
- CD309 cluster of differentiation 309
- FLK1, Ly73 FLK1, Ly73
- Krd-1 kinase insert domain receptor
- VEGFR VEGFR-2
- 6130401C7 6130401C7
- the antigen is derived from a fungal pathogen, bacteria, parasite, helminth, or viruses.
- the antigen is selected from tetanus toxoid, hemagglutinin molecules from influenza virus, diphtheria toxoid, HIV gpl20, HIV gag protein, IgA protease, insulin peptide B, Spongospora subterranea antigen, vibriose antigens, Salmonella antigens, pneumococcus antigens, respiratory syncytial virus antigens, Haemophilus influenza outer membrane proteins, Helicobacter pylori urease, Neisseria meningitidis pilins, N.
- gonorrhoeae pilins the melanoma-associated antigens (TRP-2, MAGE-1, MAGE-3, gp-100, tyrosinase, MART-1, HSP-70, beta-HCG), human papilloma virus antigens El and E2 from type HPV-16, -18, -31, -33, -35 or -45 human papilloma viruses, the tumor antigens CEA, the ras protein, mutated or otherwise, the p53 protein, mutated or otherwise, Mucl, or pSA.
- the antigen is associated with one of the following diseases; cholera, diphtheria, Haemophilus, hepatitis A, hepatitis B, influenza, measles, meningitis, mumps, pertussis, small pox, pneumococcal pneumonia, polio, rabies, rubella, tetanus, tuberculosis, typhoid, Varicella-zoster, whooping cough3 yellow fever, the immunogens and antigens from Addison's disease, allergies, anaphylaxis, Bruton's syndrome, cancer, including solid and blood borne tumors, eczema, Hashimoto's thyroiditis, polymyositis, dermatomyositis, type 1 diabetes mellitus, acquired immune deficiency syndrome, transplant rejection, such as kidney, heart, pancreas, lung, bone, and liver transplants, Graves' disease, polyendoc
- an HPV E6 antigen is utilized instead of or in addition to an E7 antigen in a method of the present invention for treating, protecting against, or inducing an immune response against a cervical cancer.
- an ActA protein fragment is utilized instead of or in addition to an LLO fragment in a method of the present invention for treating, protecting against, or inducing an immune response against a cervical cancer.
- a PEST amino acid sequence-containing protein fragment is utilized instead of or in addition to an LLO fragment in a method of the present invention for treating, protecting against, or inducing an immune response against a cervical cancer.
- the present invention provides a method for inducing an anti- E7 cytotoxic T cell (CTL) response in a subject, comprising the step of administering to the subject a recombinant Listeria strain, the recombinant Listeria strain comprising a recombinant polypeptide comprising an N-terminal fragment of an LLO protein and an HPV E7 antigen, thereby inducing an anti-E7 CTL response in a subject.
- the recombinant Listeria strain comprises a plasmid that encodes the recombinant polypeptide.
- the method further comprises the step of boosting the subject with a recombinant Listeria strain of the present invention.
- the method further comprises the step of boosting the subject with an immunogenic composition comprising an E7 antigen. In another embodiment, the method further comprises the step of boosting the subject with an immunogenic composition that directs a cell of the subject to express an E7 antigen.
- the CTL response is capable of therapeutic efficacy against an HPV-mediated disease, disorder, or symptom. In another embodiment, the CTL response is capable of prophylactic efficacy against an HPV-mediated disease, disorder, or symptom.
- the present invention provides a method of treating or ameliorating an HPV-mediated disease, disorder, or symptom in a subject, comprising the step of administering to the subject a recombinant Listeria strain, the recombinant Listeria strain comprising a recombinant polypeptide comprising an N-terminal fragment of an LLO protein and an HPV E7 antigen, whereby the recombinant Listeria strain induces an immune response against the E7 antigen, thereby treating or ameliorating an HPV-mediated disease, disorder, or symptom in a subject.
- the subject is a human subject.
- the subject is a non-human mammal.
- the subject is any other type of subject known in the art. Each possibility represents a separate embodiment of the present invention.
- the HPV-mediated disease, disorder, or symptom is genital warts. In another embodiment, the HPV-mediated disease, disorder, or symptom is non- genital warts. In another embodiment, the HPV-mediated disease, disorder, or symptom is a respiratory papilloma. In another embodiment, the HPV-mediated disease, disorder, or symptom is any other HPV-mediated disease, disorder, or symptom known in the art. Each possibility represents a separate embodiment of the present invention.
- the antigen of methods and compositions of the present invention is, in another embodiment, an HPV E7 protein.
- the antigen is an HPV E6 protein.
- the antigen is any other HPV protein known in the art. Each possibility represents a separate embodiment of the present invention.
- E7 antigen refers, in another embodiment, to an E7 protein. In another embodiment, the term refers to an E7 fragment. In another embodiment, the term refers to an E7 peptide. In another embodiment, the term refers to any other type of E7 antigen known in the art. Each possibility represents a separate embodiment of the present invention.
- the E7 protein of methods and compositions of the present invention is, in another embodiment, an HPV 16 E7 protein.
- the E7 protein is an HPV- 18 E7 protein.
- the E7 protein is an HPV-31 E7 protein.
- the E7 protein is an HPV- 35 E7 protein.
- the E7 protein is an HPV-39 E7 protein.
- the E7 protein is an HPV-45 E7 protein.
- the E7 protein is an HPV-51 E7 protein.
- the E7 protein is an HPV-52 E7 protein.
- the E7 protein is an HPV-58 E7 protein.
- the E7 protein is an E7 protein of a high-risk HPV type.
- the E7 protein is an E7 protein of a mucosal HPV type.
- Each possibility represents a separate embodiment of the present invention.
- E6 antigen refers, in another embodiment, to an E6 protein. In another embodiment, the term refers to an E6 fragment. In another embodiment, the term refers to an E6 peptide. In another embodiment, the term refers to any other type of E6 antigen known in the art. Each possibility represents a separate embodiment of the present invention.
- the E6 protein of methods and compositions of the present invention is, in another embodiment, an HPV 16 E6 protein.
- the E6 protein is an HPV- 18 E6 protein.
- the E6 protein is an HPV-31 E6 protein.
- the E6 protein is an HPV- 35 E6 protein.
- the E6 protein is an HPV-39 E6 protein.
- the E6 protein is an HPV-45 E6 protein.
- the E6 protein is an HPV-51 E6 protein.
- the E6 protein is an HPV-52 E6 protein.
- the E6 protein is an HPV-58 E6 protein.
- the E6 protein is an E6 protein of a high-risk HPV type.
- the E6 protein is an E6 protein of a mucosal HPV type.
- Each possibility represents a separate embodiment of the present invention.
- combinations of the E6 and E7 antigens are contemplated to fall within the scope of a "heterologous antigen" provided herein.
- the immune response induced by methods and compositions of the present invention is, in another embodiment, a T cell response.
- the immune response comprises a cytotoxic T cell response.
- the immune response comprises a T cell response.
- the response is a CD8 + T cell response.
- the response comprises a CD8 + T cell response.
- Each possibility represents a separate embodiment of the present invention.
- the N-terminal LLO protein fragment of methods and compositions of the present invention comprises, in another embodiment, SEQ ID No: 2.
- the fragment comprises an LLO signal peptide.
- the fragment comprises SEQ ID No: 2.
- the fragment consists approximately of SEQ ID No: 2.
- the fragment consists essentially of SEQ ID No: 2. In another embodiment, the fragment corresponds to SEQ ID No: 2. In another embodiment, the fragment is homologous to SEQ ID No: 2. In another embodiment, the fragment is homologous to a fragment of SEQ ID No: 2.
- the ALLO used in some of the Examples was 416 AA long (exclusive of the signal sequence), as 88 residues from the amino terminus which is inclusive of the activation domain containing cysteine 484 were truncated. It will be clear to those skilled in the art that any ALLO without the activation domain, and in particular without cysteine 484, are suitable for methods and compositions of the present invention.
- fusion of an E7 and/or E6 antigen to any ALLO including a PEST amino acid AA sequence, SEQ ID NO: 1, enhances cell mediated and anti-tumor immunity of the antigen.
- ALLO including a PEST amino acid AA sequence, SEQ ID NO: 1
- the LLO protein utilized to construct vaccines of the present invention has, in another embodiment, the sequence:
- the full length active LLO protein is 504 residues long.
- a full length LLO protein has an amino acid sequence of any full length wild-type LLO protein known in the art.
- SEQ ID NO: 3 is used as the source of the LLO fragment incorporated in a vaccine of the present invention. Each possibility represents a separate embodiment of the present invention.
- the N-terminal fragment of an LLO protein utilized in compositions and methods of the present invention has the sequence:
- the LLO fragment has the sequence:
- LLO protein refers to a wild-type LLO protein unless stated to be a fragment of the same.
- truncated LLO or “ALLO” refers to a fragment of LLO that comprises the PEST amino acid domain.
- the terms refer to an LLO fragment that comprises a PEST sequence.
- the terms refer to an LLO fragment that comprises a putative PEST sequence.
- the terms refer to an LLO fragment that does not contain the activation domain at the carboxy terminus and does not include cysteine 484. In another embodiment, the terms refer to an LLO fragment that is not hemolytic. In another embodiment, the LLO fragment is rendered non-hemolytic by deletion or mutation of the activation domain. In another embodiment, the LLO fragment is rendered non-hemolytic by deletion or mutation of cysteine 484. In another embodiment, the LLO fragment is rendered non-hemolytic by deletion or mutation at another location. Each possibility represents a separate embodiment of the present invention.
- the LLO fragment consists of about the first 441 AA of a wild-type LLO protein. In another embodiment, the LLO fragment consists of about the first 420 AA of LLO. In another embodiment, the LLO fragment is a non-hemolytic form of the LLO protein.
- the LLO fragment contains residues of a homologous LLO protein that correspond to one of the above AA ranges.
- the residue numbers need not, in another embodiment, correspond exactly with the residue numbers enumerated above; e.g. if the homologous LLO protein has an insertion or deletion, relative to an LLO protein utilized herein, then the residue numbers can be adjusted accordingly.
- the LLO fragment is any other LLO fragment known in the art. Each possibility represents a separate embodiment of the present invention.
- the recombinant polypeptide of methods of the present invention is expressed by the recombinant Listeria strain.
- the expression is mediated by a nucleotide molecule carried by the recombinant Listeria strain.
- the recombinant Listeria strain expresses the recombinant polypeptide by means of a plasmid that encodes the recombinant polypeptide.
- the plasmid comprises a gene encoding a bacterial transcription factor.
- the plasmid encodes a Listeria transcription factor.
- the transcription factor is PrfA.
- the PrfA is a mutant PrfA.
- the PrfA contains a D133V amino acid mutation.
- the transcription factor is any other transcription factor known in the art.
- the mutant PrfA encoded by said plasmid complements a genomic prfA mutation, deletion or inactivation in said Listeria.
- the mutant PrfA encoded by said plasmid restores partial PrfA function in said Listeria having a genomic prfA mutation, deletion or inactivation.
- a plasmid comprised by a recombinant Listeria provided herein comprises an open reading frame encoding a metabolic enzyme.
- the plasmid comprises a third open reading frame encoding a metabolic enzyme.
- the metabolic enzyme is a bacterial metabolic enzyme.
- the metabolic enzyme is a Listerial metabolic enzyme.
- the metabolic enzyme is an amino acid metabolism enzyme.
- the amino acid metabolism gene is involved in a cell wall synthesis pathway.
- the metabolic enzyme is the product of a D-amino acid aminotransferase gene (dat).
- the metabolic enzyme is the product of an alanine racemase gene (dal).
- the metabolic enzyme is any other metabolic enzyme known in the art.
- the plasmid carries an open reading frame encoding a dal protein.
- the plasmid carries an open reading frame encoding a dat protein.
- the plasmid carries an open reading frame encoding a dal and dat protein.
- when the plasmid carries an open reading frame encoding a dal and/or dat protein it is to complement a dal/dat mutation in a recombinant Listeria strain.
- dal/dat recombinant Listerias are also envisioned for use in the present invention.
- the recombinant Listeria provided herein comprises a dal/dat mutation in addition to any other mutation further described herein. Each possibility represents a separate embodiment of the present invention.
- a Listeria strain provided herein is deficient in an AA metabolism enzyme.
- the Listeria strain is deficient in a D-glutamic acid synthase gene.
- the Listeria strain is deficient in the dat gene.
- the Listeria strain is deficient in the dal gene.
- the Listeria strain is deficient in the dga gene.
- the Listeria strain is deficient in a gene involved in the synthesis of diaminopimelic acid (DAP).
- the Listeria strain is deficient in a gene involved in the synthesis of Cysteine synthase A (CysK).
- the gene is vitamin-B 12 independent methionine synthase.
- the gene is trpA.
- the gene is trpB.
- the gene is trpE.
- the gene is asnB.
- the gene is gltD.
- the gene is gltB.
- the gene is leuA.
- the gene is argG.
- the gene is thrC.
- the Listeria strain is deficient in one or more of the genes described hereinabove.
- a Listeria strain provided herein is deficient in a synthase gene.
- the gene is an AA synthesis gene.
- the gene is folP.
- the gene is dihydrouridine synthase family protein.
- the gene is ispD.
- the gene is ispF.
- the gene is phosphoenolpyruvate synthase.
- the gene is hisF.
- the gene is hisH.
- the gene is flil.
- the gene is ribosomal large subunit pseudouridine synthase.
- the gene ispD.
- the gene is bifunctional GMP synthase/glutamine amidotransferase protein.
- the gene is cobS.
- the gene is cobB.
- the gene is cbiD.
- the gene is uroporphyrin-III C-methyltransferase/ uroporphyrinogen-III synthase.
- the gene is cobQ.
- the gene is uppS.
- the gene is truB.
- the gene is dxs.
- the gene is mvaS.
- the gene is dap A.
- the gene is ispG.
- the gene is folC. In another embodiment, the gene is citrate synthase. In another embodiment, the gene is argj. In another embodiment, the gene is 3-deoxy-7-phosphoheptulonate synthase. In another embodiment, the gene is indole-3-glycerol-phosphate synthase. In another embodiment, the gene is anthranilate synthase/ glutamine amidotransferase component. In another embodiment, the gene is menB. In another embodiment, the gene is menaquinone- specific isochorismate synthase. In another embodiment, the gene is phosphoribosylformylglycinamidine synthase I or II.
- the gene is phosphoribosylaminoimidazole-succinocarboxamide synthase.
- the gene is carB.
- the gene is carA.
- the gene is thy A.
- the gene is mgsA.
- the gene is aroB.
- the gene is hepB.
- the gene is rluB.
- the gene is ilvB.
- the gene is ilvN.
- the gene is alsS.
