WO2015118031A2 - Antibody-drug conjugates and immunotoxins - Google Patents
Antibody-drug conjugates and immunotoxins Download PDFInfo
- Publication number
- WO2015118031A2 WO2015118031A2 PCT/EP2015/052342 EP2015052342W WO2015118031A2 WO 2015118031 A2 WO2015118031 A2 WO 2015118031A2 EP 2015052342 W EP2015052342 W EP 2015052342W WO 2015118031 A2 WO2015118031 A2 WO 2015118031A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- conjugate
- seq
- amino acid
- sequence
- antibody
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/04—Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
- A61K38/05—Dipeptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/164—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/56—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
- A61K47/59—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes
- A61K47/60—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes the organic macromolecular compound being a polyoxyalkylene oligomer, polymer or dendrimer, e.g. PEG, PPG, PEO or polyglycerol
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/65—Peptidic linkers, binders or spacers, e.g. peptidic enzyme-labile linkers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2896—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/24—Hydrolases (3) acting on glycosyl compounds (3.2)
- C12N9/2497—Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing N- glycosyl compounds (3.2.2)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/96—Stabilising an enzyme by forming an adduct or a composition; Forming enzyme conjugates
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y302/00—Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2)
- C12Y302/02—Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2) hydrolysing N-glycosyl compounds (3.2.2)
- C12Y302/02022—Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2) hydrolysing N-glycosyl compounds (3.2.2) rRNA N-glycosylase (3.2.2.22)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/71—Decreased effector function due to an Fc-modification
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/77—Internalization into the cell
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/55—Fusion polypeptide containing a fusion with a toxin, e.g. diphteria toxin
Definitions
- the present invention relates to antibody-drug conjugates (ADCs) an Immunotoxins that target Endoglin (ENG) , and to their use in medicine, e.g. in the treatment of certain cancers.
- ADCs antibody-drug conjugates
- ENG target Endoglin
- Malignant epithelial tumors are the main cancer-related cause of human death. These solid tumors frequently exhibit significant stromal reactions such as the so-called “desmoplastic stroma” or “reactive stroma”, which represents 20-60% of total tumor mass and is characterized by the existence of large numbers of stromal cells and dense extracellular matrix (ECM) . Recent studies have indicated the tumor-promoting roles of stromal cells, as exemplified by vascular cells, immune cells, fibroblasts, myofibroblasts,
- CAFs cancer-associated fibroblasts
- CAFs facilitate the spreading and infiltration of tumor cells in distant organs, thus contributing to formation of metastases.
- the relevance of stromal cell to the failure of systemic drug delivery to tumors and to the development of drug resistance has also been indicated (7-11).
- MAb Monoclonal antibody
- chemotherapeutic molecules can be good candidates, since they are very potent and active in very small quantities .
- ITs immunotoxins
- ADCs Antibody-Drug conjugates
- Immunoconjugates are made of a human, humanized or chimeric
- the Ab must be very selective to reach the antigen, whose expression must be restricted in normal cells.
- the Ab also must be internalized efficiently into the cancerous cells.
- the cytotoxic agent selected as the effector moiety must kill cells only after internalization and release into the cell cytoplasm.
- the most commonly used payloads in ADCs are DNA-harming drugs such as calicheamicins , duocarmicins , or microtubule-targeting compounds like auristatins and maitansinoids .
- Ab-cytotoxic linkers are designed to be stable systemically and release the cytotoxic within the target cells.
- TAAs are frequently cell membrane proteins that are overexpressed in diseased tissues or at least expressed sufficiently to facilitate the internalization-activated cytotoxicity.
- the antigen presents a restricted expression in normal tissues with a low or absent expression in vital organs.
- the tumor antigen must be recognized selectively and with high affinity by an Ab.
- TGF- ⁇ co- receptor family is emerging as a target for cancer treatments acting on the tumor or on its neovasculature .
- Endoglin ENG, CD105
- an accessory protein of the type II TGF- ⁇ receptor complex is part of this family and presents the following characteristics:
- Anti-ENG antibodies e.g. scFvs
- the present invention relates to anti-ENG antibodies, conjugates thereof and optimised payloads for use in antibody conjugate strategies.
- anti-ENG antibodies as described herein exhibit highly specific binding and fast and efficient internalisation .
- the present inventors have found that the A chain of Nigrin b can be isolated and produced in bacterial host cells, yet retains the ability to translocate into cells and exhibits cytotoxic activity in the absence of the Nigrin-b B-chain when conjugated to a monoclonal antibody.
- the Nigrin-b A-chain described herein and/or cytolysin derivatives are advantageously conjugated to anti-ENG antibodies for use in the treatment of tumors.
- the present invention provides a conjugate having the formula I:
- A is an antibody that selectively binds Endoglin
- L is a linker
- D is a drug comprising a cytolysin or a Nigrin-b A-chain; and p is 1 to 10.
- A is a monoclonal antibody or binding fragment thereof that selectively binds to an extracellular region of human Endoglin.
- A may comprise heavy chain
- CDRHl-3 complementarity determining regions 1-3
- CDRLl-3 light chain complementarity determining regions 1-3
- CDRH1 SEQ ID NO: 7 or a variant thereof having up to 1 or 2 amino acid substitutions compared with the sequence of SEQ ID NO:
- CDRH2 SEQ ID NO: 8 or a variant thereof having up to 1 or 2 amino acid substitutions compared with the sequence of SEQ ID NO:
- CDRH3 SEQ ID NO: 9 or a variant thereof having up to 1 or 2 amino acid substitutions compared with the sequence of SEQ ID NO:
- CDRL1 SEQ ID NO: 10 or a variant thereof having up to 1 or 2 amino acid substitutions compared with the sequence of SEQ ID NO: 10;
- CDRL2 SEQ ID NO: 11 or a variant thereof having up to 1 or 2 amino acid substitutions compared with the sequence of SEQ ID NO: 11;
- CDRL3 SEQ ID NO: 12 or a variant thereof having up to 1 or 2 amino acid substitutions compared with the sequence of SEQ ID NO: 12.
- CDRHl-3 comprise the amino acid sequences of SEQ ID NOS : 7-9, respectively and CDRLl-3 comprise the amino acid sequences of SEQ ID NOS: 10-12, respectively.
- A comprises a heavy chain variable region (VH) comprising an amino acid sequence having at least 90%, 95% or 99% sequence identity with the full-length sequence of SEQ ID NO: 5.
- VH heavy chain variable region
- A comprises a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 5.
- A comprises a light chain variable region (VL) comprising an amino acid sequence having at least 90%, 95% or 99% sequence identity with the full-length sequence of SEQ ID NO: 6.
- A may comprise a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 6.
- A comprises a heavy chain comprising an amino acid sequence having at least 90%, 95% or 99% sequence identity with the full-length sequence of SEQ ID NO: 3.
- A may comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 3.
- A comprises a light chain comprising an amino acid sequence having at least 90%, 95% or 99% sequence identity with the full-length sequence of SEQ ID NO: 4.
- A may comprise a light chain comprising the amino acid sequence of SEQ ID NO: 4.
- A may be a competitively binging anti-Endoglin antibody that is structurally different from the anti-Endoglin antibody molecules exemplified herein.
- A may be an anti-Endoglin antibody molecule that competes with the anti-human Endoglin IgGl antibody identified herein as "A5" for binding to immobilized recombinant human Endoglin.
- A5 has the heavy chain amino acid sequence of SEQ ID NO: 3 and the light chain amino acid sequence of SEQ ID NO: 4.
- A is a monoclonal antibody or binding fragment thereof that selectively binds to an extracellular region of murine Endoglin. Conjugates that target murine Endoglin find particular use in pre-clinical testing, e.g., employing well-characterised murine models of various cancers.
- A may comprise heavy chain complementarity determining regions 1-3 (CDRHl-3) and light chain complementarity determining regions 1-3 (CDRLl-3) having the following amino acid sequences :
- CDRH1 SEQ ID NO: 19 or a variant thereof having up to 1 or 2 amino acid substitutions compared with the sequence of SEQ ID NO: 19
- CDRH2 SEQ ID NO: 20 or a variant thereof having up to 1 or 2 amino acid substitutions compared with the sequence of SEQ ID NO: 20;
- CDRH3 SEQ ID NO: 21 or a variant thereof having up to 1 or 2 amino acid substitutions compared with the sequence of SEQ ID NO: 21;
- CDRL1 SEQ ID NO: 22 or a variant thereof having up to 1 or 2 amino acid substitutions compared with the sequence of SEQ ID NO: 22;
- CDRL2 SEQ ID NO: 23 or a variant thereof having up to 1 or 2 amino acid substitutions compared with the sequence of SEQ ID NO: 23;
- CDRL3 SEQ ID NO: 24 or a variant thereof having up to 1 or 2 amino acid substitutions compared with the sequence of SEQ ID NO: 24.
- CDRHl-3 may comprise the amino acid sequences of SEQ ID NOS: 19-21, respectively and CDRLl-3 may comprise the amino acid sequences of SEQ ID NOS: 22-24, respectively.
- A comprises a heavy chain variable region (VH) comprising an amino acid sequence having at least 90%, 95% or 99% sequence identity with the full-length sequence of SEQ ID NO: 17, e.g. A may comprise a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 17.
- A comprises a light chain variable region (VL) comprising an amino acid sequence having at least 90%, 95% or 99% sequence identity with the full-length sequence of SEQ ID NO: 18, e.g., A may comprise a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 18.
- A comprises a heavy chain comprising an amino acid sequence having at least 90%, 95% or 99% or even 100% sequence identity with the full-length sequence of SEQ ID NO: 15.
- A comprises a light chain comprising an amino acid sequence having at least 90%, 95% or 99% or even 100% sequence identity with the full-length sequence of SEQ ID NO: 16.
- A may be a competitively binding anti-Endoglin antibody that is structurally different from the anti-Endoglin antibody molecules exemplified herein.
- A may be an anti-Endoglin antibody molecule that competes with the anti-murine Endoglin IgGl antibody identified herein as "mE12" for binding to immobilized recombinant murine Endoglin.
- mE12 has the heavy chain amino acid sequence of SEQ ID NO: 15 and the light chain amino acid sequence of SEQ ID NO: 16.
- D may be a cytolysin.
- the cytolysin may, in some cases, be a compound disclosed in WO 2008/138561 Al , the entire contents of which is expressly incorporated herein by reference (compounds disclosed therein are also referred to as Tubulysine derivatives) .
- the cytolysin may be synthesised as described in WO 2008/138561.
- the cytolysin may be as defined in Formula I or Formula IV of WO 2008/138561 Al .
- the cytolysin may be of formula IV:
- R 2 (i) is directly or indirectly attached to linker L or (ii) is H or is C1-C4 alkyl;
- R 6 is Ci-C 6 alkyl
- R 7 is Ci-C 6 alkyl, CH 2 OR 19 or CH2OCOR 20 , wherein R 19 is alkyl, R 20 is C 2 - C6-alkenyl, phenyl, or CH 2 -phenyl;
- R 9 is Ci-C 6 alkyl
- R 10 is H, OH, O-alkyl or O-acetyl
- f 1 or 2;
- R 11 has the following structure:
- R 21 is H, OH, halogen, NH 2 , alkyloxy, phenyl, alkyl amino or dialkyl amino ;
- R 16 is H or a Ci-C6-alkyl group
- R 17 (i) is directly or indirectly attached to linker L or (ii) is C0 2 H, C0 2 R 18 , CONHNH2, OH, NH 2 , SH or a optionally substituted alkyl, cycloalkyl, heteroalkyl or heterocycloalkyl group, wherein R 18 is an optionally substituted alkyl, heteroalkyl or hetercycloalkyl group; and
- q 0, 1, 2 or 3;
- C1-C6 alkyl substituted with unsubstituted C1-C6 alkyl, C2C6 alkenyl, C2-C6 alkynyl, C1-C6 heteroalkyl, C3-C10 cycloalkyl, C2-C9 heterocycloalkyl, C6-C10 aryl, C1-C9 heteroaryl, C7-C12 aralkyl or C2-C11 heteroaralkyl groups .
- R 2 is a bond to linker L.
- R 17 is C(0)X, CONHNHX, OX, NHX or SX, wherein X is a bond to linker L.
- linker L may further comprise a spacer.
- the spacer has a chain length of 2 to 30 atoms
- the spacer comprises or consists of an alkylene (i.e. divalent alkyl) or heteroalkylene (i.e. divalent heteroalkyl) group. In some cases the spacer comprises or consists of an alkylene or oxyalkylene group.
- the spacer comprises or consists of a group -(CH 2 ) n - or
- the spacer comprises or consists of a group
- n may be 1 to 15, 1 to
- n may be 3 or 4.
- the space comprises between one and six ethylene glycol units, e.g. a triethylene glycol.
- the spacer may be directly attached to group R 17 , or may be attached to group R 17 via a bridging group.
- the spacer is attached to group R 17 via a -C(0)X bridging group, wherein X is a bond to R 17 .
- R 17 is CONHNHX and the spacer is attached to group R 17 via a -C(0)X bridging group, wherein X represents the bond between the spacer and R 17 .
- D comprises a cytolysin having the following
- D comprises a cytolysin having the following structure :
- L comprises an attachment group for attachment to A and protease cleavable portion.
- L may comprise a valine-citrulline unit.
- L may comprise
- the double bond of the maleimide is reacted with a thiol group of a cysteine residue of the antibody A to form a sulphur-carbon bond in order to effect linkage of the linker L to the antibody A.
- -L-D has a structure selected from the group
- -L-D may have the following structure:
- p may, in some cases, lie in the range 1 to 5, e.g. 1 to 4, or 1 to 3. In particular cases p may be 1 or 2. In particular, cases p may be 3 or 4.
- D may be a Nigrin-b A-chain.
- the Nigrin-b A-chain is in the absence of a Nigrin-b B-chain.
- the Nigrin-b A-chain may comprise or consist of the sequence of SEQ ID NO: 25.
- the Nigrin-b A-chain may be or may have been recombinantly-produced, e.g. in a bacterial host cell.
- the present inventors have surprisingly found that Nigrin-b A-chain retains its activity (e.g. cytotoxic and/or ribosome inhibiting activity) despite loss of or alteration of native glycosylation such as is the case when the Nigrin-b A-chain is produced recombinantly in a bacterial host cell.
- L may simply be a disulphide bond between a sulphur atom on A and a sulphur atom on D.
- L may comprise or consist of a bond, e.g. a disulphide bond .
- the present invention provides a conjugate as defined in accordance with the first aspect of the invention for use in medicine.
- the present invention provides a conjugate as defined in accordance with the first aspect of the invention for use in a method of treatment of a tumor in a mammalian subject.
- the conjugate is for use in the treatment of a blood neoplasm.
- the conjugate is for use in the treatment of a solid tumor.
- the conjugate may be for use in the treatment of pancreatic cancer, Ewing sarcoma, breast cancer, melanoma, lung cancer, head & neck cancer, ovarian cancer, bladder cancer or colon cancer.
- the conjugate is for simultaneous, sequential or separate administration with one or more other antitumor drugs.
- the one or more other antitumor drugs comprise a cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic cytotoxic
- chemotherapeutic agent or an anti-angiogenic agent or an
- the one or more other antitumor drugs comprise Gemcitabine, Abraxane bevacizumab,
- itraconazole carboxyamidotriazole , an anti-PD-1 molecule or an anti-PD-Ll molecule (for example, nivolumab or pembrolizumab) .
- the present invention provides a method of treating a tumor in a mammalian subject, comprising administering a therapeutically effective amount of a conjugate as defined in accordance with the first aspect of the invention to the subject in need thereof.
- the method may be for treating a blood neoplasm.
- the method may be for treating solid tumors.
- the method may be for treating pancreatic cancer, E ing sarcoma, breast cancer, melanoma, lung cancer, head & neck cancer, ovarian cancer, bladder cancer or colon cancer.
- the present invention provides use of a cytolysin in the preparation of an antibody-drug conjugate, wherein the antibody is an Endoglin-specific antibody, e.g., an Endoglin- specific antibody in accordance with the eighth aspect of the invention.