- the gene is fabF.
- the gene is fabH.
- the gene is pseudouridine synthase.
- the gene is pyrG. In another embodiment, the gene is truA. In another embodiment, the gene is pabB. In another embodiment, the gene is an atp synthase gene (e.g. atpC, atpD-2, aptG, atpA-2, etc).
- the gene is phoP. In another embodiment, the gene is aroA. In another embodiment, the gene is aroC. In another embodiment, the gene is aroD. In another embodiment, the gene is plcB.
- a Listeria strain provided herein is deficient in a peptide transporter.
- the gene is ABC transporter/ ATP-binding/permease protein.
- the gene is oligopeptide ABC transporter/ oligopep tide- binding protein.
- the gene is oligopeptide ABC transporter/ permease protein.
- the gene is zinc ABC transporter/ zinc -binding protein.
- the gene is sugar ABC transporter.
- the gene is phosphate transporter.
- the gene is ZIP zinc transporter.
- the gene is drug resistance transporter of the EmrBIQacA family.
- the gene is sulfate transporter.
- the gene is proton- dependent oligopeptide transporter. In another embodiment, the gene is magnesium transporter. In another embodiment, the gene is formate/nitrite transporter. In another embodiment, the gene is spermidine/putrescine ABC transporter. In another embodiment, the gene is Na/Pi-cotransporter. In another embodiment, the gene is sugar phosphate transporter. In another embodiment, the gene is glutamine ABC transporter. In another embodiment, the gene is major facilitator family transporter. In another embodiment, the gene is glycine betaine/L-proline ABC transporter. In another embodiment, the gene is molybdenum ABC transporter. In another embodiment, the gene is techoic acid ABC transporter. In another embodiment, the gene is cobalt ABC transporter.
- the gene is ammonium transporter. In another embodiment, the gene is amino acid ABC transporter. In another embodiment, the gene is cell division ABC transporter. In another embodiment, the gene is manganese ABC transporter. In another embodiment, the gene is iron compound ABC transporter. In another embodiment, the gene is maltose/maltodextrin ABC transporter. In another embodiment, the gene is drug resistance transporter of the BcrlCflA family. In another embodiment, the gene is a subunit of one of the above proteins.
- nucleic acid molecule that is used to transform the Listeria in order to arrive at a recombinant Listeria.
- the nucleic acid provided herein used to transform Listeria lacks a virulence gene.
- the nucleic acid molecule is integrated into the Listeria genome and carries a non-functional virulence gene.
- the virulence gene is mutated in the recombinant Listeria.
- the nucleic acid molecule is used to inactivate the endogenous gene present in the Listeria genome.
- the virulence gene is an actA gene, an inlA gene, and MB gene, an inlC gene, inlJ gene, a plbC gene, a bsh gene, or a prfA gene. It is to be understood by a skilled artisan, that the virulence gene can be any gene known in the art to be associated with virulence in the recombinant Listeria.
- a live attenuated Listeria provided herein is a recombinant Listeria.
- a recombinant Listeria provided herein comprises a mutation of a genomic internalin C (inlC) gene.
- the recombinant Listeria comprises a mutation or a deletion of a genomic actA gene and a genomic internalin C gene.
- translocation of Listeria to adjacent cells is inhibited by the deletion of the actA gene and/or the inlC gene, which are involved in the process, thereby resulting in unexpectedly high levels of attenuation with increased immunogenicity and utility as a strain backbone.
- the term "attenuation,” may encompass a diminution in the ability of the bacterium to cause disease in an animal.
- the pathogenic characteristics of the attenuated Listeria strain have been lessened compared with wild-type Listeria, although the attenuated Listeria is capable of growth and maintenance in culture.
- the lethal dose at which 50% of inoculated animals survive is preferably increased above the LD 50 of wild-type Listeria by at least about 10-fold, more preferably by at least about 100-fold, more preferably at least about 1 ,000 fold, even more preferably at least about 10,000 fold, and most preferably at least about 100,000-fold.
- An attenuated strain of Listeria is thus one which does not kill an animal to which it is administered, or is one which kills the animal only when the number of bacteria administered is vastly greater than the number of wild type non-attenuated bacteria which would be required to kill the same animal.
- An attenuated bacterium should also be construed to mean one which is incapable of replication in the general environment because the nutrient required for its growth is not present therein. Thus, the bacterium is limited to replication in a controlled environment wherein the required nutrient is provided.
- the attenuated strains of the present invention are therefore environmentally safe in that they are incapable of uncontrolled replication.
- a Listeria strain provided herein is an inlA mutant, an MB mutant, an inlC mutant, an inlJ mutant, prfA mutant, actA mutant, a dal/dat mutant, a prfA mutant, a plcB deletion mutant, or a double mutant lacking both plcA and plcB.
- the Listeria comprises a deletion or mutation of these genes individually or in combination.
- the Listeria provided herein lack each one of genes.
- the Listeria provided herein lack at least one and up to ten of any gene provided herein, including the actA, prfA, and dal/dat genes.
- the prfA mutant is a D133V PrfA mutant.
- the metabolic gene, the virulence gene, etc. is lacking in a chromosome of the Listeria strain. In another embodiment, the metabolic gene, virulence gene, etc. is lacking in the chromosome and in any episomal genetic element of the Listeria strain. In another embodiment, the metabolic gene, virulence gene, etc. is lacking in the genome of the virulence strain. In one embodiment, the virulence gene is mutated in the chromosome. In another embodiment, the virulence gene is deleted from the chromosome. In another embodiment, the metabolic gene, the virulence gene, etc. is mutated in a chromosome of the Listeria strain.
- the metabolic gene, virulence gene, etc. is mutated in the chromosome and in any episomal genetic element of the Listeria strain. In another embodiment, the metabolic gene, virulence gene, etc. is mutated in the genome of the virulence strain. In another embodiment, the virulence gene is deleted from the chromosome.
- a recombinant Listeria strain provided herein is attenuated.
- the recombinant Listeria lacks the actA virulence gene.
- the recombinant Listeria lacks the prfA virulence gene.
- the recombinant Listeria lacks the inlB gene.
- the recombinant Listeria lacks both, the actA and MB genes.
- the recombinant Listeria strain provided herein comprises an inactivating mutation of the endogenous actA gene.
- the recombinant Listeria strain provided herein comprises an inactivating mutation of the endogenous MB gene.
- the recombinant Listeria strain provided herein comprises an inactivating mutation of the endogenous inlC gene. In another embodiment, the recombinant Listeria strain provided herein comprises an inactivating mutation of the endogenous actA and B genes. In another embodiment, the recombinant Listeria strain provided herein comprises an inactivating mutation of the endogenous actA and MC genes. In another embodiment, the recombinant Listeria strain provided herein comprises an inactivating mutation of the endogenous actA, MB, and MC genes. In another embodiment, the recombinant Listeria strain provided herein comprises an inactivating mutation of the endogenous actA, MB, and MC genes.
- the recombinant Listeria strain provided herein comprises an inactivating mutation of the endogenous actA, MB, and inlC genes. In another embodiment, the recombinant Listeria strain provided herein comprises an inactivating mutation in any single gene or combination of the following genes: actA, dal, dat, B, MC, prfA, pic A, plcB.
- mutants include any type of mutation or modification to the sequence (nucleic acid or amino acid sequence), and includes a deletion mutation, a truncation, an inactivation, a disruption, or a translocation. These types of mutations are readily known in the art.
- auxotrophic bacteria comprising a plasmid encoding a metabolic enzyme or a complementing gene provided herein
- transformed auxotrophic bacteria are grown on a media that will select for expression of the amino acid metabolism gene or the complementing gene.
- a bacteria auxotrophic for D-glutamic acid synthesis is transformed with a plasmid comprising a gene for D-glutamic acid synthesis, and the auxotrophic bacteria will grow in the absence of D-glutamic acid, whereas auxotrophic bacteria that have not been transformed with the plasmid, or are not expressing the plasmid encoding a protein for D-glutamic acid synthesis, will not grow.
- a bacterium auxotrophic for D-alanine synthesis will grow in the absence of D-alanine when transformed and expressing the plasmid of the present invention if the plasmid comprises an isolated nucleic acid encoding an amino acid metabolism enzyme for D-alanine synthesis.
- Such methods for making appropriate media comprising or lacking necessary growth factors, supplements, amino acids, vitamins, antibiotics, and the like are well known in the art, and are available commercially (Becton-Dickinson, Franklin Lakes, NJ).
- the bacteria are propagated in the presence of a selective pressure. Such propagation comprises growing the bacteria in media without the auxotrophic factor.
- the presence of the plasmid expressing an amino acid metabolism enzyme in the auxotrophic bacteria ensures that the plasmid will replicate along with the bacteria, thus continually selecting for bacteria harboring the plasmid.
- the skilled artisan when equipped with the present disclosure and methods herein will be readily able to scale-up the production of the Listeria vaccine vector by adjusting the volume of the media in which the auxotrophic bacteria comprising the plasmid are growing.
- auxotroph strains and complementation systems are adopted for the use with this invention.
- a recombinant Listeria strain provided herein expresses a recombinant polypeptide.
- a recombinant Listeria strain comprises a plasmid that encodes a recombinant polypeptide.
- a recombinant nucleic acid provided herein is in a plasmid in the recombinant Listeria strain provided herein.
- the plasmid is an episomal plasmid that does not integrate into the recombinant Listeria strain's chromosome.
- the plasmid is an integrative plasmid that integrates into the Listeria strain's chromosome.
- the plasmid is a multicopy plasmid.
- the recombinant Listeria strain is administered to the human subject at a dose of 1 x 10 9 - 3.31 x 10 10 CFU.
- the dose is 5-500 x 10 8 CFU.
- the dose is 7-500 x 10 8 CFU.
- the dose is 10-500 x 10 8 CFU.
- the dose is 20-500 x 10 8 CFU.
- the dose is 30-500 x 10 8 CFU.
- the dose is 50-500 x 10 8 CFU.
- the dose is 70- 500 x 10 8 CFU.
- the dose is 100-500 x 10 8 CFU.
- the dose is 150-500 x 10 8 CFU. In another embodiment, the dose is 5-300 x 10 8 CFU. In another embodiment, the dose is 5-200 x 10 8 CFU. In another embodiment, the dose is 5-150 x 10 8 CFU. In another embodiment, the dose is 5-100 x 10 8 CFU. In another embodiment, the dose is 5-70 x 10 8 CFU. In another embodiment, the dose is 5-50 x 10 8 CFU. In another embodiment, the dose is 5-30 x 10 8 CFU. In another embodiment, the dose is 5-20 x 10 8 CFU. In another embodiment, the dose is 1-30 x 10 9 CFU. In another embodiment, the dose is 1-20 x 10 9 CFU.
- the dose is 2-30 x 10 9 CFU. In another embodiment, the dose is 1-10 x 10 9 CFU. In another embodiment, the dose is 2-10 x 10 9 CFU. In another embodiment, the dose is 3-10 x 10 9 CFU. In another embodiment, the dose is 2-7 x 10 9 CFU. In another embodiment, the dose is 2-5 x 10 9 CFU. In another embodiment, the dose is 3-5 x 10 9 CFU.
- the dose is 1 x 10 7 organisms. In another embodiment, the dose is 1 x 10 8 organisms. In another embodiment, the dose is 1 x 10 9 organisms. In another embodiment, the dose is 1.5 x 10 9 organisms. In another embodiment, the dose is 2 x 10 9 organisms. In another embodiment, the dose is 3 x 10 9 organisms. In another embodiment, the dose is 4 x 10 9 organisms. In another embodiment, the dose is 5 x 10 9 organisms. In another embodiment, the dose is 6 x 10 9 organisms. In another embodiment, the dose is 7 x 10 9 organisms. In another embodiment, the dose is 8 x 10 9 organisms. In another embodiment, the dose is 10 x 10 9 organisms.
- the dose is 1.5 x 10 10 organisms. In another embodiment, the dose is 2 x 10 10 organisms. In another embodiment, the dose is 2.5 x 10 10 organisms. In another embodiment, the dose is 3 x 10 10 organisms. In another embodiment, the dose is 3.3 x 10 10 organisms. In another embodiment, the dose is 4 x 10 10 organisms. In another embodiment, the dose is 5 x 10 10 organisms.
- Each dose and range of doses represents a separate embodiment of the present invention.
- repeat administrations (doses) of compositions of this invention may be undertaken immediately following the first course of treatment or after an interval of days, weeks or months to achieve tumor regression.
- repeat doses may be undertaken immediately following the first course of treatment or after an interval of days, weeks or months to achieve suppression of tumor growth.
- Assessment may be determined by any of the techniques known in the art, including diagnostic methods such as imaging techniques, analysis of serum tumor markers, biopsy, or the presence, absence or amelioration of tumor associated symptoms.
- Boosting may encompass administering an immunogenic composition or recombinant Listeria strain dose to a subject.
- 2 boosts or a total of 3 inoculations
- 3 boosts are administered.
- 4 boosts are administered.
- 5 boosts are administered.
- 6 boosts are administered.
- more than 6 boosts are administered.
- a method of present invention further comprises the step of boosting the human subject with a recombinant Listeria strain of the present invention.
- the recombinant Listeria strain used in the booster inoculation is the same as the strain used in the initial "priming" inoculation.
- the booster strain is different from the priming strain.
- the same doses are used in the priming and boosting inoculations.
- a larger dose is used in the booster.
- a smaller dose is used in the booster.
- the methods of the present invention further comprise the step of administering to the subject a booster vaccination.
- the booster vaccination follows a single priming vaccination.
- a single booster vaccination is administered after the priming vaccinations.
- two booster vaccinations are administered after the priming vaccinations.
- the period between a prime and a boost strain is experimentally determined by the skilled artisan.
- the period between a prime and a boost strain is from 1 day and up to 1 week, in another embodiment it is up to 2 weeks, in another embodiment, it is up to 3 weeks, in another embodiment, it is up to 4 weeks, in another embodiment, it is up to 5 weeks, in another embodiment it is up to 6-8 weeks, in yet another embodiment, the boost strain is administered up to 8-12 weeks after the prime strain.
- the boost strain is administered up to 8-12 weeks after the prime strain.
- a method of present invention further comprises the step of inoculating the human subject with an immunogenic composition comprising the E7 antigen.
- the immunogenic composition comprises a recombinant E7 protein or fragment thereof.
- the immunogenic composition comprises a nucleotide molecule expressing a recombinant E7 protein or fragment thereof.
- the non-Listeri&l inoculation is administered after the Listerial inoculation.
- the non-Listerial inoculation is administered before the Listerial inoculation.
- the recombinant Listeria strain of methods and compositions of the present invention is, in another embodiment, a recombinant Listeria monocytogenes strain.
- the Listeria strain is a recombinant Listeria seeligeri strain.
- the Listeria strain is a recombinant Listeria grayi strain.
- the Listeria strain is a recombinant Listeria ivanovii strain.
- the Listeria strain is a recombinant Listeria murrayi strain.
- the Listeria strain is a recombinant Listeria welshimeri strain.
- the Listeria strain is a recombinant strain of any other Listeria species known in the art. Each possibility represents a separate embodiment of the present invention.
- the present invention provides a number of Listerial species and strains for making or engineering an attenuated Listeria of the present invention.
- the Listeria strain is L. monocytogenes 10403S wild type (see Bishop and Hinrichs (1987) J. Immunol. 139: 2005-2009; Lauer, et al. (2002) J. Bact. 184: 4177-4186.)
- the Listeria strain is L. monocytogenes DP-L4056 (phage cured) (see Lauer, et al. (2002) J. Bact. 184: 4177-4186).
- the Listeria strain is L.
- the Listeria strain is L. monocytogenes DP-L4029, which is phage cured, deleted in ActA (see Lauer, et al. (2002) J. Bact. 184: 4177-4186; Skoble, et al. (2000) J. Cell Biol. 150: 527- 538).
- the Listeria strain is L.
- the Listeria strain is L. monocytogenes DP-L4097 (LLO-S44A) (see Brockstedt, et al. (2004) Proc. Natl. Acad. Sci. USA 101 : 13832-13837; supporting information).
- the Listeria strain is L. monocytogenes DP- L4364 (delta lplA; lipoate protein ligase) (see Brockstedt, et al. (2004) Proc. Natl. Acad. Sci.
- the Listeria strain is L. monocytogenes DP-L4405 (delta inlA) (see Brockstedt, et al. (2004) Proc. Natl. Acad. Sci. USA 101 : 13832-13837; supporting information).
- the Listeria strain is L. monocytogenes DP-L4406 (delta inlB) (see Brockstedt, et al. (2004) Proc. Natl. Acad. Sci. USA 101 : 13832-13837; supporting information).
- the Listeria strain is L.
- the Listeria strain is L. monocytogenes CS-L0002 (delta ActA-delta lplA) (see Brockstedt, et al. (2004) Proc. Natl. Acad. Sci. USA 101 : 13832-13837; supporting information).
- the Listeria strain is L. monocytogenes CS-L0003 (L461T-delta lplA) (see Brockstedt, et al. (2004) Proc. Natl.
- the Listeria strain is L. monocytogenes DP-L4038 (delta ActA-LLO L461T) (see Brockstedt, et al. (2004) Proc. Natl. Acad. Sci. USA 101 : 13832-13837; supporting information).
- the Listeria strain is L. monocytogenes DP-L4384 (S44A-LLO L461T) (see Brockstedt, et al. (2004) Proc. Natl. Acad. Sci. USA 101 : 13832-13837; supporting information).
- the Listeria strain is L. monocytogenes.
- the Listeria strain is L. monocytogenes DP-L4017 (10403S hly (L461T), having a point mutation in hemolysin gene (see U.S. Provisional Pat. Appl. Ser. No. 60/490,089 filed Jul. 24, 2003).
- the Listeria strain is L. monocytogenes EGD (see GenBank Acc. No. AL591824).
- the Listeria strain is L. monocytogenes EGD-e (see GenBank Acc. No. NC_003210. ATCC Acc. No. BAA-679).
- the Listeria strain is L. monocytogenes DP-L4029 deleted in uvrAB (see U.S. Provisional Pat. Appl. Ser. No. 60/541,515 filed Feb. 2, 2004; US Provisional Pat. Appl. Ser. No. 60/490,080 filed Jul. 24, 2003).
- the Listeria strain is L. monocytogenes ActA- /inlB - double mutant (see ATCC Acc. No. PTA-5562).
- the Listeria strain is L. monocytogenes lplA mutant or hly mutant (see U.S. Pat. Applic. No. 20040013690 of Portnoy, et. al).
- the Listeria strain is L.
- the present invention encompasses reagents and methods that comprise the above Listerial strains, as well as these strains that are modified, e.g., by a plasmid and/or by genomic integration, to contain a nucleic acid encoding one of, or any combination of, the following genes: hly (LLO; listeriolysin); iap (p60); inlA; inlB; inlC; dal (alanine racemase); dat (D-amino acid aminotransferase); plcA; plcB; actA; or any nucleic acid that mediates growth, spread, breakdown of a single walled vesicle, breakdown of a double walled vesicle, binding to a host cell, uptake by a host cell.
- the present invention is not to be limited by the particular strains disclosed above
- a recombinant Listeria strain of the present invention has been passaged through an animal host.
- the passaging maximizes efficacy of the strain as a vaccine vector.
- the passaging stabilizes the immunogenicity of the Listeria strain.
- the passaging stabilizes the virulence of the Listeria strain.
- the passaging increases the immunogenicity of the Listeria strain.
- the passaging increases the virulence of the Listeria strain.
- the passaging removes unstable substrains of the Listeria strain.
- the passaging reduces the prevalence of unstable sub-strains of the Listeria strain.
- the Listeria strain contains a genomic insertion of the gene encoding the antigen-containing recombinant peptide.
- the Listeria strain carries a plasmid comprising the gene encoding the antigen-containing recombinant peptide.
- the passaging is performed as described herein (e.g. in Example 12). In another embodiment, the passaging is performed by any other method known in the art. Each possibility represents a separate embodiment of the present invention.
- the recombinant Listeria strain utilized in methods of the present invention has been stored in a frozen cell bank.
- the recombinant Listeria strain has been stored in a lyophilized condition.
- the cell bank of methods and compositions of the present invention is a master cell bank.
- the cell bank is a working cell bank.
- the cell bank is Good Manufacturing Practice (GMP) cell bank.
- the cell bank is intended for production of clinical-grade material.
- the cell bank conforms to regulatory practices for human use.
- the cell bank is any other type of cell bank known in the art. Each possibility represents a separate embodiment of the present invention.
- Good Manufacturing Practices are defined, in another embodiment, by (21 CFR 210-211) of the United States Code of Federal Regulations. In another embodiment, “Good Manufacturing Practices” are defined by other standards for production of clinical-grade material or for human consumption; e.g. standards of a country other than the United States. Each possibility represents a separate embodiment of the present invention.
- a recombinant Listeria strain utilized in methods of the present invention is from a batch of vaccine doses.
- a recombinant Listeria strain utilized in methods of the present invention is from a frozen or lyophilized stock produced by methods provided in US Patent Ser. No. 8,114,414, which is incorporated by reference herein.
- a peptide of the present invention is a fusion peptide.
- fusion peptide refers to a peptide or polypeptide comprising 2 or more proteins linked together by peptide bonds or other chemical bonds.
- the proteins are linked together directly by a peptide or other chemical bond.
- the proteins are linked together with 1 or more AA (e.g. a "spacer") between the 2 or more proteins.
- AA e.g. a "spacer”
- a vaccine of the present invention further comprises an adjuvant.
- the adjuvant utilized in methods and compositions of the present invention is, in another embodiment, a granulocyte/macrophage colony-stimulating factor (GM-CSF) protein.
- the adjuvant comprises a GM-CSF protein.
- the adjuvant is a nucleotide molecule encoding GM-CSF.
- the adjuvant comprises a nucleotide molecule encoding GM-CSF.
- the adjuvant is saponin QS21.
- the adjuvant comprises saponin QS21.
- the adjuvant is monophosphoryl lipid A.
- the adjuvant comprises monophosphoryl lipid A. In another embodiment, the adjuvant is SBAS2. In another embodiment, the adjuvant comprises SBAS2. In another embodiment, the adjuvant is an unmethylated CpG-containing oligonucleotide. In another embodiment, the adjuvant comprises an unmethylated CpG-containing oligonucleotide. In another embodiment, the adjuvant is an immune-stimulating cytokine. In another embodiment, the adjuvant comprises an immune-stimulating cytokine. In another embodiment, the adjuvant is a nucleotide molecule encoding an immune- stimulating cytokine.
- the adjuvant comprises a nucleotide molecule encoding an immune-stimulating cytokine.
- the adjuvant is or comprises a quill glycoside.
- the adjuvant is or comprises a bacterial mitogen.
- the adjuvant is or comprises a bacterial toxin.
- the adjuvant is or comprises any other adjuvant known in the art. Each possibility represents a separate embodiment of the present invention.
- a nucleotide of the present invention is operably linked to a promoter/regulatory sequence that drives expression of the encoded peptide in the Listeria strain.
- Promoter/regulatory sequences useful for driving constitutive expression of a gene are well known in the art and include, but are not limited to, for example, the P h i Y A, PA CI A, and p60 promoters of Listeria, the Streptococcus bac promoter, the Streptomyces griseus sgiA promoter, and the B. thuringiensis phaZ promoter.
- inducible and tissue specific expression of the nucleic acid encoding a peptide of the present invention is accomplished by placing the nucleic acid encoding the peptide under the control of an inducible or tissue specific promoter/regulatory sequence.
- tissue specific or inducible promoter/regulatory sequences which are useful for his purpose include, but are not limited to the MMTV LTR inducible promoter, and the SV40 late enhancer/promoter.
- a promoter that is induced in response to inducing agents such as metals, glucocorticoids, and the like, is utilized.
- an N-terminal fragment of an ActA protein utilized in methods and compositions of the present invention has, in another embodiment, the sequence set forth in SEQ ID NO: 5.
- the ActA fragment comprises the sequence set forth in SEQ ID NO: 5.
- the ActA fragment is any other ActA fragment known in the art. Each possibility represents a separate
- the recombinant nucleotide encoding a fragment of an ActA protein comprises the sequence set forth in SEQ ID NO: 6:
- the recombinant nucleotide has the sequence set forth in SEQ ID NO: 6. In another embodiment, the recombinant nucleotide comprises any other sequence that encodes a fragment of an ActA protein. Each possibility represents a separate embodiment of the present invention.
- a PEST amino acid AA sequence is fused to the E7 or E6 antigen.
- recombinant Listeria strains expressing PEST amino acid sequence- antigen fusions induce anti-tumor immunity (Example 3) and generate antigen-specific, tumor-infiltrating T cells (Example 4).
- enhanced cell mediated immunity was demonstrated for fusion proteins comprising an antigen and LLO containing the PEST amino acid AA sequence KENSISSMAPPASPPASPKTPIEKKHADEIDK (SEQ ID NO: 1).
- the PEST amino acid AA sequence has, in another embodiment, a sequence selected from SEQ ID NO: 7-12.
- the PEST amino acid sequence is a PEST amino acid sequence from the LM ActA protein.
- the PEST amino acid sequence is KTEEQPS EVNTGPR (SEQ ID NO: 7), KASVTDTSEGDLDSSMQSADESTPQPLK (SEQ ID NO: 8),
- the PEST amino acid sequence is from Streptolysin O protein of Streptococcus sp. In another embodiment, the PEST amino acid sequence is from Streptococcus pyogenes Streptolysin O, e.g. KQNTASTETTTTNEQPK (SEQ ID NO: 11) at AA 35-51. In another embodiment, the PEST amino acid sequence is from Streptococcus equisimilis Streptolysin O, e.g. KQNTANTETTTTNEQPK (SEQ ID NO: 12) at AA 38-54.
- the PEST amino acid sequence is another PEST amino acid AA sequence derived from a prokaryotic organism. In another embodiment, the PEST amino acid sequence is any other PEST amino acid sequence known in the art. Each possibility represents a separate embodiment of the present invention.
- PEST amino acid sequences of other prokaryotic organism can be identified in accordance with methods such as described by, for example Rechsteiner and Rogers (1996, Trends Biochem. Sci. 21 :267-271) for LM. Alternatively, PEST amino acid AA sequences from other prokaryotic organisms can also be identified based by this method. Other prokaryotic organisms wherein PEST amino acid AA sequences would be expected to include, but are not limited to, other Listeria species. In another embodiment, the PEST amino acid sequence is embedded within the antigenic protein.
- fusion refers to an antigenic protein comprising both the antigen and either i) an N-terminal LLO protein (tLLO), ii) an N-terminal ActA protein or iii) a PEST amino acid sequence either linked at one end of the antigen or embedded within the antigen.
- tLLO N-terminal LLO protein
- ActA N-terminal ActA protein
- PEST amino acid sequence either linked at one end of the antigen or embedded within the antigen.
- a PEST amino acid sequence is identified using any other method or algorithm known in the art, e.g the CaSPredictor (Garay-Malpartida HM, Occhiucci JM, Alves J, Belizario JE. Bioinformatics. 2005 Jun;21 Suppl l:il 69-76).
- the following method is used:
- a PEST index is calculated for each 30-35 AA stretch by assigning a value of 1 to the amino acids Ser, Thr, Pro, Glu, Asp, Asn, or Gin.
- the coefficient value (CV) for each of the PEST residue is 1 and for each of the other AA (non-PEST) is 0.
- the LLO protein, Act A protein, or fragment thereof of the present invention need not be that which is set forth exactly in the sequences set forth herein, but rather other alterations, modifications, or changes can be made that retain the functional characteristics of an LLO or ActA protein fused to an antigen as set forth elsewhere herein.
- the present invention utilizes an analog of an LLO protein, ActA protein, or fragment thereof. Analogs differ, in another embodiment, from naturally occurring proteins or peptides by conservative AA sequence differences or by modifications which do not affect sequence, or by both.
- E7 protein is fused to a LLO protein, ActA protein, or PEST amino acid sequence-containing peptide to generate a recombinant peptide of methods of the present invention.
- the E7 protein that is utilized (either whole or as the source of the fragments) has, in another embodiment, the sequence [00164] MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHY NIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP (SEQ ID No: 13).
- the E7 protein is a homologue of SEQ ID No: 13.
- the E7 protein is a variant of SEQ ID No: 13. In another embodiment, the E7 protein is an isomer of SEQ ID No: 13. In another embodiment, the E7 protein is a fragment of SEQ ID No: 13. In another embodiment, the E7 protein is a fragment of a homologue of SEQ ID No: 13. In another embodiment, the E7 protein is a fragment of a variant of SEQ ID No: 13. In another embodiment, the E7 protein is a fragment of an isomer of SEQ ID No: 13. Each possibility represents a separate embodiment of the present invention.
- sequence of the E7 protein is:
- the E6 protein is a homologue of SEQ ID No: 14.
- the E6 protein is a variant of SEQ ID No: 14.
- the E6 protein is an isomer of SEQ ID No: 14.
- the E6 protein is a fragment of SEQ ID No: 14.
- the E6 protein is a fragment of a homologue of SEQ ID No: 14.
- the E6 protein is a fragment of an isomer of SEQ ID No: 14.