- the cytolysin may be as defined in accordance with the first aspect of the invention.
- the use may be of a cytolysin in the preparation of an antibody-drug conjugate as defined in accordance with the first aspect of the invention .
- the present invention provides an isolated Nigrin- b A-chain in the absence of the Nigrin-b B-chain.
- the amino acid sequence of the Nigrin-b A-chain may comprise or consist of the sequence of SEQ ID NO: 25.
- the present invention provides use of an isolated Nigrin-b A-chain in accordance with the sixth aspect of the invention in the preparation of an immunotoxin.
- the immunotoxin comprises a monoclonal antibody conjugated and/or bound to said isolated Nigrin-b A-chain.
- the immunotoxin comprises an antibody, such as a monoclonal antibody, e.g. a human monoclonal antibody, that selectively binds Endoglin.
- the immunotoxin comprises an antibody in accordance with the eighth aspect of the invention.
- the present invention provides a monoclonal antibody, e.g. a human monoclonal antibody, that:
- the present invention provides an antibody of the eighth aspect of the invention for use in medicine.
- the present invention provides a conjugate of the first aspect of the invention or an antibody of the eighth aspect o the invention for use in the treatment of an inflammatory condition (e.g. rheumatoid arthritis) or an eye disease (e.g. diabetic retinopathy or macular degeneration, such as wet age related macula degeneration) .
- an inflammatory condition e.g. rheumatoid arthritis
- an eye disease e.g. diabetic retinopathy or macular degeneration, such as wet age related macula degeneration
- the present invention provides a method of treating an inflammatory condition (e.g. rheumatoid arthritis) or an eye disease (e.g. diabetic retinopathy or macular degeneration, such as wet age related macular degeneration) in a mammalian subject, comprising administering a therapeutically effective amount of a conjugate of the first aspect of the invention or an antibody of the eighth aspect of the invention to the subject in need thereof.
- an inflammatory condition e.g. rheumatoid arthritis
- an eye disease e.g. diabetic retinopathy or macular degeneration, such as wet age related macular degeneration
- the present invention provides use of a
- the present invention provides a host cell comprising a vector comprising a polynucleotide that encodes at least one polypeptide having an amino acid sequence selected from the group consisting of: SEQ ID NOS : 1-6, 13-18 and 25.
- the polynucleotide may comprise the nucleic acid sequence of SEQ ID NO: 26.
- the present invention provides a process for the production of a conjugate in accordance with the first aspect of the invention, comprising: (a) derivatising the antibody that selectively binds Endoglin to introduce at least one sulphydryl group; and
- the process may further comprise a step (c) of purifying and/or isolating the conjugate.
- an appropriate residue e.g. a cysteine amino acid
- the process may further comprise a step (c) of purifying and/or isolating the conjugate.
- step (a) may comprise reacting the antibody with 4- succynimidyloxycarbonyl-a-methyl- ⁇ - ( 2-pyridyl-dithio ) toluene (SMPT) , N-succynimidyl 3— (2-pyridyl-dithiopropionate) (SPDP) or methyl 4- mercaptobutyrimidate .
- SMPT 2-pyridyl-dithio toluene
- SPDP N-succynimidyl 3— (2-pyridyl-dithiopropionate
- the present invention provides a process for the production of a conjugate in accordance with the first aspect of the invention, comprising:
- the process may comprise purifying and/or isolating the conjugate .
- Figure 1 shows ELISA results of mE12-IgG for binding to recombinant mouse ENG (aa 27-581) .
- Coated BSA was included as negative control.
- a concentration-dependent binding to mouse ENG was observed;
- Figure 2 shows flow cytometry analysis of binding of mE12-IgG to a) B16 cells using 50 g/ml antibody, b) B16 cells using 5 g/ml antibody, and c) HT1080 cells included as negative control. Shaded area: cells alone, unshaded area: cells incubated with antibody;
- Figure 3 shows a) ELISA of binding of A5 IgGl to immobilized recombinant human ENG. b) Flow cytometry analysis of binding of A5- IgG to HT1080 cells;
- Figure 4 shows MALDI-Tof profile of recombinant nigrin-b A-chain. Observed mass (Da) : 28546.55; Expected mass (Da) : 28546.09; Mass deviation: 0.5; Mass Accuracy: 16ppm.
- FIG. 5 shows ribosome inactivating protein (RIP) activity of recombinant Nigrin-b A-chain (recNgA) tested in rabbit reticulocyte cell-free lysates (RRL) versus native (WT) Nigrin-b (3a, 3b, 6c, 9c) represent different formulations of recNgA
- Figure 6 shows cytotoxicity of recNgA tested on HT1080-FAP cell line through crystal violet viability assay (native Nigrin - diamonds; recombinant Nigrin-b A-chain - squares)
- Figure 7 shows RIP activity of recNgA-conjugates in an RRL assay
- Native nigrin b diamonds ( ⁇ )
- recNgA squares ( ⁇ )
- recNgA-conjugates HPS-124-37-1 triangles: ⁇ )
- HPS-124-37-2 crosses: X
- Figure 8 shows the general antibody conjugate structure for a cytolysin-conjugated antibody via a vcPABA linker. Attachment of the cytolysin may be via Ri or R4 (identified by arrows)
- Figure 10 shows in vitro cytotoxic effect of cytolysin ADCs on (A) wild type (WT) and (B) antigen (AG) -expressing HT1080 cells.
- Cell proliferation arrest was evidenced through crystal violet staining after 72h incubation of each compound at a concentration range from 10 "6 to 10 "12 M.
- Parental TAM334 cytolysin was used as positive control for unspecific cytotoxicity.
- Figure 11 shows tumor growth inhibition effect of recNgA and cytolysin immunoconjugates .
- recNgA conjugates administrated as single agent (OMTX505) or in combination with Gemcitabine
- Endoglin may be an Endoglin protein of any mammalian species.
- Endoglin is human Endoglin (also known as CD105, ENG or END) , the amino acid sequence of which is disclosed at UniProt accession No. P17813 (Version 154, dated 13 November 2013) (SEQ ID NO: 27) .
- a molecule that binds Endoglin e.g. an antibody molecule or a conjugate thereof
- the extracellular domain of human Endoglin comprises residues 26-561 of the full- length human Endoglin protein.
- Endoglin is murine Endoglin (also known as CD105, MJ7/18 antigen, ENG or END) , the amino acid sequence of which is disclosed at UniProt accession No. Q63961 (Version 104, dated 13 November 2013) (SEQ ID NO: 28) .
- the extracellular domain of murine Endoglin comprises residues 27-581 of the full-length murine Endoglin protein.
- conjugate includes the resultant structure formed by linking molecules and specifically includes antibody-drug conjugates (ADCs) and immunotoxins (ITs) .
- ADCs antibody-drug conjugates
- ITs immunotoxins
- the terms selectively binds and selective binding refer to binding of an antibody, or binding fragment thereof, to a predetermined molecule (e.g. an antigen) in a specific manner.
- a predetermined molecule e.g. an antigen
- the antibody, or binding fragment thereof may bind to Endoglin, e.g. an extracellular portion thereof, with an affinity of at least about lxl0 7 M _1 , and may bind to the predetermined molecule with an affinity that is at least two-fold greater (e.g. five-fold or ten-fold greater) than its affinity for binding to a molecule other than the predetermined molecule.
- antibody or “antibody molecule” includes any immunoglobulin whether natural or partly or wholly synthetically produced.
- antibody or “antibody molecule” includes monoclonal
- Antibodies may be intact or fragments derived from full antibodies (see below) .
- Antibodies may be human antibodies, humanised antibodies or antibodies of non-human origin.
- “Monoclonal antibodies” are homogeneous, highly specific antibody populations directed against a single antigenic site or "determinant" of the target molecule.
- “Polyclonal antibodies” include heterogeneous antibody populations that are directed against different antigenic determinants of the target molecule.