- the E7 protein has a sequence set forth in one of the following GenBank entries: M24215, NC_004500, V01116, X62843, or M14119.
- the E7 protein is a homologue of a sequence from one of the above GenBank entries.
- the E7 protein is a variant of a sequence from one of the above GenBank entries.
- the E7 protein is an isomer of a sequence from one of the above GenBank entries.
- the E7 protein is a fragment of a sequence from one of the above GenBank entries.
- the E7 protein is a fragment of a homologue of a sequence from one of the above GenBank entries.
- the E7 protein is a fragment of a variant of a sequence from one of the above GenBank entries. In another embodiment, the E7 protein is a fragment of an isomer of a sequence from one of the above GenBank entries.
- either a whole E6 protein or a fragment thereof is fused to a LLO protein, ActA protein, or PEST amino acid sequence-containing peptide to generate a recombinant peptide of methods of the present invention.
- the E6 protein that is utilized has, in another embodiment, the sequence [00169] MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFA FRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCI NCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL (SEQ ID No: 15).
- the E6 protein is a homologue of SEQ ID No: 15.
- the E6 protein is a variant of SEQ ID No: 15.
- the E6 protein is an isomer of SEQ ID No: 15. In another embodiment, the E6 protein is a fragment of SEQ ID No: 15. In another embodiment, the E6 protein is a fragment of a homologue of SEQ ID No: 15. In another embodiment, the E6 protein is a fragment of a variant of SEQ ID No: 15. In another embodiment, the E6 protein is a fragment of an isomer of SEQ ID No: 15.
- Each possibility represents a separate embodiment of the present invention.
- sequence of the E6 protein is:
- the E6 protein is a homologue of SEQ ID No: 16.
- the E6 protein is a variant of SEQ ID No: 16.
- the E6 protein is an isomer of SEQ ID No: 16.
- the E6 protein is a fragment of SEQ ID No: 16.
- the E6 protein is a fragment of a homologue of SEQ ID No: 16. In another embodiment, the E6 protein is a fragment of a variant of SEQ ID No: 16. In another embodiment, the E6 protein is a fragment of an isomer of SEQ ID No: 16. Each possibility represents a separate embodiment of the present invention.
- the E6 protein has a sequence set forth in one of the following GenBank entries: M24215, M14119, NC_004500, V01116, X62843, or M14119.
- the E6 protein is a homologue of a sequence from one of the above GenBank entries.
- the E6 protein is a variant of a sequence from one of the above GenBank entries.
- the E6 protein is an isomer of a sequence from one of the above GenBank entries.
- the E6 protein is a fragment of a sequence from one of the above GenBank entries.
- the E6 protein is a fragment of a homologue of a sequence from one of the above GenBank entries.
- the E6 protein is a fragment of a variant of a sequence from one of the above GenBank entries. In another embodiment, the E6 protein is a fragment of an isomer of a sequence from one of the above GenBank entries.
- homoology refers to identity to an LLO sequence (e.g. to one of SEQ ID No: 2-4) of greater than 60%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 2-4 of greater than 64%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 2-4 of greater than 68%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 2-4 of greater than 72%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 2-4 of greater than 75%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 2-4 of greater than 78%.
- “homology” refers to identity to one of SEQ ID No: 2-4 of greater than 80%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 2-4 of greater than 82%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 2-4 of greater than 83%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 2-4 of greater than 85%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 2-4 of greater than 87%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 2-4 of greater than 88%.
- “homology” refers to identity to one of SEQ ID No: 2-4 of greater than 90%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 2-4 of greater than 92%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 2-4 of greater than 93%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 2-4 of greater than 95%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 2-4 of greater than 96%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 2-4 of greater than 97%.
- homology refers to identity to one of SEQ ID No: 2-4 of greater than 98%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 2-4 of greater than 99%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 2-4 of 100%.
- “homology” refers to identity to an E7 sequence (e.g. to one of SEQ ID No: 13-14) of greater than 60%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 13-14 of greater than 62%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 13-14 of greater than 64%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 13-14 of greater than 68%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 13-14 of greater than 72%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 13-14 of greater than 75%.
- “homology” refers to identity to one of SEQ ID No: 13-14 of greater than 78%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 13-14 of greater than 80%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 13-14 of greater than 82%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 13-14 of greater than 83%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 13-14 of greater than 85%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 13-14 of greater than 87%.
- “homology” refers to identity to one of SEQ ID No: 13-14 of greater than 88%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 13-14 of greater than 90%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 13-14 of greater than 92%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 13-14 of greater than 93%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 13-14 of greater than 95%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 13-14 of greater than 96%.
- “homology” refers to identity to one of SEQ ID No: 13-14 of greater than 97%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 13-14 of greater than 98%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 13-14 of greater than 99%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 13-14 of 100%. Each possibility represents a separate embodiment of the present invention.
- “homology” refers to identity to an E6 sequence (e.g. to one of SEQ ID No: 15-16) of greater than 60%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 15-16 of greater than 64%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 15-16 of greater than 68%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 15-16 of greater than 72%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 15-16 of greater than 75%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 15-16 of greater than 78%.
- “homology” refers to identity to one of SEQ ID No: 15-16 of greater than 80%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 15-16 of greater than 82%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 15-16 of greater than 83%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 15-16 of greater than 85%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 15-16 of greater than 87%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 15-16 of greater than 88%.
- “homology” refers to identity to one of SEQ ID No: 15-16 of greater than 90%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 15-16 of greater than 92%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 15-16 of greater than 93%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 15-16 of greater than 95%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 15-16 of greater than 96%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 15-16 of greater than 97%.
- homology refers to identity to one of SEQ ID No: 15-16 of greater than 98%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 15-16 of greater than 99%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 15-16 of 100%.
- homology refers to identity to a PEST amino acid sequence (e.g. to one of SEQ ID No: 1, and 7-12) or to an ActA sequence (e.g. to one of SEQ ID No: 5- 6) of greater than 60%.
- “homology” refers to identity to one of SEQ ID No: 1, and 7-12 or SEQ ID No: 5-6 of greater than 60%.
- “homology” refers to identity to one of SEQ ID No: 1, and 7-12 or SEQ ID No: 5-6 of greater than 64%.
- homoology refers to identity to one of SEQ ID No: 1, and 7-12 or SEQ ID No: 5-6 of greater than 68%.
- “homology” refers to identity to one of SEQ ID No: 1, and 7-12 or SEQ ID No: 5-6 of greater than 72%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 1, and 7-12 or SEQ ID No: 5-6 of greater than 75%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 1, and 7-12 or SEQ ID No: 5-6 of greater than 78%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 1, and 7-12 or SEQ ID No: 5-6 of greater than 80%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 1, and 7-12 or SEQ ID No: 5-6 of greater than 82%.
- “homology” refers to identity to one of SEQ ID No: 1, and 7-12 or SEQ ID No: 5-6 of greater than 83%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 1, and 7-12 or SEQ ID No: 5-6 of greater than 85%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 1, and 7-12 or SEQ ID No: 5-6 of greater than 87%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 1, and 7-12 or SEQ ID No: 5-6 of greater than 88%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 1, and 7-12 or SEQ ID No: 5-6 of greater than 90%.
- “homology” refers to identity to one of SEQ ID No: 1, and 7-12 or SEQ ID No: 5-6 of greater than 92%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 1, and 7-12 or SEQ ID No: 5-6 of greater than 93%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 1, and 7-12 or SEQ ID No: 5-6 of greater than 95%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 1, and 7-12 or SEQ ID No: 5-6 of greater than 96%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 1, and 7-12 or SEQ ID No: 5-6 of greater than 97%.
- “homology” refers to identity to one of SEQ ID No: 1, and 7-12 or SEQ ID No: 5-6 of greater than 98%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 1, and 7-12 or SEQ ID No: 5-6 of greater than 99%. In another embodiment, “homology” refers to identity to one of SEQ ID No: 1, and 7-12 or SEQ ID No: 5-6 of 100%. Each possibility represents a separate embodiment of the present invention.
- Protein and/or peptide homology for any AA sequence listed herein is determined, in one embodiment, by methods well described in the art, including immunoblot analysis, or via computer algorithm analysis of AA sequences, utilizing any of a number of software packages available, via established methods. Some of these packages include the FASTA, BLAST, MPsrch or Scanps packages, and employ, in other embodiments, the use of the Smith and Waterman algorithms, and/or global/local or BLOCKS alignments for analysis, for example. Each method of determining homology represents a separate embodiment of the present invention.
- the LLO protein, ActA protein, or fragment thereof is attached to the antigen by chemical conjugation.
- glutaraldehyde is used for the conjugation.
- the conjugation is performed using any suitable method known in the art. Each possibility represents another embodiment of the present invention.
- fusion proteins of the present invention are prepared by any suitable method, including, for example, cloning and restriction of appropriate sequences or direct chemical synthesis by methods discussed below.
- subsequences are cloned and the appropriate subsequences cleaved using appropriate restriction enzymes. The fragments are then ligated, in another embodiment, to produce the desired DNA sequence.
- DNA encoding the fusion protein is produced using DNA amplification methods, for example polymerase chain reaction (PCR). First, the segments of the native DNA on either side of the new terminus are amplified separately.
- the 5' end of the one amplified sequence encodes the peptide linker, while the 3' end of the other amplified sequence also encodes the peptide linker. Since the 5' end of the first fragment is complementary to the 3' end of the second fragment, the two fragments (after partial purification, e.g. on LMP agarose) can be used as an overlapping template in a third PCR reaction.
- the amplified sequence will contain codons, the segment on the carboxy side of the opening site (now forming the amino sequence), the linker, and the sequence on the amino side of the opening site (now forming the carboxyl sequence).
- the insert is then ligated into a plasmid.
- the LLO protein, ActA protein, or fragment thereof and the antigen, or fragment thereof are conjugated by a means known to those of skill in the art.
- the antigen, or fragment thereof is conjugated, either directly or through a linker (spacer), to the ActA protein or LLO protein.
- the chimeric molecule is recombinantly expressed as a single-chain fusion protein.
- a fusion peptide of the present invention is synthesized using standard chemical peptide synthesis techniques.
- the chimeric molecule is synthesized as a single contiguous polypeptide.
- the LLO protein, ActA protein, or fragment thereof; and the antigen, or fragment thereof are synthesized separately, then fused by condensation of the amino terminus of one molecule with the carboxyl terminus of the other molecule, thereby forming a peptide bond.
- the ActA protein or LLO protein and antigen are each condensed with one end of a peptide spacer molecule, thereby forming a contiguous fusion protein.
- the peptides and proteins of the present invention are prepared by solid-phase peptide synthesis (SPPS) as described by Stewart et al. in Solid Phase Peptide Synthesis, 2nd Edition, 1984, Pierce Chemical Company, Rockford, 111.; or as described by Bodanszky and Bodanszky (The Practice of Peptide Synthesis, 1984, Springer- Verlag, New York).
- SPPS solid-phase peptide synthesis
- a suitably protected AA residue is attached through its carboxyl group to a derivatized, insoluble polymeric support, such as cross-linked polystyrene or polyamide resin.
- “Suitably protected” refers to the presence of protecting groups on both the alpha-amino group of the amino acid, and on any side chain functional groups. Side chain protecting groups are generally stable to the solvents, reagents and reaction conditions used throughout the synthesis, and are removable under conditions which will not affect the final peptide product. Stepwise synthesis of the oligopeptide is carried out by the removal of the N- protecting group from the initial AA, and couple thereto of the carboxyl end of the next AA in the sequence of the desired peptide. This AA is also suitably protected.
- the carboxyl of the incoming AA can be activated to react with the N-terminus of the support-bound AA by formation into a reactive group such as formation into a carbodiimide, a symmetric acid anhydride or an "active ester” group such as hydroxybenzotriazole or pentafluorophenly esters.
- compositions containing vaccines and compositions of the present invention are, in another embodiment, administered to a subject by any method known to a person skilled in the art, such as parenterally, paracancerally, transmucosally, transdermally, intramuscularly, intravenously, intra-dermally, subcutaneously, intra-peritonealy, intra- ventricularly, intra-cranially, intra-vaginally or intra-tumorally.
- the vaccines or compositions are administered orally, and are thus formulated in a form suitable for oral administration, i.e. as a solid or a liquid preparation.
- suitable solid oral formulations include tablets, capsules, pills, granules, pellets and the like.
- Suitable liquid oral formulations include solutions, suspensions, dispersions, emulsions, oils and the like.
- the active ingredient is formulated in a capsule.
- the compositions of the present invention comprise, in addition to the active compound and the inert carrier or diluent, a hard gelating capsule.
- the vaccines or compositions are administered by intravenous, intra-arterial, or intra-muscular injection of a liquid preparation.
- suitable liquid formulations include solutions, suspensions, dispersions, emulsions, oils and the like.
- the pharmaceutical compositions are administered intravenously and are thus formulated in a form suitable for intravenous administration.
- the pharmaceutical compositions are administered intra- arterially and are thus formulated in a form suitable for intra- arterial administration.
- the pharmaceutical compositions are administered intra-muscularly and are thus formulated in a form suitable for intra-muscular administration.
- treating may encompass both therapeutic treatment and prophylactic or preventative measures, wherein the object is to prevent or lessen the targeted pathologic condition or disorder as described herein.
- treating may include directly affecting or curing, suppressing, inhibiting, preventing, reducing the severity of, delaying the onset of, reducing symptoms associated with the disease, disorder or condition, or a combination thereof.
- "treating" may encompass inter alia delaying progression, expediting remission, inducing remission, augmenting remission, speeding recovery, increasing efficacy of or decreasing resistance to alternative therapeutics, or a combination thereof.
- preventing or “impeding” may encompass, inter alia, delaying the onset of symptoms, preventing relapse to a disease, decreasing the number or frequency of relapse episodes, increasing latency between symptomatic episodes, or a combination thereof.
- “suppressing” or “inhibiting” may encompass, inter alia, reducing the severity of symptoms, reducing the severity of an acute episode, reducing the number of symptoms, reducing the incidence of disease-related symptoms, reducing the latency of symptoms, ameliorating symptoms, reducing secondary symptoms, reducing secondary infections, prolonging patient survival, or a combination thereof.
- symptoms are primary, while in another embodiment, symptoms are secondary.
- primary refers to a symptom that is a direct result of a particular disease or disorder
- secondary refers to a symptom that is derived from or consequent to a primary cause.
- the compounds for use in the present invention treat primary or secondary symptoms or secondary complications.
- symptoms may be any manifestation of a disease or pathological condition.
- the present invention provides a kit comprising vaccine of the present invention, an applicator, and instructional material that describes use of the methods of the invention.
- kit kits are described below, the contents of other useful kits will be apparent to the skilled artisan in light of the present disclosure. Each of these kits represents a separate embodiment of the present invention.
- the term “subject” can encompass a mammal including an adult human or a human child, teenager or adolescent in need of therapy for, or susceptible to, a condition or its sequelae, and also may include non-human mammals such as dogs, cats, pigs, cows, sheep, goats, horses, rats, and mice. It will also be appreciated that the term may encompass livestock. The term “subject” does not exclude an individual that is normal in all respects.
- mammal for purposes of treatment refers to any animal classified as a mammal, including, but not limited to, humans, domestic and farm animals, and zoo, sports, or pet animals, such as canines, including dogs, and horses, cats, cattle, pigs, sheep, etc.
- TC-1 The C57BL/6 syngeneic TC-1 tumor was immortalized with HPV-16 E6 and E7 and transformed with the c-Ha-ras oncogene.
- TC-1 provided by T. C. Wu (Johns Hopkins University School of Medicine, Baltimore, MD) is a highly tumorigenic lung epithelial cell expressing low levels of with HPV-16 E6 and E7 and transformed with the c-Ha-ras oncogene.
- TC-1 was grown in RPMI 1640, 10% FCS, 2 mM L-glutamine, 100 U/ml penicillin, 100 ⁇ g/ml streptomycin, 100 ⁇ nonessential amino acids, 1 mM sodium pyruvate, 50 micromolar (mcM) 2-ME, 400 microgram (mcg)/ml G418, and 10% National Collection Type Culture-109 medium at 37° with 10% C0 2 .
- C3 is a mouse embryo cell from C57BL/6 mice immortalized with the complete genome of HPV 16 and transformed with pEJ- ras.
- EL-4/E7 is the thymoma EL-4 retrovirally transduced with E7.
- Listeria strains used were Lm-LLO-E7 (hly-E7 fusion gene in an episomal expression system; Figure 1A), Lm-E7 (single-copy E7 gene cassette integrated into Listeria genome), Lm-LLO-NP ("DP-L2028”; hly-NP fusion gene in an episomal expression system), and Lm- Gag ("ZY-18"; single-copy HIV-1 Gag gene cassette integrated into the chromosome).
- E7 was amplified by PCR using the primers 5'-GGCTCGAGCATGGAGATACACC-3' (SEQ ID No: 17; Xhol site is underlined) and 5'-GGGGACTAGTTTATGGTTTCTGAGAACA-3' (SEQ ID No: 18; Spel site is underlined) and ligated into pCR2.1 (Invitrogen, San Diego, CA). E7 was excised from pCR2.1 by Xhol/ Spel digestion and ligated into pGG-55.
- the hly- E7 fusion gene and the pluripotential transcription factor prfA were cloned into pAM401 , a multicopy shuttle plasmid (Wirth R et al, J Bacterid, 165: 831, 1986), generating pGG-55.
- the hly promoter drives the expression of the first 441 AA of the hly gene product, (lacking the hemolytic C-terminus, referred to below as "ALLO," and having the sequence set forth in SEQ ID No: 25), which is joined by the Xhol site to the E7 gene, yielding a hly-E7 fusion gene that is transcribed and secreted as LLO-E7.
- the prfA gene was PCR amplified using primers 5'- GACTACAAGGACGATGACCGACAAGTGATAACCCGGGATCTAAATAAATCCGTTT
- Lm- E7 was generated by introducing an expression cassette containing the hly promoter and signal sequence driving the expression and secretion of E7 into the orfZ domain of the LM genome. E7 was amplified by PCR using the primers 5'- GCGGATCCCATGGAGATACACCTAC-3' (SEQ ID No: 22; BamHI site is underlined) and 5'-GCTCTAGATTATGGTTTCTGAG-3' (SEQ ID No: 23; Xbal site is underlined).
- E7 was then ligated into the pZY-21 shuttle vector.
- LM strain 10403S was transformed with the resulting plasmid, pZY-21-E7, which includes an expression cassette inserted in the middle of a 1.6-kb sequence that corresponds to the orfX, Y, Z domain of the LM genome.
- the homology domain allows for insertion of the E7 gene cassette into the orfZ domain by homologous recombination.
- Clones were screened for integration of the E7 gene cassette into the orfZ domain.
- Bacteria were grown in brain heart infusion medium with (Lm-LLO-E7 and Lm-LLO-NP) or without (Lm-E7 and ZY-18) chloramphenicol (20 ⁇ g/ml). Bacteria were frozen in aliquots at -80°C. Expression was verified by Western blotting ( Figure 2).
- Listeria strains were grown in Luria-Bertoni medium at 37°C and were harvested at the same optical density measured at 600 nm. The supernatants were TCA precipitated and resuspended in lx sample buffer supplemented with 0.1 N NaOH. Identical amounts of each cell pellet or each TCA-precipitated supernatant were loaded on 4-20% Tris-glycine SDS- PAGE gels (NOVEX, San Diego, CA).
- the gels were transferred to polyvinylidene difluoride and probed with an anti-E7 monoclonal antibody (mAb) (Zymed Laboratories, South San Francisco, CA), then incubated with HRP-conjugated anti-mouse secondary Ab (Amersham Pharmacia Biotech, Little Chalfont, U.K.), developed with Amersham ECL detection reagents, and exposed to Hyperfilm (Amersham Pharmacia Biotech).
- mAb monoclonal antibody
- Tumors were measured every other day with calipers spanning the shortest and longest surface diameters. The mean of these two measurements was plotted as the mean tumor diameter in millimeters against various time points. Mice were sacrificed when the tumor diameter reached 20 mm. Tumor measurements for each time point are shown only for surviving mice.
- mice Six- to 8-wk-old C57BL/6 mice (Charles River) received 2 x 10 5 TC-1 cells s.c. on the left flank. One week following tumor inoculation, the tumors had reached a palpable size of 4-5 mm in diameter. Groups of eight mice were then treated with 0.1 LD5 0 i.p. Lm-LLO-E7 (10 7 CFU), Lm- E7 (10 6 CFU), Lm-LLO-NP (10 7 CFU), or Lm-Gag (5 x 10 5 CFU) on days 7 and 14.
- ILD 50 Lm-LLO-E7, Lm-E7, Lm-LLO-NP, or Lm-Gag.
- spleens were harvested.
- Splenocytes were established in culture with irradiated TC-1 cells (100: 1, splenocytes :TC-1) as feeder cells; stimulated in vitro for 5 days, then used in a standard 51 Cr release assay, using the following targets: EL-4, EL-4/E7, or EL-4 pulsed with E7 H-2b peptide (RAHYNIVTF).
- E:T cell ratios were 80: 1, 40: 1, 20: 1, 10: 1, 5: 1 , and 2.5:1. Following a 4-h incubation at 37°C, cells were pelleted, and 50 ⁇ supernatant was removed from each well. Samples were assayed with a Wallac 1450 scintillation counter (Gaithersburg, MD). The percent specific lysis was determined as [(experimental counts per minute (cpm)- spontaneous cpm)/(total cpm - spontaneous cpm)] x 100.
- C57BL/6 mice were immunized with 0.1 LD5 0 and boosted by i.p. injection 20 days later with 1 LD5 0 Lm-LLO-E7, Lm-E7, Lm-LLO-NP, or Lm-Gag.
- spleens were harvested from immunized and naive mice.
- Splenocytes were established in culture at 5 x 10 5 /well in flat-bottom 96- well plates with 2.5 x 10 4 , 1.25 x 10 4 , 6 x 10 3 , or 3 x 10 3 irradiated TC-1 cells/well as a source of E7 Ag, or without TC-1 cells or with 10 ⁇ g/ml Con A.
- C57BL/6 mice were immunized intravenously (i.v.) with 0.1 LD5 0 Lm-LLO-E7 or Lm-E7 and boosted 30 days later.
- Three-color flow cytometry for CD8 (53-6.7, PE conjugated), CD62 ligand (CD62L; MEL- 14, APC conjugated), and E7 H-2Db tetramer was performed using a FACSCalibur® flow cytometer with CellQuest® software (Becton Dickinson, Mountain View, CA).
- Splenocytes harvested 5 days after the boost were stained at room temperature (rt) with H-2Db tetramers loaded with the E7 peptide (RAHYNIVTF) or a control (HIV-Gag) peptide.
- Tetramers were used at a 1/200 dilution and were provided by Dr. Larry R. Pease (Mayo Clinic, Rochester, MN) and by the NIAID Tetramer Core Facility and the NIH AIDS Research and Reference Reagent Program. Tetramer + , CD8 + , CD62L low cells were analyzed.
- mice 24 C57BL/6 mice were inoculated with 5 x 10 5 B16F0-Ova cells. On days 3, 10 and 17, groups of 8 mice were immunized with 0.1 LD5 0 Lm-OVA (10 6 cfu), Lm-LLO-OVA (10 8 cfu) and eight animals were left untreated.
- Lm-E7 and Lm-LLO-E7 were compared for their abilities to impact on TC-1 growth.
- Subcutaneous tumors were established on the left flank of C57BL/6 mice. Seven days later tumors had reached a palpable size (4-5 mm).
- Mice were vaccinated on days 7 and 14 with 0.1 LD5 0 Lm-E7, Lm-LLO-E7, or, as controls, Lm-Gag and Lm-LLO-NP.
- Lm-LLO-E7 induced complete regression of 75% of established TC-1 tumors, while tumor growth was controlled in the other 2 mice in the group ( Figure 3). By contrast, immunization with Lm-E7 and Lm-Gag did not induce tumor regression.
- EXAMPLE 2 LM-LLO-E7 TREATMENT ELICITS TC-1 SPECIFIC SPLENOCYTE PROLIFERATION
- EXAMPLE 3 FUSION OF E7 TO LLP, ActA, OR A PEST AMINO ACID SEQUENCE ENHANCES E7-SPECIFIC IMMUNITY AND GENERATES TUMOR-INFILTRATING E7-SPECIFIC CD8 + CELLS MATERIALS AND EXPERIMENTAL METHODS
- PBS phosphate buffered saline
- MATRIGEL® BD Biosciences, Franklin Lakes, N.J.
- Tumors were minced with forceps, cut into 2 mm blocks, and incubated at 37 °C for 1 hour with 3 ml of enzyme mixture (0.2 mg/ml collagenase-P, 1 mg/ml DNAse-1 in PBS). The tissue suspension was filtered through nylon mesh and washed with 5% fetal bovine serum + 0.05% of NaN 3 in PBS for tetramer and IFN-gamma staining.
- Splenocytes and tumor cells were incubated with 1 micromole (mem) E7 peptide for 5 hours in the presence of brefeldin A at 10 7 cells/ml.
- Cells were washed twice and incubated in 50 mcl of anti-mouse Fc receptor supernatant (2.4 G2) for 1 hour or overnight at 4 °C.
- Cells were stained for surface molecules CD8 and CD62L, permeabilized, fixed using the permeabilization kit Golgi-stop® or Golgi-Plug® (Pharmingen, San Diego, Calif.), and stained for IFN-gamma.
- H-2D b tetramer was loaded with phycoerythrin (PE)-conjugated E7 peptide (RAHYNIVTF, SEQ ID NO: 24), stained at rt for 1 hour, and stained with anti- allophycocyanin (APC) conjugated MEL- 14 (CD62L) and FITC-conjugated CD8 + at 4 °C for 30 min.
- PE phycoerythrin
- APC anti- allophycocyanin conjugated MEL- 14
- CD8 + FITC-conjugated CD8 + at 4 °C for 30 min.
- mice were implanted with TC-1 tumor cells and immunized with either Lm-LLO-E7 (1 x 10 7 CFU), Lm-E7 (1 x 10 6 CFU), or Lm-ActA-E7 (2 x 10 8 CFU), or were untreated (naive).
- Tumors of mice from the Lm-LLO-E7 and Lm-ActA-E7 groups contained a higher percentage of IFN- gamma- secreting CD8 + T cells ( Figure 5A) and tetramer- specific CD8 + cells ( Figure 5B) than in Lm-E7 or naive mice.
- mice were administered Lm-LLO-E7, Lm- PEST-E7, Lm-APEST-E7, or Lm-E7epi, and levels of E7-specific lymphocytes within the tumor were measured.
- Mice were treated on days 7 and 14 with 0.1 LD5 0 of the 4 vaccines. Tumors were harvested on day 21 and stained with antibodies to CD62L, CD8, and with the E7/Db tetramer. An increased percentage of tetramer-positive lymphocytes within the tumor were seen in mice vaccinated with Lm-LLO-E7 and Lm-PEST-E7 (Figure 6A). This result was reproducible over three experiments ( Figure 6B).
- Lm-LLO-E7, Lm-ActA-E7, and Lm-PEST-E7 are each efficacious at induction of tumor-infiltrating CD8 + T cells and tumor regression.
- EXAMPLE 4 PASSAGING OF LISTERIA VACCINE VECTORS THROUGH MICE ELICITS INCREASED IMMUNE RESPONSES TO HETEROLOGOUS AND ENDOGENOUS ANTIGENS
- L. monocytogenes strain 10403S, serotype 1 was the wild type organism used in these studies and the parental strain of the constructs described below.
- Strain 10403S has an LD 50 of approximately 5 x 10 4 CFU when injected intraperitoneally into BALB/c mice.
- "Lm-Gag” is a recombinant LM strain containing a copy of the HIV-1 strain HXB (subtype B laboratory strain with a syncytia-forming phenotype) gag gene stably integrated into the Listeria ⁇ chromosome using a modified shuttle vector pKSV7. Gag protein was expressed and secreted by the strain, as determined by Western blot. All strains were grown in brain-heart infusion (BHI) broth or agar plates (Difco Labs, Detroit, Mich).
- Bacteria from a single clone expressing the passenger antigen and/or fusion protein were selected and cultured in BHI broth overnight. Aliquots of this culture were frozen at " 70°C with no additives. From this stock, cultures were grown to 0.1-0.2 O.D. at 600 nm, and aliquots were again frozen at -70°C with no additives. To prepare cloned bacterial pools, the above procedure was used, but after each passage a number of bacterial clones were selected and checked for expression of the target antigen, as described herein. Clones in which expression of the foreign antigen was confirmed were used for the next passage.
- mice 6-8 week old female BALB/c (H-2d) mice were purchased from Jackson Laboratories (Bar Harbor, Me) and were maintained in a pathogen-free microisolator environment. The titer of viable bacteria in an aliquot of stock culture, stored frozen at -70 °C, was determined by plating on BHI agar plates on thawing and prior to use. In all, 5 x 10 5 bacteria were injected intravenously into BALB/c mice. After 3 days, spleens were harvested, homogenized, and serial dilutions of the spleen homogenate were incubated in BHI broth overnight and plated on BHI agar plates.