- antigen or
- antibody refers to blood serum containing antibodies obtained from immunized animals. It has been shown that fragments of a whole antibody can perform the function of binding antigens. Thus reference to antibody herein, and with reference to the methods, arrays and kits of the invention, covers a full antibody and also covers any polypeptide or protein comprising an antibody binding fragment. Examples of binding fragments are (i) the Fab fragment consisting of V L , V H , CL and CHI domains; (ii) the Fd fragment consisting of the V H and CHI domains;
- the term “selectively binds” may be used herein to refer to the situation in which one member of a specific binding pair will not show any significant binding to molecules other than its specific binding partner (s) .
- the term is also applicable where e.g. an antigen-binding site is specific for a particular epitope that is carried by a number of antigens, in which case the specific binding member carrying the antigen-binding site will be able to bind to the various antigens carrying the epitope.
- the antibody may be a fully human antibody.
- the conjugate of the invention may administered with, or for administration with, (whether simultaneously, sequentially or separately) other antitumor drugs, including, but not limited to, a cytotoxic chemotherapeutic agent or an anti-angiogenic agent or an immunotherapeutic agent.
- other antitumor drugs including, but not limited to, a cytotoxic chemotherapeutic agent or an anti-angiogenic agent or an immunotherapeutic agent.
- Cytotoxic chemotherapeutic agents are well known in the art and include anti-cancer agents such as:
- Alkylating agents including nitrogen mustards such as
- mechlorethamine HN2
- cyclophosphamide ifosfamide, melphalan (L- sarcolysin) and chlorambucil
- 10 ethylenimines and methylmelamines such as hexamethylmelamine, thiotepa
- alkyl sulphonates such as busulfan
- nitrosoureas such as carmustine (BCNU) , lomustine (CCNLJ) , semustine (methyl-CCN-U) and streptozoein ( streptozotocin)
- triazenes such as decarbazine (DTIC;
- Antimetabolites including folic acid analogues such as methotrexate (amethopterin) ; pyrimidine analogues such as fluorouracil (5- fluorouracil ; 5-FU) , floxuridine (fluorodeoxyuridine; FUdR) and cytarabine (cytosine arabinoside) ; and purine analogues and related inhibitors such as mercaptopurine ( 6-mercaptopurine ; 6-MP) ,
- thioguanine 6-thioguanine ; TG
- pentostatin (2'- deoxycofonnycin)
- Natural Products including vinca alkaloids such as vinblastine (VLB) and vincristine; epipodophyllotoxins such as etoposide and tenyposide; antibiotics such as dactinomycin
- doxorubicin doxorubicin
- bleomycin bleomycin
- plicamycin mithramycin
- mitomycin Q enzymes such as L-asparaginase ; and biological response modifiers such as interferon alphenomes.
- Miscellaneous agents including platinum coordination complexes such as cisplatin
- hydrazine derivative such as procarbazine (N- methylhydrazine, MIH) ; and adrenocortical suppressant such as mitotane (o, p'-DDD) and aminoglutethimide ; taxol and analogues/derivatives; and hormone agonists/antagonists such as flutamide and tamoxifen.
- a further preferred cytotoxic agent is Gemcitabine (Gemzar®) .
- a further preferred cytotoxic agent is Paclitaxel bound to human serum albumin
- Anti-angiogenic agents are well known in the art and include anticancer agents such as bevacizumab, itraconazole, and
- Immunotherapeutic agents include, for example, anti-programmed cell death protein 1 (PD-1) antibodies and anti-programmed death-ligand 1 (PD-L1) antibodies, including
- Nivolumab (MDX1106) and Pembrolizumab (MK-3475) .
- the conjugates of the present invention may be comprised in
- compositions with a pharmaceutically acceptable excipient .
- a pharmaceutically acceptable excipient may be a compound or a combination of compounds entering into a pharmaceutical composition which does not provoke secondary reactions and which allows, for example, facilitation of the administration of the conjugate, an increase in its lifespan and/or in its efficacy in the body or an increase in its solubility in solution.
- These pharmaceutically acceptable vehicles are well known and will be adapted by the person skilled in the art as a function of the mode of administration of the conjugate.
- conjugates of the present invention may be provided in a lyophilised form for reconstitution prior to
- lyophilised conjugates may be reconstituted in sterile water and mixed with saline prior to
- Conjugates of the present invention will usually be administered ⁇ the form of a pharmaceutical composition, which may comprise at least one component in addition to the conjugate.
- compositions may comprise, in addition to the conjugate, a pharmaceutically acceptable excipient, carrier, buffe stabilizer or other materials well known to those skilled in the art. Such materials should be non-toxic and should not interfere with the efficacy of the conjugate.
- a pharmaceutically acceptable excipient such materials should be non-toxic and should not interfere with the efficacy of the conjugate.
- carrier or other material will depend on the route of
- administration which may be by bolus, infusion, injection or any other suitable route, as discussed below.
- composition comprising the conjugate may be in the form of a parenterally acceptable aqueous solution which is pyrogen free and has suitable pH, isotonicity and stability.
- a parenterally acceptable aqueous solution which is pyrogen free and has suitable pH, isotonicity and stability.
- isotonic vehicles such as Sodium Chloride Injection, Ringer's Injection, Lactated Ringer's Injection
- Preservatives, stabilizers, buffers, antioxidants and/or other additives may be employed as required including buffers such as phosphate, citrate and other organic acids; antioxidants, such as ascorbic acid and methionine; preservatives (such as
- octadecyldimethylbenzyl ammonium chloride hexamethonium chloride; benzalkonium chloride; benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens, such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol ; 3'-pentanol; and m-cresol); low molecular weight polypeptides; proteins, such as serum albumin, gelatin or immunoglobulins; hydrophilic polymers, such as
- polyvinylpyrrolidone amino acids, such as glycine, glutamine, asparagines, histidine, arginine, or lysine; monosaccharides, disaccharides and other carbohydrates including glucose, mannose or dextrins; chelating agents, such as EDTA; sugars, such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions, such as sodium; metal complexes (e.g. Zn-protein complexes); and/or non- ionic surfactants, such as TWEENTM, PLURONICSTM or polyethylene glycol (PEG) .
- amino acids such as glycine, glutamine, asparagines, histidine, arginine, or lysine
- monosaccharides, disaccharides and other carbohydrates including glucose, mannose or dextrins such as EDTA
- sugars such as sucrose, mannitol, trehalose or sorbito
- the subject may be a human, a companion animal (e.g. a dog or cat), a laboratory animal (e.g. a mouse, rat, rabbit, pig or non-human primate), a domestic or farm animal (e.g. a pig, cow, horse or sheep) .
- the subject is a human.
- the subject may be a human diagnosed with or classified as being at ris of developing a cancer, e.g., an epithelial tumor, a solid tumor or a blood neoplasm.
- the subject may be a laboratory animal, e.g., a mouse model of a cancer.
- the subject may be a mammal (e.g.
- the subject may be a human having osteoarthritis or RA.
- the subject may be a mammal (e.g. a human) that has been diagnosed with or classified as being at risk of developing an eye disease, such as diabetic retinopathy or macular degeneration.
- the anti-ENG conjugates described herein find use in the treatment of a tumor in a mammalian subject.
- the tumor may be a solid tumor.
- the tumor may be a pancreatic cancer, breast cancer, melanoma, Ewing sarcoma, lung cancer, head & neck cancer, ovarian cancer, bladder cancer or colon cancer.
- the anti-ENG antibody or the antibody drug conjugate may be for use in the treatment of an inflammatory condition.
- ENG expression has been reported in osteoarthritis and rheumatoid arthritis. See, e.g., Szekanecz, Z. et al . Clinical Immunology and Immunopathology, 1995, 76, 187-194, and Leask A et al . , Arthritis & Rheumatism, 2002, 46, 1857-1865.
- antibodies described herein, and/or conjugates thereof described herein are able to ameliorate osteoarthritis, rheumatoid arthritis and/or symptoms of osteoarthritis or rheumatoid arthritis.
- the anti-ENG antibody or the antibody drug conjugate may be for use in the treatment of an eye disease (e.g. diabetic retinopathy or macular degeneration, such as age related macular degeneration) .
- ENG expression has been reported in certain eye conditions, including macular degeneration and retinopathy. See, e.g., Tsutomu Yasukawa et al., Curr Eye Res. 2000, 21, 952-961, and Abu El-Asrar AM et al . , Mediators Inflamm. 2012,2012:697489, and Malik RA et al . , J Cell MoI Med. 2005, 9:692-7.
- the present inventors believe that the anti-ENG antibodies described herein, and/or conjugates thereof described herein, are able to ameliorate eye diseases and/or symptoms thereof (including diabetic retinopathy or macular
- degeneration such as age related macular degeneration
- Anti-ENG scFvs isolated from synthetic antibody phage libraries have been described previously (29) .
- One scFv, directed against the extracellular region of human ENG, known as "A5" (29) and one scFv, directed against the extracellular region of murine ENG, known as "mE12" (31) were converted into full-length IgG for subsequent characterisation studies and for generation of immunotoxins and ADCs .
- All scFvs were produced in E. coli and purified by IMAC, IgGs were produced in mammalian cells (CHO) using the Lonza GS expression vectors pEE6.4 and pEE14.4 developed for antibody production.
- Table 1 antibodies, specificities, subclass, and vectors used as starting material
- scFvs were bacterially produced in E.coli TGI and purified from the periplasmic extracts of 1L cultures by IMAC. Plasmids corresponding to full length IgGl antibodies were generated and transfected into CHO cells for production of antibodies in Lonza' s CHO expressing system with yields of approximately 1 mg/L of cell culture (lab scale) . Antibodies were purified from cell culture supernatant by protein A chromatography. Purified proteins were characterized by SDS-PAGE and size exclusion chromatography.
- Bioactivity was analyzed by ELISA using recombinant ENG and
- amino acid sequences of anti-human ENG IgGl A5 (A5-IgGl) heavy chain (HC) and light chain (LC) are shown below:
- VH domain is underlined; CDRH1-H3 are shown in bold and curved underlined .
- NNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSP VTKSFNRGEC SEQ ID NO: 2
- VL domain is underlined; CDRL1-L3 are shown in bold and curved underlined .
- NNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSP VTKSFNRGEC SEQ ID NO: 4
- A5-VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAIYGSDGDTTYADSVKGRF TISRDNSKNTLYLQMNSLRAEDTAVYYCARVFYTAGFDYWGQGTLVTVSS (SEQ ID NO: 5)
- SYAMS (SEQ ID NO: 7) A5-CDRH2 :
- AIYGSDGDTTY (SEQ ID NO: 8) A5-CDRH3 :
- VFYTAGFDY (SEQ ID NO: 9) A5-CDRL1 :
- RASQSISSSLN (SEQ ID NO: 10) A5-CDRL2 :
- AASSLQS (SEQ ID NO: 11) A5-CDRL3 :
- VH domain is underlined
- VL domain is underlined mE12-IgGl-HC - without signal sequence:
- ATGTWVMS (SEQ ID NO: 21) mE12-CDRLl :
- GKNNRPS (SEQ ID NO: 23) mE12-CDRL3 :
- NSRDSSGTV SEQ ID NO: 24
- Figure 2 shows flow cytometry analysis of binding of mE12-IgG to a) B16 cells using 50 g/ml antibody, b) B16 cells using 5 g/ml antibody, and c) HT1080 cells included as negative control.
- Figure 3 demonstrates concentration-dependent binding of A5-IgG to human ENG by a) ELISA and b) flow cytometry analysis .
- the antibody constructs were cloned in GS double vectors (pEE14.4) .
- the DNA plasmids were transformed, amplified, and transiently transfected into CHOK1SV cells for expression evaluation at a volume of 200 ml.
- the antibodies were transiently expressed in 5-10 L large scale cultures.
- Clarified culture supernatant was purified using one-step Protein A chromatography.
- Product quality analysis through SE-HPLC, SDS-PAGE and LAL was carried out using purified material at a concentration of 1 mg/ml, alongside an in-house human antibody as a control sample .
- the purified protein samples were filtered through a 0.2 ⁇ filter and analysed by SE-HPLC chromatograms .
- the mE12-IgG was purified to >98.8%.
- the A5-IgG was purified to >90%.
- the endotoxin levels were ⁇ 0.5 EU/mg.
- Purified proteins A5-IgG and mE12-IgG were characterized by SDS-PAGE and size exclusion chromatography. Bioactivity was analyzed by ELISA, using recombinant mouse/human ENG and detection of bound antibodies with HRP-conj ugated anti-human IgG antibodies. Cell binding was analyzed by flow cytometry, using ENG-positive HT1080 and ENG expressing mouse eEnd2. Melting points were determined by dynamic light scattering using a zetasizer nano . Affinities were determined by QCM using an Attana A100. Internalization study was performed by indirect immunofluorescence confocal microscopy on permeabilized cells, detecting bound and internalized antibodies with a FITC-labeled secondary antibody. The full-length IgGl purified antibodies were successfully produced at both lab scale and large scale, for the generation of
- Figure 9 shows internalization of anti-huENG A5 IgGl .
- Example 3 Nigrin-b A-chain
- the enzymatic domain of Nigrin b was cloned and expressed in bacteria.
- Nigrin-b A-chain was synthetized taking into account codon
- Nigrin pET30b-3 and Nigrin pET33b-l (+/- His tag) for expression in two different E. coli strains, E. coli BLR ( DE3 ) and E. coli HMS174 (DE3) .
- E. coli BLR DE3
- E. coli HMS174 DE3
- Different culture media were used to check different expression conditions.
- Process purification was established using Capto Q chromatography and SP Sepharose High Performance. Purified recombinant Nigrin-b A-chain (recNgA) was formulated at 5mg/ml in PBS IX pH7.4, DTT 0.5 mM, glycerol 10%.
- Endotoxin levels were ⁇ lEU/mg of Nigrin and the purity >99% in monomeric form.
- Nigrin-b A-chain has the following characteristics: Number of amino acids: 256
- nucleo ' ide sequent e encoding recombinan Nigrin-b - -chain is as follows :
- -Dialysis solution Citric acid/NaOH 25mM pH5.0.
- -Capto Q FPLC Equilibration buffer A: Glycine/NaOH 50 mM pH9.5.
- Elution buffer B Glycine/NaOH 50mM pH9.5, NaCl 1 M.
- AIM Auto Inducible Medium
- Protein expression was triggered by lactose activation and glucose depletion after about 3-4 hours of growth. Then, the temperature was lowered to 20 °C for an overnight duration.
- each cell pellet was initially resuspended in 80ml of extraction buffer per liter of culture, and 3 cycles of 7 minutes disintegration at 1100-110 Bar were performed after 30 minutes of incubation at 8°C under shaking. Then the extract underwent 60 minutes centrifugation at 15, 900g, 8°C. The supernatant was the purification's starting material.
- Capto Q FPLC 160ml of extracted product from 81 culture were loaded into 160ml Capto Q and equilibrated using 4CV of equilibration buffer and washed with 15CV of equilibration buffer. Elution was carried in three steps: 15CV at 1.5mS/cm (7.6%B); 20CV at 23.8 mS/cm (18.9%B) ; 20CV 100%B.
- Dialysis was performed at the following conditions: 650ml of the product were dialyzed in 4x5Lbathsin in citric acid/NaOH 25 mM pH5.0, cut-off 6-8000Da. Dialysis factor -3500, ⁇ 24h.
- SP Sepharose HP 610ml of dialyzed pool of Capto Q in Citric acid 25 mM pH5.0 were loaded into 240ml SP Sepharose High Performance with 4CV of equilibration buffer and washed with 15CV of
- recNgA is stable at pH ranging from 5 to 9, and in presence or not of glycerol (from 10 to 45%) (data not shown) .
- the ribosome-inactivating protein (RIP) activity of recombinant Nigrin-b A-chain was tested in rabbit reticulocyte cell-free lysates: IC50 value obtained was similar to native nigrin-b and within 2.5 to 25 pM range (see Figure 5) .
- the A chain from Nigrin-b expressed as a recombinant protein in bacteria, maintains its enzymatic activity, supporting that glycosylation is not required for RIP activity of Nigrin-b A-chain.
- RecNgA retains its activity in rabbit reticulocyte cell-free lysates if stored frozen at (-80°C) and below 3 freeze-thaw cycles (not shown) .