- Lymphocytes were cultured for 5 hours in complete RPMI-10 medium supplemented with 50 U/ml human recombinant IL-2 and 1 microliter/ml Brefeldin A (GolgistopTM; PharMingen, San Diego, CA) in the presence or absence of either the cytotoxic T-cell (CTL) epitope for HIV-GAG (AMQMLKETI; SEQ ID No: 25), Listeria LLO (GYKDGNEYI; SEQ ID No: 26) or the HPV virus gene E7 (RAHYNIVTF) (SEQ ID No: 24), at a concentration of 1 micromole.
- This plasmid was used to complement a prfA negative mutant so that in a live host, selection pressures would favor conservation of the plasmid, because without it the bacterium is avirulent. All 3 constructs had been propagated extensively in vitro for many bacterial generations.
- L. monocytogenes strain XFL7 contains a 300 base pair deletion in the prfA gene XFL7 carries pGG55 which partially restores virulence and confers CAP resistance, and is described in United States Patent Application Publication No. 200500118184.
- the lysis solution was then incubated at 37°C for 15 minutes before neutralization. 3.
- the plasmid DNA was resuspended in 30 ⁇ rather than 50 ⁇ to increase the concentration.
- the cells were incubated for 15min in PI buffer + Lysozyme, then incubated with P2 (lysis buffer) and P3 (neutraliztion buffer) at room temperature.
- the genetic stability i.e. the extent to which the plasmid is retained by or remains stably associated with the bacteria in the absence of selection pressure; e.g. antibiotic selection pressure
- L. monocytogenes strain XFL7 was assessed by serial sub-culture in both Luria-Bertani media (LB: 5 g/L NaCl, 10 g/ml soy peptone, 5 g/L yeast extract) and Terrific Broth media (TB: 10 g/L glucose, 11.8 g/L soy peptone, 23.6 g/L yeast extract, 2.2 g/L KH 2 P0 4 , 9.4 g/L K 2 HP0 4 ), in duplicate cultures.
- Luria-Bertani media LB: 5 g/L NaCl, 10 g/ml soy peptone, 5 g/L yeast extract
- TB 10 g/L glucose, 11.8 g/L soy peptone, 23.6 g/L yeast extract, 2.2 g
- plasmid DNA was subjected to agarose gel electrophoresis, followed by ethidium bromide staining. While the amount of plasmid in the preps varied slightly between samples, the overall trend was a constant amount of plasmid with respect to the generational number of the bacteria ( Figures 9A-B). Thus, pGG55 exhibited stability in strain XFL7, even in the absence of antibiotic.
- Plasmid stability was also monitored during the stability study by replica plating on agar plates at each stage of the subculture. Consistent with the results from the agarose gel electrophoresis, there was no overall change in the number of plasmid-containing cells throughout the study in either LB or TB liquid culture ( Figures 10 and 11, respectively).
- the primers used for amplification of the prfA gene and discrimination of the D133V mutation are shown in Table 1.
- Stock solutions of the primers ADV451, 452 and 453 were prepared by diluting the primers in TE buffer to 400 ⁇ . An aliquot of the stock solution was further diluted to 20 ⁇ in water (PCR grade) to prepare a working solution. Primers were stored at -20°C. The reagents used in the PCR are shown in Table 2.
- pGG55 plasmids with (pGG55 D133V) and without (pGG55 WT) the prfA mutation were extracted and purified by midipreparations either from E. coli or Listeria monocytogenes using the PureLinkTM HiPure Plasmid Midiprep Kit (Invitrogen, K2100-05), according to the manufacturer's instructions.
- midipreparations either from E. coli or Listeria monocytogenes using the PureLinkTM HiPure Plasmid Midiprep Kit (Invitrogen, K2100-05), according to the manufacturer's instructions.
- plasmid purification from Listeria bacterial strains carrying the pGG55 D133V or WT plasmids were streak plated from frozen stocks in BHI agar plates supplemented with chloramphenicol (25 ⁇ g/ml).
- a single colony from each strain was grown in 5 ml of selective medium (BHI broth with 25 ⁇ g/ml of chloramphenicol) for 6 hours with vigorous shaking at 37°C and subinoculated 1 :500 in 100 ml of selective medium for overnight growth under similar conditions.
- Bacteria from the overnight culture were harvested by centrifugation at 4,000 x g for 10 minutes and resuspended buffer R3 (resuspension buffer) containing 2 mg/ml of lysozyme (Sigma, L7001). The bacteria suspension was incubated for at least 1 hour at 37 °C before proceeding to the regular protocol.
- Concentration and purity of the eluted plasmids were measured in a spectrophotometer at 260nm and 280nm.
- the pGG55 D133V and WT plasmids were resuspended in water to a final concentration of 1 ng/ ⁇ from the midiprep stock solution.
- serial 10-fold dilutions from the 1 ng/ ⁇ solution were prepared, corresponding to dilutions from 10 "1 to 10 "7 . prfA specific PCR protocol to test clinical grade material
- the reaction mixture contained lx PCR buffer, 1.5 mM MgCl 2 , 0.8 mM dNTPs, 0.4 ⁇ of each primer, 0.05 U/ ⁇ of Taq DNA polymerase and 0.04 ng/ ⁇ of the pGG55 D133V template plasmid.
- 10 tubes were required and the key components in each tube in a 25 ⁇ reaction are shown in the Table 3.
- a master mix was prepared with enough reagents for 11 reactions as shown in Table 4, and 24 ⁇ of this PCR mix was added to each tube.
- Table 3 Set of individual PCR reactions to validate the method to detect the presence of wild-type prfA sequence in Lm-LLO-E7 samples.
- dNTPs Deoxynucleo tides
- Table 5 PCR protocol for validation of the method to detect the presence of wild-type prfA sequence using primers ADV451, 452 and 453.
- Deoxynucleotides mix (dATP, dCTP, dGTP and dTTP) 0.5 ⁇
- Primer ADV452 (20 ⁇ ) 0.5 ⁇
- Primer ADV453 (20 ⁇ ) 0.5 ⁇
- a pGG55 WT (1 ng in tube 3; 100 pg in tube 4; 10 pg in tube 5; 1 pg in tube 6; 100 fg in tube 7; 10 fg in tube 8; 1 fg in tube 9; 0.1 fg in tube 10).
- tube 1 In tube 1, add 0.5 ⁇ of water and 0.5 ⁇ of primer ADV451 (20 ⁇ stock); in tube 2 add 1 ⁇ of water.
- Sequencing of the plasmids was done using the dideoxy sequencing method.
- the plasmids pGG55 D133V and pGG55 WT were mixed at different ratios (1 : 1 , 1 : 10, 1 ; 100, 1 :1 ,000 and 1 : 10,000).
- the total amount of plasmid in the mixture was kept constant (500 ⁇ g) and the plasmid containing the wild- type sequence was 10-fold serially diluted in relation to the D133V plasmid to determine the sensitivity of the method.
- EXAMPLE 6 SEQUENCING IS NOT A SENSITIVE METHOD TO DETECT THE REVERSION OF THE D133V MUTATION.
- EXAMPLE 7 DEVELOPMENT OF A HIGHLY SPECIFIC AND SENSITIVE PCR METHOD TO DETECT REVERSION OF THE D133V MUTATION.
- the ADV453 primer is the reverse primer located approximately 300 bp downstream the annealing site of the ADV451 and ADV452 primers ( Figure 13).
- the expected PCR band obtained with the primers ADV451 or ADV452 and ADV453 is 326 bp.
- the ADV451 primer should only amplify the pGG55 D133V plasmid, whereas the ADV452 would be specific to the wild-type prfA sequence.
- EXAMPLE 8 SPECIFICITY OF THE PCR METHOD.
- the sensitivity of the reaction was tested using 1 ng of template DNA.
- decreasing amounts of DNA corresponding to 10-fold dilutions from 10 "1 to 10 "7 ), were also included in the reaction to estimate the sensitivity.
- the primers ADV452 and ADV453 were used.
- the sensitivity of the method was 1 in 100,000 (data not shown). As shown in figure 5, increasing the number of PCR cycles to 37 improved the visual sensitivity of the method to 10 "6 for the detection of D133V revertants, without significantly compromising the specificity.
- This strain is approx. 4 -5 logs more attenuated than the wild-type parent strain 10403S and secretes the fusion protein tLLO-E7.
- This immunotherapy is based on the backbone XFL7, which is derived from 10403S by the irreversible deletion in the virulence gene transcription activator prfA.
- PrfA regulates the transcription of several virulence genes such as Listeriolysin O (LLO), ActA, PlcA (phospholipase A), PlcB (phospholipase B) etc that are required for in vivo intracellular growth and survival of L. monocytogenes.
- the plasmid pGG55 is retained by the Lm-LLO-E7 in vitro by means of selection with 'chloramphenicol' .
- Lm-LLO-E7 carries a copy of mutated prfA (D133V), which has been demonstrated to be less active than wild-type PrfA in DNA binding and activating the transcription of virulence genes.
- mutated prfA D133V
- complementation with mutated prfA resulted in approx. 40 fold reduction in the amount of secreted LLO from Lm-LLO-E7 when compared to wild- type strain 10403S.
- strain Lm-LLO-E7 likely exhibits a reduced expression of the virulence genes that are regulated by PrfA such as actA, inlA, MB, inlC, plcB etc.
- PrfA such as actA, inlA, MB, inlC, plcB etc.
- the complementation with mutated copy of prfA likely causes a reduction in the expression of different virulence genes that are regulated by PrfA resulting in overall attenuation of approx. 4-5 logs.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Microbiology (AREA)
- Immunology (AREA)
- Biochemistry (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Virology (AREA)
- Biotechnology (AREA)
- Biophysics (AREA)
- Molecular Biology (AREA)
- Epidemiology (AREA)
- Mycology (AREA)
- General Engineering & Computer Science (AREA)
- Biomedical Technology (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Oncology (AREA)
- Tropical Medicine & Parasitology (AREA)
- Cell Biology (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Endocrinology (AREA)
- Reproductive Health (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Priority Applications (14)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| RU2016145464A RU2016145464A (ru) | 2014-04-24 | 2015-04-14 | Рекомбинантные вакцинные штаммы listeria и способы их получения |
| CN201580021074.6A CN106459887A (zh) | 2014-04-24 | 2015-04-14 | 重组李斯特菌疫苗菌株及其制备方法 |
| CA2946716A CA2946716A1 (en) | 2014-04-24 | 2015-04-14 | Recombinant listeria vaccine strains and methods of producing the same |
| KR1020167029990A KR102359691B1 (ko) | 2014-04-24 | 2015-04-14 | 재조합 리스테리아 백신 균주 및 그 생산 방법 |
| AU2015250111A AU2015250111A1 (en) | 2014-04-24 | 2015-04-14 | Recombinant listeria vaccine strains and methods of producing the same |
| US15/306,289 US10258679B2 (en) | 2014-04-24 | 2015-04-14 | Recombinant Listeria vaccine strains and methods of producing the same |
| EP15782800.5A EP3134510B1 (en) | 2014-04-24 | 2015-04-14 | Recombinant listeria vaccine strains and methods of producing the same |
| BR112016024352-8A BR112016024352A2 (pt) | 2014-04-24 | 2015-04-14 | ?cepa de listeria recombinante, listeria recombinante, composição farmacêutica, e, métodos de induzir uma resposta imune contra um tumor ou um câncer em um indivíduo humano e de listeria? |
| MX2016013985A MX2016013985A (es) | 2014-04-24 | 2015-04-14 | Cepas de vacunas de listeria recombinante y metodos para producir las mismas. |
| KR1020227003655A KR102491332B1 (ko) | 2014-04-24 | 2015-04-14 | 재조합 리스테리아 백신 균주 및 그 생산 방법 |
| SG11201608820WA SG11201608820WA (en) | 2014-04-24 | 2015-04-14 | Recombinant listeria vaccine strains and methods of producing the same |
| JP2016564032A JP7009061B2 (ja) | 2014-04-24 | 2015-04-14 | 組み換え型リステリアワクチン株およびこれを生産する方法 |
| IL248483A IL248483A0 (en) | 2014-04-24 | 2016-10-25 | Different strains of Listeria recombinant vaccines and methods for their production |
| US16/276,520 US20190240303A1 (en) | 2014-04-24 | 2019-02-14 | Recombinant listeria vaccine strains and methods of producing the same |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201461983732P | 2014-04-24 | 2014-04-24 | |
| US61/983,732 | 2014-04-24 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/306,289 A-371-Of-International US10258679B2 (en) | 2014-04-24 | 2015-04-14 | Recombinant Listeria vaccine strains and methods of producing the same |
| US16/276,520 Continuation US20190240303A1 (en) | 2014-04-24 | 2019-02-14 | Recombinant listeria vaccine strains and methods of producing the same |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2015164121A1 true WO2015164121A1 (en) | 2015-10-29 |
Family
ID=54333010
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2015/025690 Ceased WO2015164121A1 (en) | 2014-04-24 | 2015-04-14 | Recombinant listeria vaccine strains and methods of producing the same |
Country Status (15)
| Country | Link |
|---|---|
| US (2) | US10258679B2 (enExample) |
| EP (1) | EP3134510B1 (enExample) |
| JP (3) | JP7009061B2 (enExample) |
| KR (2) | KR102491332B1 (enExample) |
| CN (1) | CN106459887A (enExample) |
| AU (1) | AU2015250111A1 (enExample) |
| BR (1) | BR112016024352A2 (enExample) |
| CA (1) | CA2946716A1 (enExample) |
| IL (1) | IL248483A0 (enExample) |
| MA (1) | MA39849A (enExample) |
| MX (1) | MX2016013985A (enExample) |
| RU (1) | RU2016145464A (enExample) |
| SG (2) | SG11201608820WA (enExample) |
| TW (2) | TWI722858B (enExample) |
| WO (1) | WO2015164121A1 (enExample) |
Cited By (13)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2016061277A1 (en) * | 2014-10-14 | 2016-04-21 | The Trustees Of The University Of Pennsylvania | Recombinant listeria vaccine strains and methods of using the same in cancer immunotherapy |
| CN106978381A (zh) * | 2017-03-23 | 2017-07-25 | 上海理工大学 | prfA基因缺失单核细胞增生李斯特氏菌及制备方法 |
| US10058599B2 (en) | 2012-03-12 | 2018-08-28 | Advaxis, Inc. | Suppressor cell function inhibition following Listeria vaccine treatment |
| US10064898B2 (en) | 2011-03-11 | 2018-09-04 | Advaxis, Inc. | Listeria-based adjuvants |
| US10143734B2 (en) | 2014-02-18 | 2018-12-04 | Advaxis, Inc. | Biomarker directed multi-target immunotherapy |
| US10258679B2 (en) | 2014-04-24 | 2019-04-16 | Advaxis, Inc. | Recombinant Listeria vaccine strains and methods of producing the same |
| WO2019086507A1 (en) | 2017-10-31 | 2019-05-09 | Pantarhei Bioscience B.V. | Immunotherapeutic methods for treating and/or preventing lung cancer |
| US10900044B2 (en) | 2015-03-03 | 2021-01-26 | Advaxis, Inc. | Listeria-based compositions comprising a peptide minigene expression system and methods of use thereof |
| US11179339B2 (en) | 2017-09-19 | 2021-11-23 | Advaxis, Inc. | Compositions and methods for lyophilization of bacteria or listeria strains |
| WO2021259963A1 (en) | 2020-06-23 | 2021-12-30 | Pandora Endocrine Innovation B.V. | Immunization against wnt4 for treatment and prophylaxis of breast cancer |
| US11446369B2 (en) | 2007-05-10 | 2022-09-20 | Advaxis, Inc. | Compositions and methods comprising KLK3 or FOLH1 antigen |
| WO2023066923A1 (en) | 2021-10-19 | 2023-04-27 | Rahman Nafis | Male contraception |
| US11897927B2 (en) | 2016-11-30 | 2024-02-13 | Advaxis, Inc. | Immunogenic compositions targeting recurrent cancer mutations and methods of use thereof |
Families Citing this family (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20170199961A1 (en) | 2015-12-16 | 2017-07-13 | Gritstone Oncology, Inc. | Neoantigen Identification, Manufacture, and Use |
| ES3029080T3 (en) | 2017-10-10 | 2025-06-23 | Seattle Project Corp | Neoantigen identification using hotspots |
| US11885815B2 (en) | 2017-11-22 | 2024-01-30 | Gritstone Bio, Inc. | Reducing junction epitope presentation for neoantigens |
| EP3762719A1 (en) * | 2018-03-09 | 2021-01-13 | Advaxis, Inc. | Compositions and methods for evaluating attenuation and infectivity of listeria strains |
| CN110408634B (zh) | 2018-04-27 | 2021-08-03 | 苏州若泰医药科技有限公司 | 一种非整合李斯特菌疫苗及抗肿瘤免疫应答方法 |
| US10973908B1 (en) | 2020-05-14 | 2021-04-13 | David Gordon Bermudes | Expression of SARS-CoV-2 spike protein receptor binding domain in attenuated salmonella as a vaccine |
| US12537071B1 (en) | 2020-07-22 | 2026-01-27 | David Gordon Bermudes | Bacteria having boolean control pathways expressing therapeutic proteins including immunotherapeutic cytotoxins |
| CN116218754B (zh) * | 2023-04-10 | 2025-06-03 | 四川大学 | 一种提高绵羊李斯特菌膜囊泡产量的方法及应用 |
| CN119060155B (zh) * | 2024-11-07 | 2025-03-07 | 山东大学 | 一种蛋白在调节肠道稳态及抵抗致病菌感染中的应用 |
Citations (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20040013690A1 (en) | 2002-05-29 | 2004-01-22 | Portnoy Daniel A. | Attenuated Listeria spp. and methods for using the same |
| US20050048081A1 (en) | 1997-11-18 | 2005-03-03 | The Trustees Of The University Of Pennsylvania | Immunogenic compositions comprising DAL/DAT double mutant, auxotrophic attenuated strains of listeria and their mehods of use |
| US20050118184A1 (en) | 2000-03-29 | 2005-06-02 | Trustees Of The University Of Pennsylvania | Compositions and methods for enhancing the immunogenicity of antigens |
| US20070207170A1 (en) | 2006-03-01 | 2007-09-06 | Cerus Corporation | Engineered Listeria and methods of use thereof |
| US7794729B2 (en) * | 1994-11-08 | 2010-09-14 | The Trustees Of The University Of Pennsylvania | Methods and compositions for immunotherapy of cancer |
| US20110142791A1 (en) | 2009-11-11 | 2011-06-16 | Vafa Shahabi | Compositions and methods for prevention of escape mutation in the treatment of her2/neu over-expressing tumors |
| US8114414B2 (en) | 1994-11-08 | 2012-02-14 | The Trustees Of The University Of Pennsylvania | Compositions and methods for treatment of cervical cancer |
| WO2012125551A1 (en) * | 2011-03-11 | 2012-09-20 | Advaxis | Listeria-based adjuvants |
Family Cites Families (65)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5830702A (en) | 1990-10-31 | 1998-11-03 | The Trustees Of The University Of Pennsylvania | Live, recombinant listeria monocytogenes and production of cytotoxic T-cell response |
| US7662396B2 (en) * | 2001-03-26 | 2010-02-16 | The Trustees Of The University Of Pennsylvania | Compositions and methods for enhancing the immunogenicity of antigens |
| US20070264279A1 (en) * | 1994-11-08 | 2007-11-15 | Claudia Gravekamp | Compositions and methods comprising a MAGE-b antigen |
| US8791237B2 (en) | 1994-11-08 | 2014-07-29 | The Trustees Of The University Of Pennsylvania | Compositions and methods for treatment of non-hodgkins lymphoma |
| US7820180B2 (en) | 2004-09-24 | 2010-10-26 | The Trustees Of The University Of Pennsylvania | Listeria-based and LLO-based vaccines |
| US6051237A (en) | 1994-11-08 | 2000-04-18 | The Trustees Of The University Of Pennsylvania | Specific immunotherapy of cancer using a live recombinant bacterial vaccine vector |
| US8956621B2 (en) | 1994-11-08 | 2015-02-17 | The Trustees Of The University Of Pennsylvania | Compositions and methods for treatment of cervical dysplasia |
| US9012141B2 (en) | 2000-03-27 | 2015-04-21 | Advaxis, Inc. | Compositions and methods comprising KLK3 of FOLH1 antigen |
| US6855320B2 (en) | 2000-03-29 | 2005-02-15 | The Trustees Of The University Of Pennsylvania | Fusion of non-hemolytic, truncated form of listeriolysin O to antigens to enhance immunogenicity |
| US8771702B2 (en) | 2001-03-26 | 2014-07-08 | The Trustees Of The University Of Pennsylvania | Non-hemolytic LLO fusion proteins and methods of utilizing same |
| US7700344B2 (en) | 2001-03-26 | 2010-04-20 | The Trustees Of The University Of Pennsylvania | Compositions and methods for enhancing the immunogenicity of antigens |
| CA2512812A1 (en) | 2003-01-09 | 2004-07-29 | The Trustees Of The University Of Pennsylvania | Compositions, methods and kits for enhancing the immunogenicity of a bacterial vaccine vector |
| US7858097B2 (en) * | 2004-08-13 | 2010-12-28 | The Trustees Of The University Of Pennsylvania | Antibiotic resistance free Listeria strains and methods for constructing and using same |
| PT2942391T (pt) * | 2004-08-13 | 2018-10-09 | Univ Pennsylvania | Métodos de produção de vacinas não resistentes aos antibióticos |
| US7855064B2 (en) | 2004-08-13 | 2010-12-21 | The Trustees Of The University Of Pennsylvania | Antibiotic resistance free vaccines and methods for constructing and using same |
| CA2584130A1 (en) * | 2004-10-18 | 2006-04-27 | Medimmune, Inc. | High cell density process for growth of listeria |
| US8241636B2 (en) | 2006-08-15 | 2012-08-14 | The Trustees Of The University Of Pennsylvania | Compositions comprising HMW-MAA and fragments thereof, and methods of use thereof |
| US8268326B2 (en) | 2006-08-15 | 2012-09-18 | The Trustees Of The University Of Pennsylvania | Compositions comprising HMW-MAA and fragments thereof, and methods of use thereof |
| EP2147092A4 (en) | 2007-04-16 | 2010-06-09 | Univ Pennsylvania | ANTIBIOTIC RESISTANCE-FREE LISTERIA TRIBES AND METHOD OF CONSTRUCTING AND USING THEREOF |
| WO2009143167A2 (en) | 2008-05-19 | 2009-11-26 | Advaxis | Dual delivery system for heterologous antigens |
| US20140234370A1 (en) | 2009-11-11 | 2014-08-21 | Advaxis, Inc. | Compositions and methods for prevention of escape mutation in the treatment of her2/neu over-expressing tumors |
| US20120135033A1 (en) | 2008-05-19 | 2012-05-31 | Anu Wallecha | Multiple delivery system for heterologous antigens |
| US9650639B2 (en) | 2008-05-19 | 2017-05-16 | Advaxis, Inc. | Dual delivery system for heterologous antigens |
| US9017660B2 (en) | 2009-11-11 | 2015-04-28 | Advaxis, Inc. | Compositions and methods for prevention of escape mutation in the treatment of Her2/neu over-expressing tumors |
| US20150366955A9 (en) | 2009-11-11 | 2015-12-24 | Advaxis, Inc. | Compositions and methods for prevention of escape mutation in the treatment of her2/neu over-expressing tumors |
| CA2724649A1 (en) * | 2008-05-19 | 2009-11-26 | Anza Therapeutics, Inc. | Compositions comprising prfa* mutant listeria and methods of use thereof |
| KR20110045010A (ko) * | 2008-07-24 | 2011-05-03 | 아두로 바이오테크 | C형 간염의 치료를 위한 조성물 및 방법 |
| JP5539411B2 (ja) | 2009-03-04 | 2014-07-02 | ザ トラスティーズ オブ ザ ユニバーシティ オブ ペンシルバニア | 血管新生因子を含む組成物およびその使用方法 |
| US10016617B2 (en) | 2009-11-11 | 2018-07-10 | The Trustees Of The University Of Pennsylvania | Combination immuno therapy and radiotherapy for the treatment of Her-2-positive cancers |
| US20110223187A1 (en) | 2010-02-15 | 2011-09-15 | Vafa Shahabi | Live listeria-based vaccines for central nervous system therapy |
| US20110305724A1 (en) | 2010-04-19 | 2011-12-15 | Yvonne Paterson | Immunotherapeutic, anti-tumorigenic compositions and methods of use thereof |
| CN107412756A (zh) | 2010-10-01 | 2017-12-01 | 宾夕法尼亚大学理事会 | 李斯特菌疫苗载体用于在寄生虫感染的个体中扭转免疫无应答的用途 |
| SI2640842T1 (sl) | 2010-11-17 | 2018-09-28 | Aduro Biotech, Inc. | Postopki in sestavki za induciranje imunskega odziva na EGFRvIII |
| SG10201700392UA (en) | 2012-03-12 | 2017-03-30 | Advaxis Inc | Suppressor cell function inhibition following listeria vaccine treatment |
| EP3107566A4 (en) | 2014-02-18 | 2017-10-11 | Advaxis, Inc. | Biomarker directed multi-target immunotherapy |
| RU2016137834A (ru) | 2014-02-25 | 2018-03-29 | Адваксис, Инк. | КОМПОЗИЦИИ И СПОСОБЫ ЛЕЧЕНИЯ ОПУХОЛЕЙ, СВЕРХЭКСПРЕССИРУЮЩИХ HER2/neu |
| MA39717A (fr) | 2014-03-05 | 2017-01-11 | Advaxis Inc | Procédés et compositions pour accroître le rapport des lymphocytes t effecteurs aux lymphocytes t régulateurs |
| SG11201608820WA (en) | 2014-04-24 | 2016-11-29 | Advaxis Inc | Recombinant listeria vaccine strains and methods of producing the same |
| JP2017514904A (ja) | 2014-05-02 | 2017-06-08 | ザ トラスティーズ オブ ザ ユニバーシティ オブ ペンシルバニア | Her2陽性ガンの治療のための免疫療法および放射線療法の併用 |
| KR20170052569A (ko) | 2014-07-18 | 2017-05-12 | 어드박시스, 인크. | 전립선암 치료용 pd-1 길항제 및 리스테리아 기반 백신의 병용 |
| WO2016011320A1 (en) | 2014-07-18 | 2016-01-21 | Advaxis, Inc. | Bivalent listeria-based delivery system of heterologous antigens |
| SG11201700092XA (en) | 2014-07-18 | 2017-02-27 | Advaxis Inc | Recombinant listeria strain expressing heterologous antigen fusion proteins and methods of use thereof |
| JP2017522322A (ja) | 2014-07-18 | 2017-08-10 | アドバクシス, インコーポレイテッド | 抗腫瘍応答を引き出すためのリステリアベースの免疫原性組成物 |
| SG11201702857PA (en) | 2014-10-14 | 2017-05-30 | Univ Pennsylvania | Recombinant listeria vaccine strains and methods of using the same in cancer immunotherapy |
| MA41217A (fr) | 2014-12-19 | 2017-10-24 | Advaxis Inc | Polythérapies ayant des souches de listeria recombinées |
| WO2016126876A2 (en) | 2015-02-03 | 2016-08-11 | Advaxis, Inc. | Listeria-based adjuvants |
| WO2016126878A2 (en) | 2015-02-03 | 2016-08-11 | The Trustees Of The University Of Pennsylvania | Listeria-based immunomodulation |
| US20160220652A1 (en) | 2015-02-03 | 2016-08-04 | Advaxis, Inc. | Methods of using recombinant listeria vaccine strains in disease immunotherapy |
| MA41644A (fr) | 2015-03-03 | 2018-01-09 | Advaxis Inc | Compositions à base de listeria comprenant un système d'expression de minigènes codant pour des peptides, et leurs procédés d'utilisation |
| WO2016154412A2 (en) | 2015-03-26 | 2016-09-29 | The Trustees Of The University Of Pennsylvania | Combination of a pd-1 antagonist and a listeria based vaccine for treating pancreatic cancer |
| US20180104284A1 (en) | 2015-05-13 | 2018-04-19 | Advaxis, Inc. | Immunogenic Listeria-Based Compositions Comprising Truncated Acta-Antigen Fusions And Methods Of Use Thereof |