- recNgA The cytotoxic activity of recNgA was tested on cell cultures through crystal violet-based viability assay.
- recNgA lacking the B chain to translocate within cells, presents a 100 to 1000 less toxic activity than native Nigrin-b, as shown in Figure 6.
- Native nigrin b showed an IC5o 3 ⁇ 4 2xlO "8 M (similar to previous published data see 37), while recNgA showed an IC 5 o ⁇ 2xlO "6 M .
- Nigrin b presents higher RIP activity than Ricin in RRL assay, while it is much less toxic (30-10,000 time, approximately) in cells or in vivo (see IC50 and LD50 values in Table 3) .
- Ricin A chain loses activity in both RRL assay and cytotoxicity assay.
- Nigrin b A chain generated for the first time in this present invention, only loses activity in cell cytotoxicity assay, while it was even increased in RRL assay with respect to native Nigrin b.
- Nigrin b A chain is 50 times more active than Ricin A chain in RRL.
- Nigrin b A chain conjugates present higher cytotoxic activity (IC50 within pM range) than Ricin A chain conjugates (nM range) (not shown) .
- Table 3 In vitro and in vivo activity data for Ricin and Nigrin b (native and A chain) .
- Example 4 Conjugation of Nigrin-b A-chain to anti-ENG antibodies
- the RIP must be released from the targeting vehicle in fully active form, which requires avoiding steric hindrance (38) .
- the disulfide bond is the only type of linkage that fit this criterium (39, 40) .
- SPDP has already been used in the making of immunotoxins (ITs) containing nigrin b (36, 42) . Moreover SMPT protects the disulfide bond from attack by thiolate anions, improving in vivo stability of the linkage (43, 44) .
- DTT Dithiothreitol
- the recNgA sample was incubated in the presence of 4.8 mM DTT at room temperature for 30 min.
- the A280 of the aliquots was taken and the two most concentrated mixed.
- A280 was taken again.
- cysteine residues are involved in maintaining the tertiary and/or quaternary structure of the protein, so that it is not possible to reduce them without loss of the specific protein functions. Moreover, presumably some of the cysteine residues are not sterically accessible, as it was demonstrated by the 10 thiols groups per immunoglobulin that had to be generated for an optimal conjugation to an activated RIP (45) .
- hetero-bifunctional reagents chemically inserted using hetero-bifunctional reagents, and several methods have been developed in order to generate hetero-conjugates avoiding or reducing to a minimum the formation of homopolymers .
- the reagents used to introduce thiol groups react with amino groups, forming amide or amidine bonds. Amino groups are reactive, abundant and, in a limited way for most proteins,
- N-succynimidyl 3— 2-pyridyl-dithiopropionate )
- SPDP 2-pyridyl-dithiopropionate
- SMPT 4-succynimidyloxycarbonyl-a-methyl-a- (2-pyridyl- dithio ) toluene
- 2-pyridyl disulphide groups into the protein by reacting with amino groups to form neutral amides, and methyl 4-mercaptobutyrimidate (2-iminothiolane .
- the reaction with Ellman' s reagent is also used for the quick measurement of protein sulphydryl groups (45, 46) .
- SMPT has a methyl group and a benzene ring attached to the carbon atom adjacent to disulphide bond that protects it from attack by thiolate anions, thus improving the in vivo stability of the linkage (43, 44) .
- IgG proteins can be modified with SMPT, which do not significantly affect the antigen binding property of the molecules in the following conditions, even if they change the charge of the protein in the reaction site.
- the present inventors investigated conjugating IgGls with recNgA, using 2 different recNgA:mAb molar ratio of 2.5 and 3.5, after derivatization using an SMPT:mAb molar ratio of 6, following conjugation protocols (see 40) . Purification was performed by Size Exclusion chromatography on Sephacryl S200 (see 41) .
- the immunotoxin is predominantly a mixture of antibody linked to one or two toxin molecules, with the presence of high molecular weight components (IgG linked to several RIP proteins) , as well as free and polymeric RIPs (dimeric in the case of recNgA) and free antibody.
- IgG linked to several RIP proteins high molecular weight components
- free and polymeric RIPs dimeric in the case of recNgA
- IC50 values obtained for the native Nigrin-b or recNgA were in the 2.5pM range and those for conjugates were similar and within 1-0.5pM range, even higher than native Nigrin-b positive control, showing that antibody conjugation did not affect the enzymatic activity of recNgA .
- cytolysins employed for conjugation studies were chosen from the general structure shown above (formula IV) . These structures exhibit activity against different cancer cell lines (nM to pM range) .
- vcPABA valine-citrulline-PABC protease-cleavable linker
- ADC molecule Brentuximab Vedotine, developed by Seattle Genetics and Takeda, and recently approved by the FDA and EMEA as Adcetris® (2011, and Nov. 2012, respectively)
- vcPABA has been coupled at its free NH2 to maleimide caproyl for thiol-based conjugation on mAb (cACIO anti-CD30
- vcPABA has been conjugated through its COOH to the Auristatin cytotoxic drug from Seattle Genetics (MMAE) . (see 48j
- the present inventors have used this linker (maleimide caproyl- vcPABA) to conjugate anti-ENG antibodies through thiol-based reaction with the maleimide caproyl, and on the other end, to the cytolysin cytotoxic molecules through its cyclic piperidine with vcPABA ( Ri or R4 positions of the cytolysin shown in Figure 8) .
- TAM461 (Tubulysin/Cytolysin) : 30.0 mg (0.041 mmol)
- TAM461 and TAM465 were dissolved in anhydrous DMF under dry conditions and the resulting solution was treated with HOBt and DIPEA. The reaction was stirred at RT for 18h. The reaction mixture was concentrated and the resulting oil was purified by column chromatography using 2-6% methanol: DCM to give 35 mg (64%) of
- TAM470 and TAM466 were dissolved in anhydrous DMF under dry
- In vitro activity testing is performed. Functional activity is evaluated through microtubule inhibition assay, while cytotoxic activity is determined through crystal violet viability assay.
- Rl TAM467, TAM551
- R4 TAM471, TAM553, TAM558
- EG ethylene-glycol spacer
- TPI tubulin polymerization inhibition assay
- CPA cell proliferation arrest on HT1080 cells
- TAM334 In vitro activity of parental cytolysin TAM334 is within the same range of other payloads currently used for the generation of antibody-drug conjugates such as auristatins (MMAE) or maytansinoids (DM1-DM4) .
- MMAE auristatins
- DM1-DM4 maytansinoids
- HIC Hydrophobic Interaction Chromatography
- PLRP Polymeric liquid reversed-phase chromatography
- the various drugs produced different levels of aggregation.
- a preliminary conjugation with TAM467 also showed high level of aggregation: at DAR 3.27, SEC purity was already only 67% with 16% of free drug (data not shown) .
- ADC-471 and ADC-553 showed low and no antigen-specific cytotoxic activity ( ⁇ and ⁇ IC50 range, respectively) with no difference between wild type (WT) and antigen (AG) expressing HT1080 cells
- ADC-558 presented a 1 nM range specific cytotoxic activity with a specificity ratio of 500 between AG and WT HT1080 cells.
- immunoconjugates a highest tolerated dose of 0.5mg/kg was found, while cytolysin conjugates, independently of the derivative used, were administrated at doses from 2.5mg/kg up to 20mg/kg, without any weight loss or toxic effect. Immunoconj ugates were then administrated once a week
- the recNgA immunoconj ugates presented a high in vivo anti- tumoral efficacy (60%) at a dose of 0.5 mg/kg in PDX murine models of pancreas cancer ( Figure 11A) . When combined with Gemcitabine, it even showed 100% tumor growth inhibition and tumor regression.
- Tumor cell plasticity enables certain types of highly malignant tumor cells to dedifferentiate and engage a plastic multipotent embryonic-like phenotype, which enables them to 'adapt' during tumor progression and escape conventional therapeutic strategies.
- the present inventors hypothesize the therapeutic potential of anti- ENG monoclonal antibodies, ITs and ADCs, in the treatment of Ewing Sarcoma .
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Organic Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Immunology (AREA)
- Epidemiology (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Molecular Biology (AREA)
- General Engineering & Computer Science (AREA)
- Biophysics (AREA)
- Microbiology (AREA)
- Cell Biology (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- Diabetes (AREA)
- Rheumatology (AREA)
- Endocrinology (AREA)
- Gastroenterology & Hepatology (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Ophthalmology & Optometry (AREA)
- Physical Education & Sports Medicine (AREA)
- Hematology (AREA)
- Mycology (AREA)
- Heart & Thoracic Surgery (AREA)
- Pain & Pain Management (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| DK15705779.5T DK3102606T3 (en) | 2014-02-06 | 2015-02-04 | ANTIBODY MEDICINAL CONJUGATES AND IMMUNTOXINES |
| PL15705779T PL3102606T3 (pl) | 2014-02-06 | 2015-02-04 | Koniugaty przeciwciało-lek i immunotoksyny |
| ES15705779T ES2701188T3 (es) | 2014-02-06 | 2015-02-04 | Conjugados anticuerpo-fármaco e inmunotoxinas |
| CA2937600A CA2937600C (en) | 2014-02-06 | 2015-02-04 | Antibody-drug conjugates and immunotoxins |
| CN201580007513.8A CN105980411B (zh) | 2014-02-06 | 2015-02-04 | 抗体-药物缀合物和免疫毒素 |
| KR1020167021450A KR102342934B1 (ko) | 2014-02-06 | 2015-02-04 | 항체-약물 접합체 및 면역독소 |
| EP15705779.5A EP3102606B1 (en) | 2014-02-06 | 2015-02-04 | Antibody-drug conjugates and immunotoxins |
| JP2016550786A JP6616776B2 (ja) | 2014-02-06 | 2015-02-04 | 抗体−薬物複合体及び免疫毒素 |
| US15/116,419 US10004812B2 (en) | 2014-02-06 | 2015-02-04 | Antibody-drug conjugates and immunotoxins |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| GB1402009.3 | 2014-02-06 | ||
| GB201402009A GB201402009D0 (en) | 2014-02-06 | 2014-02-06 | Antibody-drug conjugates and immunotoxins |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2015118031A2 true WO2015118031A2 (en) | 2015-08-13 |
| WO2015118031A3 WO2015118031A3 (en) | 2015-10-01 |
Family
ID=50390520
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2015/052342 Ceased WO2015118031A2 (en) | 2014-02-06 | 2015-02-04 | Antibody-drug conjugates and immunotoxins |
Country Status (12)
| Country | Link |
|---|---|
| US (1) | US10004812B2 (https=) |
| EP (1) | EP3102606B1 (https=) |
| JP (1) | JP6616776B2 (https=) |
| KR (1) | KR102342934B1 (https=) |
| CN (1) | CN105980411B (https=) |
| CA (1) | CA2937600C (https=) |
| DK (1) | DK3102606T3 (https=) |
| ES (1) | ES2701188T3 (https=) |
| GB (1) | GB201402009D0 (https=) |
| HU (1) | HUE040517T2 (https=) |
| PL (1) | PL3102606T3 (https=) |
| WO (1) | WO2015118031A2 (https=) |
Cited By (15)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11229708B2 (en) | 2015-12-04 | 2022-01-25 | Seagen Inc. | Conjugates of quaternized tubulysin compounds |
| WO2023133595A2 (en) | 2022-01-10 | 2023-07-13 | Sana Biotechnology, Inc. | Methods of ex vivo dosing and administration of lipid particles or viral vectors and related systems and uses |
| US11793880B2 (en) | 2015-12-04 | 2023-10-24 | Seagen Inc. | Conjugates of quaternized tubulysin compounds |
| WO2024040195A1 (en) | 2022-08-17 | 2024-02-22 | Capstan Therapeutics, Inc. | Conditioning for in vivo immune cell engineering |
| WO2024081820A1 (en) | 2022-10-13 | 2024-04-18 | Sana Biotechnology, Inc. | Viral particles targeting hematopoietic stem cells |
| WO2024119157A1 (en) | 2022-12-02 | 2024-06-06 | Sana Biotechnology, Inc. | Lipid particles with cofusogens and methods of producing and using the same |
| WO2024243340A1 (en) | 2023-05-23 | 2024-11-28 | Sana Biotechnology, Inc. | Tandem fusogens and related lipid particles |
| WO2024249954A1 (en) | 2023-05-31 | 2024-12-05 | Capstan Therapeutics, Inc. | Lipid nanoparticle formulations and compositions |
| WO2025076127A1 (en) | 2023-10-05 | 2025-04-10 | Capstan Therapeutics, Inc. | Constrained ionizable cationic lipids and lipid nanoparticles |
| WO2025076113A1 (en) | 2023-10-05 | 2025-04-10 | Capstan Therapeutics, Inc. | Ionizable cationic lipids with conserved spacing and lipid nanoparticles |
| EP4537854A1 (en) * | 2023-10-04 | 2025-04-16 | Formosa Laboratories, Inc. | Compound for conjugation, conjugate and pharmaceutical composition comprising the same |
| WO2025141153A1 (en) * | 2023-12-29 | 2025-07-03 | Oncomatryx Biopharma, S.L. | Endo180 targeted antibody-drug conjugates |
| WO2025184529A1 (en) | 2024-03-01 | 2025-09-04 | Sana Biotechnology, Inc. | Viral particles with fusogen display and related compositions and methods |
| WO2025217454A2 (en) | 2024-04-11 | 2025-10-16 | Capstan Therapeutics, Inc. | Ionizable cationic lipids and lipid nanoparticles |
| WO2025217452A1 (en) | 2024-04-11 | 2025-10-16 | Capstan Therapeutics, Inc. | Constrained ionizable cationic lipids and lipid nanoparticles |
Families Citing this family (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AU2015346444A1 (en) | 2014-11-12 | 2017-05-04 | Tracon Pharmaceuticals, Inc. | Anti-endoglin antibodies and uses thereof |
| WO2018187158A1 (en) * | 2017-04-07 | 2018-10-11 | Tracon Pharmaceuticals, Inc. | Combination therapy of cancer with anti-endoglin antibodies and anti-programmed death receptor agents |
| WO2018222882A1 (en) * | 2017-06-01 | 2018-12-06 | Health Research, Inc. | Strong potentiation of immune checkpoint blockade therapy of cancer by combination with endoglin-targeting therapy |
| ES2974288T3 (es) | 2017-08-10 | 2024-06-26 | Sumitomo Pharma Co Ltd | Conjugados de anticuerpo-fármaco que incluyen un derivado de hemiasterlina |
| TWI799438B (zh) * | 2017-08-10 | 2023-04-21 | 日商住友製藥股份有限公司 | 半星芒體衍生物及此等之抗體藥物複合體 |
| JP2017214419A (ja) * | 2017-08-18 | 2017-12-07 | 学校法人関西医科大学 | 白血病改善剤 |
| JP7262817B2 (ja) * | 2017-12-31 | 2023-04-24 | ハンジョウ ディーエーシー バイオテック シーオー.,エルティディ. | 分岐連結体を備えたチューブリシン類縁体の共役体 |
| US11981000B2 (en) | 2018-12-18 | 2024-05-14 | 3M Innovative Properties Company | Coated abrasive articles and methods of making coated abrasive articles |
| JP7560255B2 (ja) * | 2019-02-13 | 2024-10-02 | 住友ファーマ株式会社 | ヘミアスタリン誘導体を含む抗体薬物複合体を含有する医薬 |
| US12178879B2 (en) | 2019-02-13 | 2024-12-31 | Sumitomo Pharma Co., Ltd. | Hemiasterlin derivative and antibody-drug conjugate thereof |
| US12312419B2 (en) | 2019-02-13 | 2025-05-27 | Sumitomo Pharma Co., Ltd. | Hemiasterlin derivative having cysteine residue |
Family Cites Families (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5776427A (en) * | 1992-03-05 | 1998-07-07 | Board Of Regents, The University Of Texas System | Methods for targeting the vasculature of solid tumors |