| CN107847611A (zh) | 2015-05-26 | 2018-03-27 | 阿德瓦希斯公司 | 个性化的基于递送载体的免疫疗法及其用途 |
| EP3313975A4 (en) | 2015-06-24 | 2019-03-13 | Advaxis, Inc. | MANUFACTURING DEVICE AND METHOD FOR PERSONALIZED ADMINISTRATION OF VECTOR-BASED IMMUNOTHERAPY |
| TW201723171A (zh) | 2015-09-15 | 2017-07-01 | 艾法西斯公司 | 基於李斯特菌屬之免疫原性組成物及其於癌症預防與治療中之使用方法 |
| US20180265879A1 (en) | 2015-09-15 | 2018-09-20 | Advaxis, Inc. | Manufacturing method of an immunotherapeutic formulation comprising a recombinant listeria strain |
| AU2016324170A1 (en) | 2015-09-17 | 2018-04-12 | Advaxis, Inc. | Recombinant Listeria vaccine strains and methods of using the same in cancer immunotherapy |
| AU2016340148A1 (en) | 2015-10-14 | 2018-05-31 | Advaxis, Inc. | Recombinant Listeria strains and methods of using the same in cancer immunotherapy |
| WO2017085691A1 (en) | 2015-11-20 | 2017-05-26 | Advaxis, Inc. | Manufacturing device and method of an immunotherapeutic formulation comprising a recombinant listeria strain |
| JP2018537511A (ja) | 2015-12-16 | 2018-12-20 | アドバクシス, インコーポレイテッド | リステリア系免疫療法およびその使用方法 |
| WO2017132547A1 (en) | 2016-01-27 | 2017-08-03 | Advaxis, Inc. | Personalized delivery vector-based immunotherapy and uses thereof |
| EP3481854A4 (en) | 2016-07-05 | 2020-07-29 | Advaxis, Inc. | LISTERIA-BASED IMMUNOGENIC COMPOSITIONS INCLUDING WILMS TUMOR PROTEIN ANTIGENS AND CORRESPONDING METHODS OF USE |
| EP3534944A4 (en) | 2016-11-07 | 2020-07-01 | Advaxis, Inc. | COMBINATION OF A LISTERIA-BASED VACCINE WITH ANTI-CTLA-4 OR ANTI-CD137 ANTIBODIES |
| CN110506107A (zh) | 2016-11-30 | 2019-11-26 | 阿德瓦希斯公司 | 靶向复发性癌症突变的免疫原性组合物及其使用方法 |
| WO2018102585A1 (en) | 2016-11-30 | 2018-06-07 | Advaxis, Inc. | Personalized immunotherapy in combination with immunotherapy targeting recurrent cancer mutations |
| WO2018129306A1 (en) | 2017-01-05 | 2018-07-12 | Advaxis, Inc. | Recombinant listeria vaccine strains and methods of using the same in cancer immunotherapy |
-
2015
- 2015-04-14 SG SG11201608820WA patent/SG11201608820WA/en unknown
- 2015-04-14 BR BR112016024352-8A patent/BR112016024352A2/pt not_active Application Discontinuation
- 2015-04-14 EP EP15782800.5A patent/EP3134510B1/en active Active
- 2015-04-14 US US15/306,289 patent/US10258679B2/en active Active
- 2015-04-14 AU AU2015250111A patent/AU2015250111A1/en not_active Abandoned
- 2015-04-14 WO PCT/US2015/025690 patent/WO2015164121A1/en not_active Ceased
- 2015-04-14 MX MX2016013985A patent/MX2016013985A/es unknown
- 2015-04-14 JP JP2016564032A patent/JP7009061B2/ja not_active Expired - Fee Related
- 2015-04-14 SG SG10202011841WA patent/SG10202011841WA/en unknown
- 2015-04-14 MA MA039849A patent/MA39849A/fr unknown
- 2015-04-14 KR KR1020227003655A patent/KR102491332B1/ko active Active
- 2015-04-14 RU RU2016145464A patent/RU2016145464A/ru not_active Application Discontinuation
- 2015-04-14 KR KR1020167029990A patent/KR102359691B1/ko not_active Expired - Fee Related
- 2015-04-14 CN CN201580021074.6A patent/CN106459887A/zh active Pending
- 2015-04-14 CA CA2946716A patent/CA2946716A1/en not_active Abandoned
- 2015-04-21 TW TW109111533A patent/TWI722858B/zh not_active IP Right Cessation
- 2015-04-21 TW TW104112751A patent/TWI692525B/zh not_active IP Right Cessation
-
2016
- 2016-10-25 IL IL248483A patent/IL248483A0/en unknown
-
2019
- 2019-02-14 US US16/276,520 patent/US20190240303A1/en not_active Abandoned
-
2020
- 2020-03-18 JP JP2020047632A patent/JP2020099352A/ja not_active Withdrawn
-
2022
- 2022-05-30 JP JP2022087587A patent/JP7300041B2/ja active Active
Patent Citations (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7794729B2 (en) * | 1994-11-08 | 2010-09-14 | The Trustees Of The University Of Pennsylvania | Methods and compositions for immunotherapy of cancer |
| US8114414B2 (en) | 1994-11-08 | 2012-02-14 | The Trustees Of The University Of Pennsylvania | Compositions and methods for treatment of cervical cancer |
| US20050048081A1 (en) | 1997-11-18 | 2005-03-03 | The Trustees Of The University Of Pennsylvania | Immunogenic compositions comprising DAL/DAT double mutant, auxotrophic attenuated strains of listeria and their mehods of use |
| US20050118184A1 (en) | 2000-03-29 | 2005-06-02 | Trustees Of The University Of Pennsylvania | Compositions and methods for enhancing the immunogenicity of antigens |
| US20040013690A1 (en) | 2002-05-29 | 2004-01-22 | Portnoy Daniel A. | Attenuated Listeria spp. and methods for using the same |
| US20070207170A1 (en) | 2006-03-01 | 2007-09-06 | Cerus Corporation | Engineered Listeria and methods of use thereof |
| US20110142791A1 (en) | 2009-11-11 | 2011-06-16 | Vafa Shahabi | Compositions and methods for prevention of escape mutation in the treatment of her2/neu over-expressing tumors |
| WO2012125551A1 (en) * | 2011-03-11 | 2012-09-20 | Advaxis | Listeria-based adjuvants |
Non-Patent Citations (27)
| Title |
|---|
| "GenBank", Database accession no. NP-001082350 |
| ANTHONY, CANCER RES., vol. 36, 1976, pages 2579 - 2583 |
| AUERBUCH ET AL., INFECT. IMMUNITY, vol. 69, 2001, pages 5953 - 5957 |
| BENVEGNU ET AL., LIVER, vol. 12, 1992, pages 80 - 83 |
| BISHOPHINRICHS, J. IMMUNOL., vol. 139, 1987, pages 2005 - 2009 |
| BODANSZKYBODANSZKY: "The Practice of Peptide Synthesis", 1984, PIERCE CHEMICAL COMPANY |
| BROCKSTEDT ET AL., PROC. NATL. ACAD. SCI. USA, vol. 101, 2004, pages 13832 - 13837 |
| FRACHON ET AL., J. HEPATOL., vol. 34, 2001, pages 850 - 857 |
| GARAY-MALPARTIDA HMOCCHIUCCI JMALVES JBELIZARIO JE, BIOINFORMATICS, vol. 21, no. 1, June 2005 (2005-06-01), pages i169 - 76 |
| GIANNINI ET AL., HEPATOGASTROENTEROL., vol. 34, 1987, pages 95 - 97 |
| JONESPORTNOY, INFECT. IMMUNITY, vol. 65, 1994, pages 5608 - 5613 |
| KOTOULA ET AL., LIVER, vol. 22, 2002, pages 57 - 69 |
| LAUER ET AL., J. BACT., vol. 184, 2002, pages 4177 - 4186 |
| MACIAG ET AL., VACCINE, vol. 27, no. 30, 2009, pages 3975 - 3983 |
| NAKANUMA ET AL., J. HEPATOBILIARY PANCREAT. SURG., vol. 10, 2003, pages 265 - 281 |
| O'RIORDAN ET AL., SCIENCE, vol. 302, 2003, pages 462 - 464 |
| PETIT ET AL.: "12 Month Survival and Safety Data from a Phase 2 Study in Recurrent Cervical Cancer", 2013 ASCO ANNUAL MEETING, ABSTRACT #5529, 29 May 2013 (2013-05-29), XP055233731, Retrieved from the Internet <URL:http://content.stockpr.com/advaxis/media/e0e1d38f7024f8f0e534eb6fcb9acb82.pdf> [retrieved on 20150615] * |
| RECHSTEINERROGERS, TRENDS BIOCHEM. SCI., vol. 21, 1996, pages 267 - 271 |
| RIEGLER, SEMIN. GASTROINTEST. DIS., vol. 7, 1996, pages 74 - 87 |
| ROCKENCARL-MCGRATH, DIG. DIS., vol. 19, 2001, pages 269 - 278 |
| SHIMONISHI ET AL., J. HEPATOBILIARY PANCREAT. SURG., vol. 7, 2000, pages 542 - 550 |
| SKOBLE ET AL., J. CELL BIOL., vol. 150, 2000, pages 527 - 538 |
| SUBANNASCH, TOXICOL. PATHOL., vol. 31, 2003, pages 126 - 133 |
| TERRACCIANOTOMILLO, PATHOLOGICA, vol. 95, 2003, pages 71 - 82 |
| VEGA ET AL.: "New Listeria monocytogenes prfA* mutants, transcriptional properties of PrfA* proteins and structure-function of the virulence regulator PrfA", MOLECULAR MICROBIOLOGY, vol. 52, no. Iss. 6, 7 May 2004 (2004-05-07), pages 1553 - 1565, XP055233740 * |
| WALLECHA ET AL.: "Lm-LLO-Based Immunotherapies and HPV-Associated Disease", JOURNAL OF ONCOLOGY, vol. 2012, 2 February 2012 (2012-02-02), pages 1 - 10, XP055233738 * |
| WIRTH R ET AL., J BACTERIOL, vol. 165, 1986, pages 831 |
Cited By (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11446369B2 (en) | 2007-05-10 | 2022-09-20 | Advaxis, Inc. | Compositions and methods comprising KLK3 or FOLH1 antigen |
| US10064898B2 (en) | 2011-03-11 | 2018-09-04 | Advaxis, Inc. | Listeria-based adjuvants |
| US10058599B2 (en) | 2012-03-12 | 2018-08-28 | Advaxis, Inc. | Suppressor cell function inhibition following Listeria vaccine treatment |
| US10143734B2 (en) | 2014-02-18 | 2018-12-04 | Advaxis, Inc. | Biomarker directed multi-target immunotherapy |
| US10258679B2 (en) | 2014-04-24 | 2019-04-16 | Advaxis, Inc. | Recombinant Listeria vaccine strains and methods of producing the same |
| WO2016061277A1 (en) * | 2014-10-14 | 2016-04-21 | The Trustees Of The University Of Pennsylvania | Recombinant listeria vaccine strains and methods of using the same in cancer immunotherapy |
| JP2017536095A (ja) * | 2014-10-14 | 2017-12-07 | ザ トラスティーズ オブ ザ ユニバーシティ オブ ペンシルバニア | 組み換え型リステリアワクチン株および癌免疫療法におけるその使用方法 |
| US10900044B2 (en) | 2015-03-03 | 2021-01-26 | Advaxis, Inc. | Listeria-based compositions comprising a peptide minigene expression system and methods of use thereof |
| US11702664B2 (en) | 2015-03-03 | 2023-07-18 | Advaxis, Inc. | Listeria-based compositions comprising a peptide minigene expression system and methods of use thereof |
| US11897927B2 (en) | 2016-11-30 | 2024-02-13 | Advaxis, Inc. | Immunogenic compositions targeting recurrent cancer mutations and methods of use thereof |
| CN106978381A (zh) * | 2017-03-23 | 2017-07-25 | 上海理工大学 | prfA基因缺失单核细胞增生李斯特氏菌及制备方法 |
| US11179339B2 (en) | 2017-09-19 | 2021-11-23 | Advaxis, Inc. | Compositions and methods for lyophilization of bacteria or listeria strains |
| US12239738B2 (en) | 2017-09-19 | 2025-03-04 | Advaxis, Inc. | Compositions and methods for lyophilization of bacteria or listeria strains |
| WO2019086507A1 (en) | 2017-10-31 | 2019-05-09 | Pantarhei Bioscience B.V. | Immunotherapeutic methods for treating and/or preventing lung cancer |
| WO2021259963A1 (en) | 2020-06-23 | 2021-12-30 | Pandora Endocrine Innovation B.V. | Immunization against wnt4 for treatment and prophylaxis of breast cancer |
| WO2023066923A1 (en) | 2021-10-19 | 2023-04-27 | Rahman Nafis | Male contraception |
Also Published As
| Publication number | Publication date |
|---|---|
| TW201546276A (zh) | 2015-12-16 |
| TWI722858B (zh) | 2021-03-21 |
| KR20160145627A (ko) | 2016-12-20 |
| SG11201608820WA (en) | 2016-11-29 |
| JP7009061B2 (ja) | 2022-01-25 |
| AU2015250111A1 (en) | 2016-12-08 |
| CN106459887A (zh) | 2017-02-22 |
| KR20220021021A (ko) | 2022-02-21 |
| EP3134510B1 (en) | 2023-11-01 |
| JP7300041B2 (ja) | 2023-06-28 |
| RU2016145464A (ru) | 2018-05-24 |
| JP2022105768A (ja) | 2022-07-14 |
| US10258679B2 (en) | 2019-04-16 |
| JP2017513502A (ja) | 2017-06-01 |
| MA39849A (fr) | 2017-03-01 |
| US20190240303A1 (en) | 2019-08-08 |
| TWI692525B (zh) | 2020-05-01 |
| IL248483A0 (en) | 2016-12-29 |
| JP2020099352A (ja) | 2020-07-02 |
| KR102359691B1 (ko) | 2022-02-10 |
| CA2946716A1 (en) | 2015-10-29 |
| EP3134510A1 (en) | 2017-03-01 |
| TW202041671A (zh) | 2020-11-16 |
| US20170042996A1 (en) | 2017-02-16 |
| KR102491332B1 (ko) | 2023-01-27 |
| EP3134510A4 (en) | 2018-04-25 |
| BR112016024352A2 (pt) | 2018-01-23 |
| MX2016013985A (es) | 2017-01-11 |
| SG10202011841WA (en) | 2021-01-28 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| JP7300041B2 (ja) | 組み換え型リステリアワクチン株およびこれを生産する方法 | |
| US10010593B2 (en) | Recombinant Listeria vaccine strains and methods of using the same in cancer immunotherapy | |
| US20180280487A1 (en) | Recombinant listeria vaccine strains and methods of using the same in cancer immunotherapy | |
| US20160220652A1 (en) | Methods of using recombinant listeria vaccine strains in disease immunotherapy | |
| WO2017049218A2 (en) | Recombinant listeria vaccine strains and methods of using the same in cancer immunotherapy |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 15782800 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2946716 Country of ref document: CA Ref document number: 2016564032 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 15306289 Country of ref document: US Ref document number: MX/A/2016/013985 Country of ref document: MX |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 248483 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 20167029990 Country of ref document: KR Kind code of ref document: A |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112016024352 Country of ref document: BR |
|
| REEP | Request for entry into the european phase |
Ref document number: 2015782800 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2015782800 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2016145464 Country of ref document: RU Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2015250111 Country of ref document: AU Date of ref document: 20150414 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 112016024352 Country of ref document: BR Kind code of ref document: A2 Effective date: 20161019 |