| US7097836B1 (en) * | 2002-10-23 | 2006-08-29 | Health Research, Inc. | Method for increasing the efficacy of anti-tumor agents by anti-endoglin antibody |
| CN104127878A (zh) * | 2007-03-14 | 2014-11-05 | 恩多塞特公司 | 结合配体连接的微管溶素递药缀合物 |
| US8980833B2 (en) | 2007-05-10 | 2015-03-17 | R&D-Biopharmaceuticals Gmbh | Tubulysine derivatives |
| US8221753B2 (en) * | 2009-09-30 | 2012-07-17 | Tracon Pharmaceuticals, Inc. | Endoglin antibodies |
| EP2486023A4 (en) * | 2009-10-06 | 2014-05-07 | Immunogen Inc | EFFICIENT CONJUGATES AND HYDROPHILIC BINDER |
| WO2012135517A2 (en) * | 2011-03-29 | 2012-10-04 | Immunogen, Inc. | Preparation of maytansinoid antibody conjugates by a one-step process |
| US9255595B2 (en) * | 2011-04-29 | 2016-02-09 | Bae Systems Information And Electronic Systems Integration Inc. | Optical dome bezel |
| CN104244718A (zh) | 2011-12-05 | 2014-12-24 | 伊格尼卡生物治疗公司 | 抗体-药物缀合物以及相关化合物、组合物和方法 |
| PL2872157T3 (pl) | 2012-07-12 | 2020-07-13 | Hangzhou Dac Biotech Co., Ltd | Koniugaty wiążących komórkę cząsteczek ze środkami cytotoksycznymi |
| WO2015113760A1 (en) | 2014-01-28 | 2015-08-06 | Tube Pharmaceuticals Gmbh | Cytotoxic tubulysin compounds for conjugation |
-
2014
- 2014-02-06 GB GB201402009A patent/GB201402009D0/en not_active Ceased
-
2015
- 2015-02-04 PL PL15705779T patent/PL3102606T3/pl unknown
- 2015-02-04 EP EP15705779.5A patent/EP3102606B1/en active Active
- 2015-02-04 DK DK15705779.5T patent/DK3102606T3/en active
- 2015-02-04 WO PCT/EP2015/052342 patent/WO2015118031A2/en not_active Ceased
- 2015-02-04 HU HUE15705779A patent/HUE040517T2/hu unknown
- 2015-02-04 ES ES15705779T patent/ES2701188T3/es active Active
- 2015-02-04 CN CN201580007513.8A patent/CN105980411B/zh active Active
- 2015-02-04 JP JP2016550786A patent/JP6616776B2/ja active Active
- 2015-02-04 CA CA2937600A patent/CA2937600C/en active Active
- 2015-02-04 US US15/116,419 patent/US10004812B2/en active Active
- 2015-02-04 KR KR1020167021450A patent/KR102342934B1/ko active Active
Cited By (17)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11229708B2 (en) | 2015-12-04 | 2022-01-25 | Seagen Inc. | Conjugates of quaternized tubulysin compounds |
| US11793880B2 (en) | 2015-12-04 | 2023-10-24 | Seagen Inc. | Conjugates of quaternized tubulysin compounds |
| WO2023133595A2 (en) | 2022-01-10 | 2023-07-13 | Sana Biotechnology, Inc. | Methods of ex vivo dosing and administration of lipid particles or viral vectors and related systems and uses |
| WO2024040195A1 (en) | 2022-08-17 | 2024-02-22 | Capstan Therapeutics, Inc. | Conditioning for in vivo immune cell engineering |
| WO2024040194A1 (en) | 2022-08-17 | 2024-02-22 | Capstan Therapeutics, Inc. | Conditioning for in vivo immune cell engineering |
| WO2024081820A1 (en) | 2022-10-13 | 2024-04-18 | Sana Biotechnology, Inc. | Viral particles targeting hematopoietic stem cells |
| WO2024119157A1 (en) | 2022-12-02 | 2024-06-06 | Sana Biotechnology, Inc. | Lipid particles with cofusogens and methods of producing and using the same |
| WO2024243340A1 (en) | 2023-05-23 | 2024-11-28 | Sana Biotechnology, Inc. | Tandem fusogens and related lipid particles |
| WO2024249954A1 (en) | 2023-05-31 | 2024-12-05 | Capstan Therapeutics, Inc. | Lipid nanoparticle formulations and compositions |
| EP4537854A1 (en) * | 2023-10-04 | 2025-04-16 | Formosa Laboratories, Inc. | Compound for conjugation, conjugate and pharmaceutical composition comprising the same |
| TWI905962B (zh) * | 2023-10-04 | 2025-11-21 | 台耀化學股份有限公司 | 用於綴合之化合物、綴合物及包含其之醫藥組成物 |
| WO2025076127A1 (en) | 2023-10-05 | 2025-04-10 | Capstan Therapeutics, Inc. | Constrained ionizable cationic lipids and lipid nanoparticles |
| WO2025076113A1 (en) | 2023-10-05 | 2025-04-10 | Capstan Therapeutics, Inc. | Ionizable cationic lipids with conserved spacing and lipid nanoparticles |
| WO2025141153A1 (en) * | 2023-12-29 | 2025-07-03 | Oncomatryx Biopharma, S.L. | Endo180 targeted antibody-drug conjugates |
| WO2025184529A1 (en) | 2024-03-01 | 2025-09-04 | Sana Biotechnology, Inc. | Viral particles with fusogen display and related compositions and methods |
| WO2025217454A2 (en) | 2024-04-11 | 2025-10-16 | Capstan Therapeutics, Inc. | Ionizable cationic lipids and lipid nanoparticles |
| WO2025217452A1 (en) | 2024-04-11 | 2025-10-16 | Capstan Therapeutics, Inc. | Constrained ionizable cationic lipids and lipid nanoparticles |
Also Published As
| Publication number | Publication date |
|---|---|
| EP3102606B1 (en) | 2018-09-12 |
| EP3102606A2 (en) | 2016-12-14 |
| US10004812B2 (en) | 2018-06-26 |
| KR102342934B1 (ko) | 2021-12-24 |
| PL3102606T3 (pl) | 2019-05-31 |
| KR20160113623A (ko) | 2016-09-30 |
| HUE040517T2 (hu) | 2019-03-28 |
| CN105980411A (zh) | 2016-09-28 |
| JP6616776B2 (ja) | 2019-12-04 |
| CA2937600A1 (en) | 2015-08-13 |
| WO2015118031A3 (en) | 2015-10-01 |
| CN105980411B (zh) | 2020-10-30 |
| US20170007714A1 (en) | 2017-01-12 |
| GB201402009D0 (en) | 2014-03-26 |
| JP2017506234A (ja) | 2017-03-02 |
| CA2937600C (en) | 2023-01-03 |
| ES2701188T3 (es) | 2019-02-21 |
| DK3102606T3 (en) | 2018-12-17 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10864278B2 (en) | Antibody-drug conjugates and immunotoxins | |
| CA2937600C (en) | Antibody-drug conjugates and immunotoxins | |
| TWI883057B (zh) | 抗pd-l1抗體及抗體藥物結合物 | |
| JP6333882B2 (ja) | 抗体−薬剤コンジュゲート | |
| US20240409658A1 (en) | Anti-cd228 antibodies and antibody-drug conjugates | |
| EP4253421A2 (en) | Anti-her2 biparatopic antibody-drug conjugates and methods of use | |
| JP2023546293A (ja) | 抗cspg4結合剤、そのコンジュゲートおよびその使用方法 | |
| RU2806049C2 (ru) | Конъюгаты анти-her2 бипаратопных антител-лекарственных веществ и способы их применения | |
| RU2806049C9 (ru) | Конъюгаты анти-her2 бипаратопных антител-лекарственных веществ и способы их применения | |
| BR112016018005B1 (pt) | Conjugados anticorpo-droga e imunotoxinas | |
| EA052759B1 (ru) | Антитела против pd-l1 и конъюгаты антитело-лекарственное средство |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 15705779 Country of ref document: EP Kind code of ref document: A2 |
|
| REEP | Request for entry into the european phase |
Ref document number: 2015705779 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2015705779 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2937600 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 15116419 Country of ref document: US |
|
| ENP | Entry into the national phase |
Ref document number: 20167021450 Country of ref document: KR Kind code of ref document: A Ref document number: 2016550786 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |