WO2014207708A2 - Amino acid and peptide conjugates and conjugation process - Google Patents
Amino acid and peptide conjugates and conjugation process Download PDFInfo
- Publication number
- WO2014207708A2 WO2014207708A2 PCT/IB2014/062648 IB2014062648W WO2014207708A2 WO 2014207708 A2 WO2014207708 A2 WO 2014207708A2 IB 2014062648 W IB2014062648 W IB 2014062648W WO 2014207708 A2 WO2014207708 A2 WO 2014207708A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- amino acid
- peptide
- xaa
- absent
- sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- 0 C*(C(*)(*)*(C)NI)C(*)=C(*)* Chemical compound C*(C(*)(*)*(C)NI)C(*)=C(*)* 0.000 description 8
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/39—Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/60—Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
- A61K2039/6018—Lipids, e.g. in lipopeptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/62—Medicinal preparations containing antigens or antibodies characterised by the link between antigen and carrier
- A61K2039/627—Medicinal preparations containing antigens or antibodies characterised by the link between antigen and carrier characterised by the linker
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/16011—Herpesviridae
- C12N2710/16111—Cytomegalovirus, e.g. human herpesvirus 5
- C12N2710/16134—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
Definitions
- Synthetic peptide vaccines generally comprise a synthetic copy of an immunogenic part of protein antigens. This approach to vaccine development has a number of advantages, including ease of synthesis, avoidance of potentially toxic biological by-products and straightforward characterisation.
- An alternative strategy in peptide vaccine design is to create self-adjuvanting vaccines in which the peptide epitope of interest is covalently linked to an appropriate adjuvant.
- Such self-adjuvanting vaccines may have enhanced antigen uptake, presentation and dendritic cell maturation compared to simple co-formulation of the antigen with an external adjuvant.
- the amino acid-comprising conjuation partner is a peptide- containing conjugation partner
- the lipid-containing conjugation partner is coupled to the peptide of the peptide-containing conjugation partner
- the present invention provides a method for making a peptide conjugate, the method comprising reacting
- the lipid-containing conjugation partner comprises the carbon- carbon double bond, and the peptide of the peptide-containing conjugation partner comprises the thiol.
- the amino acid-comprising conjugation partner comprises an epitope.
- the peptide-containing conjugation partner comprises an epitope.
- the amino acid-comprising conjugation partner comprises two or more epitopes.
- the peptide-containing conjugation partner comprises two or more epitopes.
- the peptide conjugate comprises two or more epitopes.
- the epitope is a peptide epitope.
- the amino acid-comprising conjugation partner consists of a peptide.
- the amino acid-comprising conjugation partner consists of a peptide comprising a peptide epitope. In one embodiment, the peptide-containing conjugation partner consists of a peptide. In one embodiment, the peptide-containing conjugation partner consists of a peptide comprising a peptide epitope.
- the amino acid-comprising conjugation partner comprises an epitope bound to the or an amino acid of the conjugation partner.
- the peptide-containing conjugation partner comprises an epitope bound to the peptide of the peptide containing conjugation partner.
- the epitope is bound to the peptide via linker group.
- the amino acid-comprising conjugation partner comprises a peptide epitope bound to the or an amino acid of the conjugation partner via a linker group. In some embodiments, the peptide-containing conjugation partner comprises a peptide epitope bound to the peptide via a linker group.
- the method further comprises coupling the amino acid of the amino acid conjugate to an amino acid or a peptide to provide a peptide conjugate.
- coupling a peptide comprises individually coupling one or more amino acids and/or one or more peptides.
- the method further comprises coupling the amino acid of the amino acid conjugate or an amino acid of the peptide conjugate to an amino acid or a peptide so as to provide a peptide conjugate comprising a linker group or one or more amino acids thereof.
- the method further comprises coupling an amino acid of the peptide conjugate comprising a linker group or one or more amino acids thereof to an amino acid or a peptide so as to provide a peptide conjugate comprising a peptide epitope bound to the amino acid to which lipid-containing conjugation partner is conjugated via a linker group.
- the method further comprises coupling the amino acid of the amino acid conjugate or an amino acid of the peptide conjugate to an amino acid or a peptide so as to provide a peptide conjugate comprising a peptide epitope.
- the method further comprises coupling an epitope to the amino acid of the amino acid conjugate or an amino acid of the peptide conjugate. In some embodiments, the method further comprises coupling a peptide epitope to the amino acid of the amino acid conjugate or an amino acid of the peptide conjugate. In some embodiments, the epitope is coupled or bound via a linker group.
- the method further comprises coupling an epitope to the peptide of the peptide conjugate. In some embodiments, the method further comprises coupling a peptide epitope to the peptide of the peptide conjugate. In some embodiments, the epitope is bound to the peptide via a linker group.
- the amino acid-comprising conjugation partner consists of an amino acid.
- the carboxyl group of the C-terminus of the amino acid is protected with a carboxyl protecting group and/or the Na-amino group of the amino acid is protected with an amino protecting group.
- the carboxyl group of the C-terminus of the peptide is protected with a carboxyl protecting group and/or the ⁇ -amino group of the peptide is protected with an amino protecting group.
- the lipid-containing conjugation partner comprises one or more optionally substituted straight or branched aliphatic or heteroaliphatic chains each containing at least 4 chain-linked atoms. In one embodiment, the lipid-containing conjugation partner comprises one or more optionally substituted straight or branched aliphatic or heteroaliphatic chains each containing at least 6 chain-linked atoms. In one specifically contemplated embodiment, the one or more chains are aliphatic. In one specifically contemplated embodiment, the one or more chains are saturated.
- the one or more chains are optionally substituted. In some embodiments, the one or more chains are optionally substituted with one or more aryl groups. In some embodiments, the one or more chains comprise at least 4, 6, 8, 10, 12, or 14 chain-linked atoms. In some embodiments, the one or more chains comprise from 4-22, 6-22, 8-22, 10-22, 12-22, or 14-22 chain-linked atoms.
- the one or more chains are covalently bound to a moiety comprising the carbon-carbon double bond or the thiol by a heteroatom containing functional group.
- heteroatom containing functional groups include but are not limited to ether, amine, sulfide, sulfoxide, sulfone, ester, amide, carbonate, carbamate, and urea groups.
- the one or more chains are covalently bound to the moiety by ester functional groups.
- the lipid-containing conjugation partner comprises one or more saturated or unsaturated fatty acid esters.
- the fatty acid is saturated.
- one or more fatty acid ester is bound to the moiety comprising to carbon-carbon double bond or thiol.
- the ester is an ester of the carboxyl group of the fatty acid and an alcohol of the moiety.
- the fatty acid is a C4-22 fatty acid. In one embodiment, the fatty acid is a C6-22 fatty acid. In another embodiment, the fatty acid is a ClO-22 fatty acid. In yet another embodiment, the fatty acid is a C12-22 fatty acid. In one exemplary embodiment, the fatty acid is a C12, C14, C16, C18, or C20 fatty acid.
- the fatty acid ester is an ester of an alcohol comprising the carbon-carbon double bond or thiol.
- the alcohol is a monohydric, dihydric, or trihydric C2-6 aliphatic alcohol.
- the alcohol is a monohydric or dihydric C2-4 aliphatic alcohol.
- the alcohol is a monohydric C2 aliphatic or monohydric or dihydric C3 aliphatic alcohol.
- the alcohol is a monohydric C2 alcohol.
- the lipid-containing conjugation partner comprises the carbon- carbon double bond.
- the alcohol comprises the carbon-carbon double bond.
- the alcohol is vinyl alcohol.
- the peptide is a synthetic peptide.
- the amino acid-comprising conjugation partner and/or peptide conjugate comprises a synthetic peptide.
- the synthetic peptide is a peptide prepared by a method comprising solid phase peptide synthesis (SPPS).
- the or an amino acid of the amino acid-comprising conjugation partner comprises the carbon-carbon double bond or thiol.
- an amino acid residue of the peptide of the peptide-containing conjugation partner comprises the carbon-carbon double bond or thiol.
- the amino acid residue comprising the carbon-carbon double bond or thiol is a terminal amino acid residue. In some embodiments, the terminal amino acid residue is an N-terminal residue.
- the ⁇ -amino group of the amino acid comprising the carbon- carbon double bond or thiol is acylated.
- the method further comprises acylating the ⁇ -amino group of the amino acid of the amino acid conjugate or the amino acid residue of the peptide conjugate to which the lipid-containing conjugation partner is conjugated. In certain embodiments, the method further comprises acylating the ⁇ -amino group with a C2-20 fatty acid.
- the or an amino acid of the amino acid-comprising conjugation partner comprises the thiol.
- an amino acid residue of the peptide of the peptide-containing conjugation partner comprises the thiol.
- the thiol is the thiol of a cysteine residue.
- the cysteine residue is an N-terminal residue.
- the amino group of the cysteine residue is acylated.
- the amino group is acylated with a C2-20 fatty acid.
- the C2-20 fatty acid is acetyl or palmitoyl. In another exemplary embodiment, the C2-20 fatty acid is acetyl.
- the amino acid-comprising conjugation partner and/or peptide conjugate comprises from 8 to 220, 8 to 200, 8 to 175, 8 to 150, 8 to 125, 8 to 100, 8 to 90, 8 to 80, 8 to 70, 8 to 60, 8 to 50, 8 to 40, 8 to 30, 8 to 25, 8 to 20, or 8 to 15 amino acids.
- the peptide-containing conjugation partner comprises from 8 to 220, 8 to 200, 8 to 175, 8 to 150, 8 to 125, 8 to 100, 8 to 90, 8 to 80, 8 to 70, 8 to 60, 8 to 50, 8 to 40, 8 to 30, 8 to 25, 8 to 20, or 8 to 15 amino acids.
- the amino acid-comprising conjugation partner and/or peptide conjugate comprises a peptide comprising from 8 to 60 amino acids. In one exemplary embodiment, the peptide comprises from 8 to 60 amino acids.
- the amino acid-comprising conjugation partner and/or peptide conjugate comprises from 5 to 220, 8 to 220, 5 to 175, 8 to 175, 8 to 150, 10 to 150, 15 to 125, 20 to 100, 20 to 80, 20 to 60, 25 to 100, 25 to 80, 25 to 60, 30 to 80, 40 to 60, or 50 to 60 amino acids.
- the peptide-containing conjugation partner comprises from 5 to 220, 8 to 220, 5 to 175, 8 to 175, 8 to 150, 10 to 150, 15 to 125, 20 to 100, 20 to 80, 20 to 60, 25 to 100, 25 to 80, 25 to 60, 30 to 80, 40 to 60, or 50 to 60 amino acids.
- the amino acid comprising conjugation partner and/or peptide conjugate comprises from 5 to 150, 5 to 125, 5 to 100, 5 to 75, 5 to 60, 5 to 50, 5 to 40, 5 to 30, 5 to 25, 5 to 20, 8 to 150, 8 to 125, 8 to 100, 8 to 75, 8 to 60, 8 to 50, 8 to 40, 8 to 30, 8 to 25, or 8 to 20 amino acids.
- the peptide-containing conjugation partner comprises from 5 to 150, 5 to 125, 5 to 100, 5 to 75, 5 to 60, 5 to 50, 5 to 40, 5 to 30, 5 to 25, 5 to 20, 8 to 150, 8 to 125, 8 to 100, 8 to 75, 8 to 60, 8 to 50, 8 to 40, 8 to 30, 8 to 25, or 8 to 20 amino acids.
- the amino acid-comprising conjugation partner and/or peptide conjugate comprises one or more solubilising groups.
- the peptide- containing conjugation partner comprises one or more solubilising groups.
- the solubilising group is an amino acid sequence comprising two or more hydrophilic amino acid residues in the peptide chain. In certain embodiments, the solubilising group is an amino acid sequence comprising a sequence of two or more consecutive hydrophilic amino acid residues in the peptide chain. In one embodiment, the hydrophilic amino acid residues are cationic amino acid residues. In one
- the cationic amino acid residues are arginine or lysine residues. In one specifically contemplated embodiment, the cationic amino acid residues are lysine residues. In one embodiment, the sequence comprises from 2 to 20, 2 to 15, 2 to 10, 3 to 7, or 3 to 5 amino acids. In one embodiment, the solubilising group is a tri-, tetra-, penta-, hexa-, or hepta- lysine sequence. In one specifically contemplated embodiment, the solubilising group is a tetralysine sequence.
- the peptide conjugate and/or amino-acid comprising conjugation partner comprises a serine residue adjacent to the amino acid residue to which the lipid- containing conjugation partner is conjugated.
- conjugation partner is conjugated.
- amino acid residue to which the lipid-containing conjugation partner is conjugated is N-terminal.
- the peptide further comprises a consecutive sequence of two or more hydrophilic amino acid residues adjacent to the serine residue.
- the peptide conjugate and/or amino-acid comprising
- conjugation partner comprises a consecutive sequence of two or more hydrophilic amino acid residues adjacent to the serine residue.
- the peptide conjugate and/or amino acid-comprising are independently selected from the group consisting of: the peptide conjugate and/or amino acid-comprising
- conjugation partner comprises only naturally occuring amino acids.
- the peptide-containing conjugation partner comprises only naturally occuring amino acids. In other embodiments, 75% or more, 80% or more, 85% or more, 90% or more, 95% or more, 97% or more, or 99% or more of the amino acid residues in the peptide are naturally occuring amino acids.
- 75% or more, 80% or more, 85% or more, 90% or more, 95% or more, 97% or more, or 99% or more of the amino acid residues in the peptide conjugate and/or amino acid-comprising conjugation partner are naturally occuring amino acids.
- the peptide conjugate and/or amino acid-comprising conjugation partner comprises a peptide comprising a peptide epitope.
- the peptide of the peptide-containing conjugation partner comprises one or more peptide epitopes.
- XaaiXaa 2 Xaa 3 Xaa 4 GARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPL [SEQ ID NO: 1], wherein Xaai is absent or is S, Xaa 2 is absent or is a hydrophilic amino acid, Xaa 3 is absent or is a hydrophilic amino acid, and Xaa 4 is absent or is one or more hydrophilic amino acids, (b) 8 or more contiguous amino acid residues from the sequence
- XaaiXaa 2 GARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPL [SEQ ID NO: 3], wherein Xaai is absent or is S, and Xaa 2 is absent or is from one to four hydrophilic amino acids,
- XaaiXaa 2 Xaa 3 Xaa 4 VPGVLLKEFTVSGNILTIRLTAADHR [SEQ ID NO: 8], wherein Xaai is absent or is S, Xaa 2 is absent or is a hydrophilic amino acid, Xaa 3 is absent or is a hydrophilic amino acid, and Xaa 4 is absent or is one or more hydrophilic amino acids,
- XaaiXaa 2 Xaa 3 VPGVLLKEFTVSGNILTIRLTAADHR [SEQ ID NO:9], wherein Xaai is absent or is S, Xaa 2 is absent or is a hydrophilic amino acid, and Xaa 3 is absent or is from one to ten hydrophilic amino acids, (n) 8 or more contiguous amino acid residues from the sequence
- Ra and Rb at each instance of q are each independently hydrogen, Cl-6alkyl, or C3-6cycloalkyl;
- LI and L2 are each independently C5-21alkyl or C4-20heteroalkyl
- L3 is Cl-21alkyl or C4-20heteroalkyl
- R33 is L2-C(0)-OCl-6alkyl
- Rll is not L2-C(0)-OCl-6alkyl
- p is an integer from 2 to 4
- no more than one Rl l is L2-C(0)-0C1-
- the lipid-containing conjugation partner is a compound of the formula (Al) :
- Z is selected from the group consisting of -0-, -NR-, -S-, -S(O)-, -S0 2 -, - C(0)0-, -OC(O)-, -C(0)NR-, -NRC(O)-, -OC(0)0-, -NRC(0)0-, -OC(0)NR-, and NRC(0)NR-;
- R is hydrogen, Cl-6alkyl, or C3-6cycloalkyl, wherein the alkyl or cycloalkyl is optionally substituted;
- n is an integer from 0 to 4.
- R3, R4, and R5 are each independently hydrogen, Cl-6alkyl, or C3-6cycloalkyl; R3 is L2-C(0)-OCl-6alkyl;
- LI and L2 are each independently C5-21alkyl or C4-20heteroalkyl
- R3 is L2-C(0)-OCl-6alkyl, Rl is not L2-C(0)-OCl-6alkyl; and hen m is an integer from 2 to 4, no more than one Rl is L2-C(0)-0C1-
- any alkyl, cycloalkyl or heteroalkyl present in any of Rl, R2, R3, R4, R5, LI, and L2 is optionally substituted
- the lipid containing conjugation partner is a compound of the formula (Bl) :
- Z is selected from the group consisting of -0-, -NR-, -S-, -S(O)-, -S0 2 -, - C(0)0-, -OC(O)-, -C(0)NR-, -NRC(O)-, -OC(0)0-, -NRC(0)0-, -OC(0)NR-, and - NRC(0)NR-;
- R is hydrogen, Cl-6alkyl, or C3-6cycloalkyl, wherein the alkyl or cycloalkyl is optionally substituted;
- p is an integer from 0 to 4.
- Rll and R22 at each instance of p are each independently hydrogen, Cl-6alkyl, or C3-6cycloalkyl; or Rl l is L2-C(0)-OCl-6alkyl;
- R33 and R44 are each independently hydrogen, Cl-6alkyl, or C3-6cycloalkyl; or R33 is L2-C(0)-OCl-6alkyl;
- any alkyl, cycloalkyl, or heteroalkyl present in any of Rl l, R22, R 33, R44, LI, and L2 is optionally substituted;
- the amino acid-comprising conjugation partner is a compound of the formula (III) as defined in any of the embodiments described herein.
- the peptide-containing conjugation partner is a compound of the formula (III) as defined in any of the embodiments described herein.
- the amino acid-comprising conjugation partner is a compound of the formula (IIIA) as defined in any of the embodiments described herein.
- the peptide-containing conjugation partner is a compound of the formula (IIIA) as defined in any of the embodiments described herein.
- the method comprises making an amino acid or peptide conjugate comprising a structure of the formula (I)
- n is an integer from 0 to 4.
- n 1 or 2;
- Rl and R2 at each instance of m are each independently hydrogen, Cl-6alkyl, or C3-6cycloalkyl; or Rl is L2-C(0)-OCl-6alkyl;
- R3, R4, R5, R8, and R9 are each independently hydrogen, Cl-6alkyl, or C3- 6cycloalkyl; or R3 is L2-C(0)-OCl-6alkyl;
- R9 is an amino protecting group, L3-C(0), or A2;
- R6 and R7 at each instance of n are each independently hydrogen, Cl-6alkyl, or C3-6cycloalkyl;
- LI and L2 are each independently C5-21alkyl or C4-20heteroalkyl
- L3 is Cl-21alkyl or C4-20heteroalkyl
- Aland A2 are each independently an amino acid or a peptide; or Al is OH or OP1, wherein PI is a carboxyl protecting group ;
- R3 is L2-C(0)-OCl-6alkyl, Rl is not L2-C(0)-OCl-6alkyl; and hen m is an integer from 2 to 4, no more than one Rl is L2-C(0)-OCl-
- the method comprises making a peptide conjugate comprising a structure of the formula (I)
- n is an integer from 0 to 4.
- n 1 or 2;
- Rl and R2 at each instance of m are each independently hydrogen, Cl-6alkyl, or C3-6cycloalkyl; or Rl is L2-C(0)-OCl-6alkyl;
- R6 and R7 at each instance of n are each independently hydrogen, Cl-6alkyl, or C3-6cycloalkyl;
- R3 is L2-C(0)-OCl-6alkyl
- Rl is not L2-C(0)-OCl-6alkyl
- m is an integer from 2 to 4, no more than one Rl is L2-C(0)-OCl-
- n, R6, R7, R8, R9 and Al are as defined in the compound of formula (I); under conditions effective to conjugate the compound of formula (II) with the compound of formula (III) by hydrothiolation of the carbon-carbon double bond in the compound of formula (II) with the thiol in the compound of formula (III).
- the method comprises making an amino acid or peptide conjugate comprising a structure of the formula (IA),
- p is an integer from 0 to 4.
- q is an integer from 0 to 2;
- R9 is an amino protecting group, L3-C(0), or A2;
- Ra and Rb at each instance of q are each independently hydrogen, Cl-6alkyl, or C3-6cycloalkyl;
- LI and L2 are each independently C5-21alkyl or C4-20heteroalkyl
- the method comprises making a peptide conjugate comprising a structure of the formula (IA),
- p is an integer from 0 to 4.
- q is an integer from 0 to 2;
- Rll and R22 at each instance of p are each independently hydrogen, Cl-6alkyl, or C3-6cycloalkyl; or Rl l is L2-C(0)-OCl-6alkyl;
- R33, R44, R55, R66, R77, R8, and R9 are each independently hydrogen, Cl- 6alkyl, or C3-6cycloalkyl; or R33 is L2-C(0)-OCl-6alkyl;
- R9 is L3-C(0) or A2;
- Ra and Rb at each instance of q are each independently hydrogen, Cl-6alkyl, or C3-6cycloalkyl;
- LI and L2 are each independently C5-21alkyl or C4-20heteroalkyl
- L3 is Cl-21alkyl or C4-20heteroalkyl
- Al and A2 are each independently a peptide; or Al is OH;
- R33 is L2-C(0)-OCl-6alkyl
- Rll is not L2-C(0)-OCl-6alkyl
- p is an integer from 2 to 4
- no more than one Rl l is L2-C(0)-OCl-
- Al and/or A2 are each independently a peptide, wherein the peptide comprises 8 to 60 amino acids. In some embodiments, Al and/or A2 are each independently a peptide comprising or substituted with a peptide epitope, wherein the peptide epitope compises from 8 to 60 amino acids.
- LI is Cll-21alkyl; m is 0; R3 is hydrogen or L2-C(0)-OCH2; L2 is Cl l-21alkyl; and R4 and R5 are each hydrogen.
- n is 1; R6, R7, and R8 are each hydrogen; and R9 is hydrogen, L3- C(O), or A2. In one embodiment, n is 1; R6, R7, and R8 are each hydrogen; and R9 is hydrogen or L3-C(0). In one embodiment, L3 is methyl or linear C15alkyl.
- LI is Cll-21alkyl; m is 0; R3 is hydrogen or L2-C(0)-OCH2; L2 is Cl l-21alkyl; R4 and R5 are each hydrogen; n is 1; R6, R7, and R8 are each hydrogen; R9 is hydrogen, L3-C(0), or A2.
- LI is Cl l-21alkyl; m is 0; R3 is hydrogen or L2-C(0)-OCH2; L2 is Cl l-21alkyl; R4 and R5 are each hydrogen; n is 1; R6, R7, and R8 are each hydrogen; R9 is hydrogen or L3-C(0).
- n is 1; R6, R7, and R8 are each hydrogen; and R9 is hydrogen, L3- C(O), or A2. In one embodiment, n is 1; R6, R7, and R8 are each hydrogen; and R9 is hydrogen or L3-C(0). In one embodiment, n is 1; R6, R7, and R8 are each hydrogen; and R9 is hydrogen or L3-C(0), wherein L3 is methyl.
- LI is Cll-21alkyl; m is 0; R3 is hydrogen; R4 and R5 are each hydrogen; n is 1; R6, R7, and R8 are each hydrogen; R9 is hydrogen, L3-C(0), or A2.
- LI is Cll-21alkyl; m is 0; R3 is hydrogen; R4 and R5 are each hydrogen; n is 1; R6, R7, and R8 are each hydrogen; R9 is hydrogen or L3-C(0).
- LI is Cll-21alkyl
- m is 0
- R3 is hydrogen
- R4 and R5 are each hydrogen.
- Al is a peptide comprising serine as the first N-terminal amino acid residue and a solubilising group comprising an amino acid sequence comprising two or more hydrophilic amino acid residues in the peptide chain adjacent to the serine.
- R9 is hydrogen, an amino protecting group or L3-C(0). In some embodiments, R9 is hydrogen or L3-C(0).
- R9 is hydrogen or an amino protecting group
- the method further comprises acylating the amino acid conjugate or peptide conjugate so as to replace the hydrogen or amino protecting group at R9 with L3-C(0).
- Al and/or A2 is a peptide.
- Al is OH or OPl and/or R9 is hydrogen, an amino protecting group or L3-C(0). In some embodiments, Al is OPl or OH and/or R9 is hydrogen, an amino protecting group or L3-C(0). In some embodiments, Al is a OPl or OH and R9 is hydrogen, an amino protecting group or L3-C(0).
- Al is a OPl or OH and/or R9 is hydrogen, an amino protecting group or L3-C(0), and the method comprises coupling an amino acid or a peptide so as to replace Al and/or R9 with the amino acid or peptide.
- coupling a peptide comprises individually coupling one or more amino acids and/or one or more peptides.
- the amino protecting group is Boc, Fmoc, Cbz (carboxybenzyl), Nosyl (o- or p-nitrophenylsulfonyl), Bpoc (2-(4-biphenyl)isopropoxycarbonyl) and Dde (l-(4,4-dimethyl-2,6-dioxohexylidene)ethyl).
- the amino protecting group is Boc or Fmoc.
- the carboxyl protecting group is tert-butyl or benzyl.
- the compound of the formula (I) is a compound of the formula (IV) :
- R3 is hydrogen or L2-C(0)-OCH2
- R9 is hydrogen, an amino protecting group, L3-C(0), or A2
- LI and L2 are each independently C5-21alkyl or C4-20heteroalkyl
- the compound of the formula (I) is a compound of the formula (IV) :
- R3 is hydrogen or L2-C(0)-OCH2
- R9 is hydrogen, L3-C(0), or A2;
- LI and L2 are each independently C5-21alkyl or C4-20heteroalkyl
- L3 is Cl-21alkyl or C4-20heteroalkyl
- Al and A2 are each independently a peptide; or Al is OH;
- LI, Al, A2, L2, and L3 in the compound of formula (IV) are each independently as defined in any of the embodiments relating to the compound of the formula (I).
- R3 is hydrogen
- R9 is acetyl
- R3 is hydrogen and R9 is acetyl.
- the method is for making a compound of the formula (IV), wherein LI is C15 linear alkyl, R3 is hydrogen, R9 is Fmoc, and Al is OH, and the method comprises reacting vinyl palmitate and Fmoc-Cys-OH.
- the amino protecting group is not Fmoc. In some embodiments, the amino protecting group is Boc. In some embodiments, the amino acid-comprising conjugation partner is not Fmoc-Cys- OH.
- the peptide conjugate comprises 3 or more, 4 or more, or 5 or more contiguous amino acids. In some embodiments, the compound of formula (I) comprises 3 or more, 4 or more, or 5 or more contiguous amino acids.
- the conditions effective to conjugate the lipid-containing conjugation partner to the amino acid-comprising conjugation partner comprises the generation of one or more free radicals. In one embodiment, the conditions effective to conjugate the lipid-containing conjugation partner to the peptide-containing conjugation partner comprises the generation of one or more free radicals.
- the generation of one or more free radicals is initiated thermally and/or photochemically. In certain embodiments, the generation of one or more free radicals is initiated by the thermal and/or photochemical degradation of a free radical initiator. In exemplary embodiments, the generation of one or more free radicals is initiated by the thermal degradation of a thermal initiator or the photochemical degradation of a photochemical initiator.
- thermal degradation of the free radical initiator comprises heating the reaction mixture at a suitable temperature.
- the reaction mixture is heated at a temperature is from about 40 °C to about 200 °C, from about 50 °C to about 180 °C, from about 60 °C to about 150 °C, from about 65 °C to about 120 °C, from about 70 °C to about 115 °C, from about 75 °C to about 110 °C, or from about 80 °C to about 100 °C.
- the reaction mixture is heated at a temperature of at least about 40 °C, at least about 50 °C, at least about 60 °C, or at least about 65 °C.
- the reaction mixture is heated at a temperature of about 90 °C.
- photochemical degradation of the free radical initiator comprises irradiation with ultraviolet light.
- the ultraviolet light has a wavelength of about 365 nm.
- photochemical degradation of the free radical initiator is carried out at about ambient temperature.
- the thermal initiator is 2,2'- azobisisobutyronitrile (AIBN).
- the photoinitiator is 2,2-dimethoxy-2-phenylacetophenone (DMPA).
- the reaction is carried out in a liquid medium.
- the liquid medium comprises a solvent.
- the solvent is selected from the group consisting of N-methylpyrrolidone (NMP), dimethylsulfoxide (DMSO), ⁇ , ⁇ -dimethylformamide (DMF), dichloromethane (DCM), 1,2-dichloroethane, and mixtures thereof.
- the solvent comprises NMP, DMSO, or a mixture thereof.
- the solvent comprises DMSO.
- the reaction is carried out in the presence of one or more additives that inhibit dimerisation, telomerisation, or polymerisation.
- the additive is selected from the group consisting of reduced glutathione (GSH), 2,2'-(ethylenedioxy)diethanethiol (DODT), 1,4-dithiothreitol (DTT), and protein.
- GSH reduced glutathione
- DODT 2,2'-(ethylenedioxy)diethanethiol
- DTT 1,4-dithiothreitol
- protein protein.
- the additive is DTT.
- the additive is DTT or tert-butyl mercaptan.
- the reaction is carried out for a period of time from about 5 minutes to about 48 h, 5 minutes to about 24 h, from about 5 minutes to about 12 hours, from about 5 minutes to about 6 hours, from about 5 minutes to about 3 hours, 5 minutes to 2 hours, or form about 5 minutes to about 1 hour. In exemplary embodiments, the reaction is carried out for a period of time from about 5 minutes to about 1 h. In some embodiments, the reaction is carried out until one of the conjugation partners is at least about 70%, 80%, 90%, 95%, 97%, 99%, or 100% consumed.
- the reaction is carried out under substantially oxygen free conditions.
- the method comprises
- SPPS solid phase peptide synthesis
- the method further comprises acylating the Na-amino group of the amino acid of the amino acid conjugate or the amino acid to which the lipid- containing conjugation partner is conjugated of any one of the peptide conjugates.
- the method comprises cleaving the peptide conjugate from the solid phase support.
- the peptide-containing conjugation partner is not purified prior to reaction with the lipid-containing conjugation partner.
- the amino acid residue in the peptide of the peptide-containing conjugation partner bearing the carbon-carbon double bond or thiol to be reacted is an N-terminal amino acid residue and the method comprises acylating the N-terminal amino group prior to cleaving the peptide from the solid phase.
- the amino acid residue is an N-terminal residue.
- the N-terminal residue is a cysteine residue.
- the present invention provides a compound of the formula (V) :
- n is an integer from 0 to 4.
- Rl and R2 at each instance of m are each independently hydrogen, Cl-6alkyl, or C3-6cycloalkyl;
- R3, R4, R5, R8, and R9 are each independently hydrogen, Cl-6alkyl, or C3- 6cycloalkyl; or R9 is an amino protecting group, L3-C(0), or A2;
- LI is C5-21alkyl or C4-20heteroalkyl
- any alkyl, cycloalkyl or heteroalkyl present in any of Rl, R2, R3, R4, R5, R6, R7, R8, R9, LI, and L3 is optionally substituted, and
- the present invention provides a compound of the formula (V) :
- n 1 or 2;
- Rl and R2 at each instance of m are each independently hydrogen, Cl-6alkyl, or C3-6cycloalkyl;
- LI is C5-21alkyl or C4-20heteroalkyl
- Aland A2 are each independently a peptide; or Al is OH;
- m, n, R6, R7, Al and A2 are each independently as defined in any of the embodiments relating to the compound of formula (I).
- LI comprises a linear chain of 9-21 carbon atoms. In one specifically contemplated embodiment, LI is linear C15alkyl.
- R3 is hydrogen
- R6 and R7 are each hydrogen.
- R8 is hydrogen.
- R8 is hydrogen and R9 is hydrogen, an amino protecting group, L3-C(0), or A2.
- R8 and R9 are each hydrogen; or R9 is L3-C(0) or A2.
- R8 is hydrogen and R9 is L3-C(0) .
- L3 is methyl.
- Al is OP1 or OH and R9 is hydrogen, an amino protecting group or L3-C(0).
- Al and/or A2 is an amino acid or a peptide.
- the peptide comprises an epitope.
- Al is serine or a peptide comprising serine as the first N-terminal amino acid residue.
- Al and/or A2 is a peptide comprising a solubilising group comprising an amino acid sequence comprising two or more hydrophilic amino acid residues in the peptide chain.
- Al is a peptide comprising serine as the first N-terminal amino acid residue and a solubilising group comprising an amino acid sequence comprising two or more hydrophilic amino acid residues in the peptide chain adjacent to the serine.
- LI is Cl l-21alkyl
- m is 0
- R3 is hydrogen
- R4 and R5 are each hydrogen.
- n is 1; R6, R7, and R8 are each hydrogen; and R9 is hydrogen, L3- C(O), or A2. In one embodiment, n is 1; R6, R7, and R8 are each hydrogen; and R9 is hydrogen or L3-C(0). In one embodiment, n is 1 ; R6, R7, and R8 are each hydrogen; and R9 is hydrogen or L3-C(0), wherein L3 is methyl.
- the pharmaceutical composition comprises an effective amount of one or more peptide conjugates of the present invention together with one or more peptides of the present invention, or any combination thereof.
- the pharmaceutical composition comprises an effective amount of two or more peptide conjugates of the present invention and one or more peptides of the present invention, or an effective amount of one or more peptide conjugates of the present invention and two or more peptides of the present invention.
- the present invention provides a method of vaccinating or eliciting an immune response in a subject comprising administering to the subject an effective amount of a peptide conjugate or peptide of the present invention.
- the present invention provides use of a peptide conjugate or a peptide of the invention in the manufacture of a medicament for vaccinating or eliciting an immune response in a subject.
- the present invention provides use of a pharmaceutical composition of the invention for vaccinating or eliciting an immune response in a subject.
- the present invention provides use of one or more peptides of the present invention or one or more peptide conjugates of the present invention in the manufacture of a medicament for vaccinating or eliciting an immune response in a subject.
- the present invention provides a method of eliciting an immune response in a subject comprising administering to the subject an effective amount of a peptide conjugate of the present invention or a pharmaceutically acceptable salt or solvate thereof.
- the present invention provides use of a peptide conjugate of the invention or a pharmaceutically acceptable salt or solvate thereof for eliciting an immune response in a subject.
- the present invention provides use of a peptide conjugate of the invention or a pharmaceutically acceptable salt or solvate thereof in the manufacture of a medicament for eliciting an immune response in a subject.
- the present invention provides a method of vaccinating a subject comprising administering to the subject an effective amount of a peptide conjugate of the present invention or a pharmaceutically acceptable salt or solvate thereof.
- the present invention provides use of a peptide conjugate of the present invention for vaccinating a subject or a pharmaceutically acceptable salt or solvate thereof.
- the present invention provides use of a peptide conjugate of the invention or a pharmaceutically acceptable salt or solvate thereof in the manufacture of a medicament for vaccinating a subject.
- the method comprises the administration of one or more peptides of the present invention and/or one or more peptide conjugates of the present invention, for example one or more peptides in combination with one or more peptide conjugates to the subject.
- one or more peptides of the present invention and/or one or more peptide conjugates of the present invention are used for vaccinating or eliciting an immune response in the subject or in the manufacture of a medicament for vaccinating or eliciting an immune response in the subject.
- two or more peptides, two or more peptide conjugates, or one or more peptides and one or more peptide conjugates are used or administered.
- the two or more peptides, two or more peptide conjugates, or one or more peptides and one or more peptide conjugates are used or administered simultaneously, sequentially, or separately.
- Asymmetric centers may exist in the compounds described herein.
- the asymmetric centers may be designated as (R) or (S), depending on the configuration of substituents in three dimensional space at the chiral carbon atom.
- All stereochemical isomeric forms of the compounds, including diastereomeric, enantiomeric, and epimeric forms, as well as d-isomers and l-isomers, and mixtures thereof, including enantiomerically enriched and diastereomerically enriched mixtures of stereochemical isomers, are within the scope of the invention.
- Individual enantiomers can be prepared synthetically from commercially available enantiopure starting materials or by preparing enantiomeric mixtures and resolving the mixture into individual enantiomers. Resolution methods include conversion of the enantiomeric mixture into a mixture of diastereomers and separation of the
- Acid addition salts can be prepared by reacting compounds, in free base form, with inorganic or organic acids.
- inorganic acids include, but are not limited to, hydrochloric, hydrobromic, nitric, sulfuric, and phosphoric acid.
- organic acids include, but are not limited to, acetic, trifluoroacetic, propionic, succinic, glycolic, lactic, malic, tartaric, citric, ascorbic, maleic, fumaric, pyruvic, aspartic, glutamic, stearic, salicylic, methanesulfonic, benzenesulfonic, isethionic, sulfanilic, adipic, butyric, and pivalic.
- Quaternary salts of basic nitrogen-containing groups in the compounds may be may be prepared by, for example, reacting the compounds with alkyl halides such as methyl, ethyl, propyl, and butyl chlorides, bromides, and iodides, dialkyl sulfates such as dimethyl, diethyl, dibutyl, and diamyl sulfates, and the like.
- alkyl halides such as methyl, ethyl, propyl, and butyl chlorides, bromides, and iodides
- dialkyl sulfates such as dimethyl, diethyl, dibutyl, and diamyl sulfates, and the like.
- heteroaliphatic is intended to include aliphatic groups, wherein one or more chain carbon atoms are replaced with a heteroatom. In some embodiments, the heteroaliphatic is saturated.
- alkyl is intended to include saturated or unsaturated straight chain and branched chain hydrocarbon groups.
- saturated hydrocarbon groups include methyl, ethyl, n-propyl, isopropyl, n-butyl, t-butyl, isobutyl, sec-butyl, and the like.
- Unsaturated alkyl groups have one or more carbon-carbon double bonds or triple bonds.
- unsaturated alkyl groups include vinyl, prop-2-enyl, crotyl, isopent-2-enyl, 2-butadienyl, penta-2,4-dienyl, penta-l,4-dienyl, ethynyl, prop-3-ynyl, but-3-ynyl, and the like.
- the alkyl is saturated.
- cycloalkyi is intended to include non-aromatic cyclic alkyl groups.
- examples of cycloalkyi groups include but are not limited to cyclopentyl, cyclohexyl, cyclohex-1- enyl, cyclohex-3-enyl, cycloheptyl.
- the cycloalkyi is saturated.
- heteroatom is intended to include oxygen, nitrogen, sulfur, or phosphorus. In some embodiments, the heteroatom is selected from the group consisting of oxygen, nitrogen, and sulfur.
- aryl is intended to include aromatic radicals. Examples include, but are not limited to, phenyl, tolyl, naphthyl, indanyl, and the like. In some embodiments, aryl groups comprise from 4 to 8 or from 6 to 8 carbon atoms in the aromatic ring system.
- substituted is intended to mean that one or more hydrogen atoms in the group indicated is replaced with one or more independently selected suitable substituents, provided that the normal valency of each atom to which the substituent/s are attached is not exceeded, and that the substitution results in a stable compound.
- carboxyl protecting group as used herein is means a group that is capable of readily removed to provide the OH group of a carboxyl group and protects the carboxyl group against undesirable reaction during synthetic procedures.
- Such protecting groups are described in Protective Groups in Organic Synthesis edited by T. W. Greene et al. (John Wiley & Sons, 1999) and 'Amino Acid-Protecting Groups' by Fernando Albericio (with Albert Isidro-Llobet and Mercedes Alvarez) Chemical Reviews 2009 (109) 2455- 2504.
- Examples include, but are not limited to, alkyl and silyl groups, for example methyl, ethyl, tert-butyl, methoxymethyl, 2,2,2-trichloroethyl, benzyl, diphenylmethyl, trimethylsilyl, and tert-butyldimethylsilyl, and the like.
- amine protecting group means a group that is capable of being readily removed to provide the NH 2 group of an amine group and protects the amine group against undesirable reaction during synthetic procedures. Such protecting groups are described in Protective Groups in Organic Synthesis edited by T. W. Greene et al.
- Cbz carboxybenzyl
- Nosyl o- or p-nitrophenylsulfonyl
- Bpoc 2-(4- biphenyl)isopropoxycarbonyl
- Dde l-(4,4-dimethyl-2,6-dioxohexylidene)ethyl
- the invention may also be said broadly to consist in the parts, elements and features referred to or indicated in the specification of the application, individually or collectively, in any or all combinations of two or more of said parts, elements or features, and where specific integers are mentioned herein which have known equivalents in the art to which the invention relates, such known equivalents are deemed to be incorporated herein as if individually set forth.
- Figure 1 is a series of graphs showing CD80 response of Pam3CSK4, 22, 20, and 26 across five donors.
- MFI mean fluorescence intensity
- UT untreated
- Pam3CSK4 Pam3Cys
- 22 8
- 20 9
- 26 11.
- Figure 3 is a graph showing the results of the T cell activation assay using CMV pp65 495- 503 constructs and the CD8+ T cell clone 4D9 with allogeneic HLA-A2+ MoDC as APC, as described herein in Example 4.
- Figure 5 is a graph showing the results of the T cell activation assay using NY-ESO-li 53 - 180 constructs and the CD8+ T cell clone 2F2 with allogeneic HLA-A2+ HLA-DP4+ MoDC as APC, as described herein in Example 5.
- Figure 6 is a graph showing the results of the T cell activation assay using NY-ESO-li 53 - 180 constructs and the CD4+ T cell clone 1B7 with autologous LCL as APC, as described herein in Example 6.
- Figure 12 is a graph showing the results of the T cell activation assay using NY-ESO- 1 us- 14 3 constructs and the CD4+ T cell clone 1E4 with autologous LCL as APC, as described herein in Example 9.
- Figure 14 is a graph showing the results of the TLR agonism assay using the NY-ESO-1 constructs and HekBlueTM, as described herein in Example 10.
- the present invention relates to a method of making amino acid and peptide conjugates.
- the method comprises reacting an lipid-containing conjugation partner and an amino acid comprising conjugation partner under conditions effective to conjugate the lipid- containing conjugation partner to the amino acid-comprising conjugation partner in a thiol-ene reaction.
- the method comprises reacting an lipid- containing conjugation partner and a peptide-containing conjugation partner under conditions effective to conjugate the lipid-containing conjugation partner to the peptide of the peptide-containing conjugation partner in a thiol-ene reaction.
- photoinitiators include but are not limited to acetophenone, anisoin, anthraquinone, anthraquinone-2- sulfonic acid, benzil, benzoin, benzoin ethyl ether, benzoin isobutyl ether, benzoin methyl ether, benzophenone, 3,3',4,4'-benzophenonetetracarboxylic dianhydride, 4- benzoylbiphenyl, 2-benzyl-2-(dimethylamino)-4'-morpholinobutyrophenone, 4'- bis(diethylamino)benzophenone, 4,4'-bis(dimethylamino)benzophenone,
- Preparation of the compounds may involve the protection and deprotection of various chemical groups.
- the need for protection and deprotection, and the selection of appropriate protecting groups, can be readily determined by a person skilled in the art.
- Protecting groups and methods for protection and deprotection are well known in the art (see e.g. T. W. Greene and P. G. M. Wuts, Protective Groups in Organic Synthesis, 3 rd Ed., Wiley & Sons, Inc., New York (1999)).
- the order in which the lipid-containing conjugation partner and amino acid-comprising conjugation partner, for example a peptide-containing conjugation partner, and any other components present in the reaction mixture are introduced into the reaction vessel may vary.
- the reaction may be carried out as a one-pot procedure.
- the stoichiometry of the lipid-containing conjugation partner and amino acid-comprising conjugation partner, for example a peptide-containing conjugation partner, in the reaction may vary.
- the stoichiometric ratio of amino acid- comprising conjugation partner to lipid-containing conjugation partner is from about 1 : 0.5 to about 1 : 20, from about 1 : 1 to about 1 : 10, from about 1 : 1 to about 1 : 5, from about 1 : 1 to about 1 : 3.
- the stoichiometric ratio of peptide- containing conjugation partner to lipid-containing conjugation partner is from about 1 : 0.5 to about 1 : 20, from about 1 : 1 to about 1 : 10, from about 1 : 1 to about 1 : 5, from about 1 : 1 to about 1 : 3.
- the reaction is carried out at a temperature above ambient temperature. In one embodiment, the reaction is carried out at a temperature from 40 to 200 °C, from 50 to 150 °C, from 60 to 100 °C, from 65 to 90 °C, or from 70 to 80 °C. In some embodiments, the reaction is carried out at a temperature greater than 40 °C, greater than 50 °C, greater than 75 °C, greater than 100 °C, or greater than 150 °C.
- the temperature at which the reaction is carried out may depend on how free radicals are generated in the reaction.
- the temperature used may be selected to control the rate of the reaction.
- the temperature may be adjusted during the course of the reaction to control the rate of the reaction. By controlling the rate of the reaction it may be possible to minimise or obviate the formation of undesirable by products (e.g. telomerisation or polymerisation products).
- the reaction will generally be carried out at a temperature above ambient temperature. The temperature will depend on the reactivity of the species from which free radicals are generated.
- the reaction is carried out until at least about 50%, at least about 60%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 97%, at least about 99% of the lipid-containing conjugation partner or amino acid-comprising conjugation partner, whichever is stoichiometrically less, has been consumed.
- the reaction is carried out until at least about 50%, at least about 60%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 97%, at least about 99% of the lipid-containing conjugation partner or peptide-containing conjugation partner, whichever is stoichiometrically less, has been consumed .
- the consumption of starting materials may be monitored by any suitable method, for example, HPLC.
- the reaction mixture may be mixed by any suitable method known in the art, for example, using a magnetic or mechanical stirrer.
- the method used may depend on the scale on which the reaction is carried out.
- the solvent may be selected based on the solubility of the lipid-containing conjugation partner and amino acid-comprising conjugation partner, for example a peptide-containing conjugation partner, in the solvent.
- the solubility of the free radical initiator may also be relevant.
- the lipid-containing conjugation partner is hydrophobic.
- the hydrophobicity or hydrophilicity of an amino acid-comprising conjugation partner, for example a peptide-containing conjugation partner may vary depending on, for example, amino acid sequence of the peptide of a peptide-containing conjugation partner.
- the presence of a solubilising group in the peptide-conta ining conjugation partner may increase solubility in polar solvents, such as water. A person skilled in the art will be able to select an appropriate solvent without undue experimentation.
- the reaction may be ca rried out under substantially oxygen-free conditions. Oxygen may quench free radicals formed in the reaction .
- the reaction mixture may be degassed with an inert gas (e.g . nitrogen or argon) that is substantially oxygen-free to remove any dissolved oxygen before free radicals are generated .
- an inert gas e.g . nitrogen or argon
- components of the reaction mixture may be degassed with inert gas that is substantially oxygen-free prior to being combined in the reaction vessel .
- the reaction may be ca rried out under an atmosphere of inert gas that is substantially oxygen-free.
- the method of the present invention may be carried out at ambient pressure.
- An additive that inhibits dimerisation, telomerisation, or polymerisation may be included in the reaction mixture in the method of the present invention.
- the inventors have found that in some embodiments the inclusion of an extraneous thiol that facilitates chain transfer as an additive in the reaction mixture reduces the formation of undesirable by products.
- the extraneous thiol may, in some embodiments, increase the efficiency of the desired thiol ene reaction.
- suitable extraneous thiols include but are not limited to reduced glutathione, DODT, DTT, protein, and the like.
- the inventors have found that in some embodiments the inclusion of DTT resulted in no undesirable by products.
- the extraneous thiol is a sterically hindered thiol .
- a suitable sterically hindered extra neous thiol include tert-butyl mercaptan and 1-methylpropyl mercaptan .
- an acid in some embodiments may also inhibit dimerisation
- the acid may be a strong inorganic acid, for example HCI, or orga nic acid, for example TFA.
- the additive is TFA.
- the reaction mixture comprises a combination of TFA and tert-butyl mercapta n.
- the additive is generally used in an amount sufficient to minimise the formation of undesirable by products without adversely affecting the reaction or any, optional, subsequent steps in the method.
- less than about 50%, less than about 40%, less than about 30%, less than about 25%, less than about 20%, less than about 15%, less than about 10%, less than about 5%, less than about 3%, or less than about 1% by weight of the lipid-containing conjugation partner and peptide- containing conjugation partner starting materials used in the reaction are undesirable by products resulting from dimerisation, telomerisation, or polymerisation.
- the purity of the products of the reaction may be determined by, for example, HPLC.
- the concentration of the lipid-containing conjugation partner and amino acid-compirsing conjugation partner, for example a peptide-containing conjugation partner, respectively, in the reaction mixture may also affect the reaction.
- concentration of the lipid-containing conjugation partner and peptide- containing conjugation partner in the reaction mixture may be varied to e.g. optimise yield and purity without undue experimentation.
- the peptide conjugate produced by and/or the peptide-containing conjugation partner in the method of the present invention may comprise a synthetic peptide.
- Synthetic peptides may be prepared using solid phase peptide synthesis (SPPS).
- the amino acid to be coupled is reacted with the unprotected ⁇ -amino group of the N- terminal amino acid of the peptide chain, increasing the chain length of the peptide chain by one amino acid.
- the carboxyl group of the amino acid to be coupled may be activated with a suitable chemical activating agent to promote reaction with the ⁇ -amino group of the peptide chain.
- the ⁇ -protecting group of N-terminal amino acid of the peptide chain is then removed in preparation for coupling with the next amino acid residue. This technique consists of many repetitive steps making automation attractive whenever possible.
- peptides may be coupled to the Na- amino group of the solid phase bound amino acid or peptide instead of an individual amino acid, for example where a convergent peptide synthesis is desired.
- SPPS may be carried out using a continuous flow method or a batch flow method .
- Linker molecules are then attached to the support for connecting the peptide chain to the solid phase support.
- Linker molecules are generally designed such that eventual cleavage provides either a free acid or amide at the C-terminus.
- Linkers are generally not resin- specific. Examples of linkers include peptide acids for example 4- hydroxymethylphenoxyacetyl-4'-methylbenzyhydrylamine (HMP), or peptide amides for example benzhydrylamine derivatives.
- the first amino acid of the peptide sequence may be attached to the linker after the linker is attached to the solid phase support or attached to the solid phase support using a linker that includes the first amino acid of the peptide sequence.
- Linkers that include amino acids are commercially available.
- the peptide is cleaved from the resin.
- the conditions used in this process depend on the sensitivity of the amino acid composition of the peptide and the side-chain protecting groups. Generally, cleavage is carried out in an environment containing a plurality of scavenging agents to quench the reactive carbonium ions that originate from the protective groups and linkers. Common cleaving agents include, for example, TFA and hydrogen fluoride (HF).
- cleaving agents include, for example, TFA and hydrogen fluoride (HF).
- the inventors have found that in some embodiments the peptide- containing conjugation partner may be used in the method of the present invention without purification following cleavage of the peptide from the resin.
- the method further comprises coupling the amino acid of the amino acid conjugate or an amino acid of the peptide conjugate to an amino acid or a peptide so as to provide a peptide conjugate comprising a peptide epitope.
- the peptide to be coupled comprises a peptide epitope.
- a peptide epitope is formed on coupling. The coupling may be carried out by SPPS as described herein.
- the peptide conjugate and/or peptide-containing conjugation partner comprises two or more epitopes, for example, the peptide of the peptide conjugate and/or peptide-containing conjugation partner comprises two or more epitopes.
- Confirmation of the identity of the peptides synthesized may be conveniently achieved by, for example, amino acid analysis, mass spectrometry, Edman degradation, and the like.
- the present invention also relates to amino acid conjugates and peptide conjugates made by the method of the present invention.
- the conjugates are as defined in any of the embodiments described herein.
- the present invention also relates to a compound of the formula (V), which is an amino acid conjugate.
- the peptide conjugates may be pure or purified, or substantially pure.
- purified does not require absolute purity; rather, it is intended as a relative term where the material in question is more pure than in the environment it was in previously. In practice the material has typically, for example, been subjected to fractionation to remove various other components, and the resultant material has substantially retained its desired biological activity or activities.
- substantially purified refers to materials that are at least about 60% free, preferably at least about 75% free, and most preferably at least about 90% free, at least about 95% free, at least about 98% free, or more, from other components with which they may be associated during manufacture.
- the peptide-containing conjugation partner comprises only natural amino acids.
- naturally occurring amino acid refers to any one of the twenty amino acids commonly found in peptides synthesized in nature, and known by the one letter abbreviations A, R, N, C, D, Q, E, G, H, I, L, K, M, F, P, S, T, W, Y and V.
- peptide and the like is used herein to refer to any polymer of amino acid residues of any length.
- the polymer can be linear or non-linear ⁇ e.g. , branched), it can comprise modified amino acids or amino acid analogs.
- the term also encompasses amino acid polymers that have been modified naturally or by intervention, for example, by disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other modification or manipulation, for example conjugation with labeling or bioactive component.
- CD8+ cytotoxic T-cell response.
- CD8+ cells Upon binding of the T-cell to the antigen-MHC I complex, CD8+ cells secrete perforin and other mediators, resulting in target cell death.
- CD8+ cells secrete perforin and other mediators, resulting in target cell death.
- T-lymphocytes populations of immune cells, such as T-lymphocytes.
- TLRs Toll-like receptors
- PRRs pattern recognition receptors
- TLR2 is a cell-surface receptor expressed on a range of different cell types, including dendritic cells, macrophages and lymphocytes (Coffman, R. L, Sher, A., Seder, R. A., Immunity 2010, 33, 492-503).
- TLR2 recognises a wide range of microbial components including lipopolysaccharides, peptidoglycans and lipoteichoic acid. It is unique amongst TLRs in that it forms heterodimers, with either TLR1 or TLR6; the ability to form complexes with other PRRs may explain the wide range of agonists for TLR2 (Feldmann, M., Steinman, L., Nature 2005, 435, 612-619). Upon ligand binding and heterodimerisation, signalling takes place via the MyD88 pathway, leading to N FKB activation and consequent production of inflammatory and effector cytokines.
- the peptide conjugate has TLR2 agonist activity. In some embodiments, the peptide conjugate has TLR2 agonist activity comparable to Pam3CSK4. In some embodiments, the peptide conjugate has TLR2 agonist activity at least about 50%, about 60%, about 70%, about 80%, about 90% that of Pam3CSK4. In some embodiments, for example in embodiments where a modulated immune response is desirable, the peptide conjugate has TLR2 agonist activity less that that of Pam3CSK4. For example, the peptide conjugate has TLR2 agonist activity less than about 50%, less than about 40%, less than about 30%, less than about 20%, or less than about 10% that of Pam3CSK4.
- tumour antigens or antigens from various pathogenic organisms have been characterised and are suitable for use in the present invention. All antigens, whether or not presently characterized, that are capable of eliciting an immune response are contemplated.
- amino acids with basic side chains e.g., lysine, arginine, histidine
- acidic side chains e.g., aspartic acid,
- Amino acid analogs e.g., phosphorylated or glycosylated amino acids
- Amino acid analogs are also contemplated in the present invention, as are peptides substituted with non-naturally occurring amino acids, including but not limited to N- alkylated amino acids (e.g. N-methyl amino acids), D-amino acids, ⁇ -amino acids, and ⁇ - amino acids.
- a "fragment" of a peptide is a subsequence of the peptide that performs a function that is required for the enzymatic or binding activity and/or provides three dimensional structure of the peptide, such as the three dimensional structure of a polypeptide.
- conjugates of the present invention are in certain embodiments particularly suited for stimulating T-cell responses, for example in the treatment of neoplastic diseases, including cancer.
- Conjugates of the present invention comprising one or more tumour antigens are specifically contemplated. It will be appreciated that tumour antigens contemplated for use in the preparation of peptide conjugates of the invention will generally comprise one or more peptides. In certain embodiments of the invention, including for example pharmaceutical compositions of the invention, one or more additional tumour antigens may be present, wherein the one or more tumour antigens does not comprise peptide.
- compositions comprising one or more antigens prepared using those methods of immunisation are specifically contemplated.
- Tumour antigens appropriate for the use in the present invention encompass a wide variety of molecules, such as (a) peptide-containing tumour antigens, including peptide epitopes (which can range, for example, from 8-20 amino acids in length, although lengths outside this range are also common), lipopolypeptides and glycoproteins, (b) saccharide-containing tumour antigens, including poly-saccharides, mucins, gangliosides, glycolipids and glycoproteins, including and (c) polynucleotides that express antigenic polypeptides.
- peptide-containing tumour antigens including peptide epitopes (which can range, for example, from 8-20 amino acids in length, although lengths outside this range are also common), lipopolypeptides and glycoproteins
- saccharide-containing tumour antigens including poly-saccharides, mucins, gangliosides, glycolipids and glycoproteins, including and (c) polynucleotides that express
- one or more conjugates comprises a tumour antigen that does not itself comprise peptide, but for example is bound to the amino acid-comprising or peptide-containing conjugation partner, are contemplated.
- compositions of the invention in which one or more tumour antigens that does not itself comprise peptide is present are contemplated.
- the tumour antigens are provided in recombinant form.
- the tumour antigens include, for example, class I-restricted antigens recognized by CD8+ lymphocytes or class II-restricted antigens recognized by CD4+ lymphocytes.
- the peptide of the peptide-containing conjugation partner or of the peptide conjugate comprises one or more epitopes derived from NY-ESO-1. In one embodiment, the peptide comprises one or more epitopes derived from NY-ESO-1 residues 79 - 116. In one embodiment, the peptide comprises one or more epitopes derived from NY-ESO-1 residues 118 - 143. In one embodiment, the peptide comprises one or more epitopes derived from NY-ESO-1 residues 153 - 180.
- the peptide comprises more that one amino acid sequence selected from the group consisting of any one of SEQ ID NOs: 1 to 20. In one
- Galectin 4 associated with, for example, colorectal cancer
- Galectin 9 associated with, for example, Hodgkin's disease
- proteinase 3 associated with, for example, chronic myelogenous leukemia
- Wilm's tumour antigen-1 WT 1, associated with, for example, various leukemias
- carbonic anhydrase associated with, for example, renal cancer
- aldolase A associated with, for example, lung cancer
- PRAME associated with, for example, melanoma
- HER-2/neu associated with, for example, breast, colon, lung and ovarian cancer
- alpha-fetoprotein associated with, for example, hepatoma
- KSA associated with, for example, colorectal cancer
- gastrin associated with, for example, pancreatic and gastric cancer
- tumour antigens amenable to use in the present invention include TAG-72, (See, e.g., U.S. Pat. No. 5,892,020; human carcinoma antigen (See, e.g., U.S. Pat. No. 5,808,005); TP1 and TP3 antigens from osteocarcinoma cells (See, e.g., U.S. Pat. No. 5,855,866); Thomsen-Friedenreich (TF) antigen from adenocarcinoma cells (See, e.g., U.S. Pat. No. 5,110,911); KC-4 antigen from human prostrate
- adenocarcinoma See, e.g., U.S. Pat. No. 4,743,543; a human colorectal cancer antigen (See, e.g., U.S. Pat. No. 4,921,789); CA125 antigen from cystadenocarcinoma (See, e.g., U.S. Pat. No. 4,921,790); DF3 antigen from human breast carcinoma (See, e.g., U.S. Pat. Nos. 4,963,484 and 5,053,489); a human breast tumour antigen (See, e.g., U.S. Pat. No.
- T and Tn haptens in glycoproteins of human breast carcinoma MSA breast carcinoma glycoprotein; MFGM breast carcinoma antigen; DU-PAN-2 pancreatic carcinoma antigen; CA125 ovarian carcinoma antigen; YH206 lung carcinoma antigen, Alphafetoprotein (AFP) hepatocellular carcinoma antigen; Carcinoembryonic antigen (CEA) bowel cancer antigen; Epithelial tumour antigen (ETA) breast cancer antigen;
- Tyrosinase the raf oncogene product; gp75; gplOO; EBV-LMP 1 & 2; EBV-EBNA 1, 2 & 3C; HPV-E4, 6, 7; C017-1A; GA733; gp72; p53; proteinase 3; telomerase; and melanoma gangliosides.
- tumour antigens whether or not presently characterized, are contemplated for use in the present invention.
- Polynucleotide-containing antigens used in the present invention include polynucleotides that encode polypeptide tumour antigens such as those listed above.
- the polynucleotide-containing antigens include, but are not limited to, DNA or RNA vector constructs, such as plasmid vectors (e.g., pCMV), which are capable of expressing polypeptide tumour antigens in vivo.
- the present invention also contemplates the preparation of conjugates comprising viral antigens that are capable of stimulating T-cell to elicit effective anti-viral immunity in patients who are or have been immunosuppressed, for example patients who have had bone marrow transplants, haematopoietic stem cell transplants, or are otherwise undergoing immunosuppression.
- antigens derived from viruses associated with increased incidence of cancer or that are reported to be cancer-causing, such as human papillomavirus, hepatitis A virus, and hepatitis B virus, are contemplated for use in the present invention.
- the tumour antigens include, but are not limited to, pl5, Hom/Mel-40, H-Ras, E2A-PRL, H4-RET, IGH-IGK, MYL-RAR, Epstein Barr virus antigens, human papillomavirus (HPV) antigens, including E6 and E7, hepatitis B and C virus antigens, human T-cell lymphotropic virus antigens, TSP-180, pl85erbB2, pl80erbB-3, c-met, mn-23Hl, TAG-72-4, CA 19-9, CA 72-4, CAM 17.1, NuMa, K-ras, pl6, TAGE, PSCA, CT7, 43-9F, 5T4, 791 Tgp72, beta-HCG, BCA225, BTAA, CA 125, CA 15-3 (CA 27.29 ⁇ BCAA), CA 195, CA 242, CA-50, CAM43, CD68 ⁇ KP1, CO-029,
- M. tuberculosis antigens have been characterised and are suitable for use in the present invention. All M. tuberculosis antigens, whether or not presently characterized, that are capable of eliciting an immune response are contemplated. Exemplary M.
- tuberculosis antigens suitable for use include early secretary antigen target (ESAT) -6, Ag85A, Ag85B (MPT59), Ag85B, Ag85C, MPT32, MPT51, MPT59, MPT63, MPT64, MPT83, MPB5, MPB59, MPB64, MTC28, Mtb2, Mtb8.4, Mtb9.9, Mtb32A, Mtb39, Mtb41, TB10.4, TB10C, TB11B, TB12.5, TBI 3 A, TB14, TB15, TBI 5 A, TB16, TB16A, TB17, TB18, TB21, TB20.6, TB24, TB27B, TB32, TB32A, TB33, TB38, TB40.8, TB51, TB54, TB64, CFP6, CFP7, CFP7A, CFP7B, CFP8A, CFP8B, CFP9, CFP
- hepatitis antigens have been characterised and are suitable for use in the present invention.
- Exemplary hepatitis C antigens include C - p22, El - gp35, E2 - gp70, NS1 - p7, NS2 - p23, NS3 - p70, NS4A - p8, NS4B - p27, NS5A - p56/58, and NS5B - p68, and together with one or more antigenic portions or epitopes derived therefrom are each (whether alone or in combination) suitable for application in the present invention. All hepatitis antigens, whether or not presently characterized, that are capable of eliciting an immune response are contemplated.
- influenza antigens have been characterised and are suitable for use in the present invention.
- Exemplary influenza antigens suitable for use in the present invention include PB, PB2, PA, any of the hemagglutinin (HA) or neuramimidase (NA) proteins, NP, M, and NS, and together with one or more antigenic portions or epitopes derived therefrom are each (whether alone or in combination) suitable for application in the present invention. All influenza antigens, whether or not presently characterized, that are capable of eliciting an immune response are contemplated.
- a number of B. anthracis antigens have been identified as potential candidates for vaccine development and are useful in the present invention.
- PA83 is one such antigen for vaccine development.
- AZA FDA licensed vaccine for anthrax
- BioThrax® BioThrax®. This vaccine is derived from the cell-free supernatant of a non-encapsulated strain of B. anthracis adsorbed to aluminum adjuvant.
- PA is the primary immunogen in AVA.
- anthrax antigens suitable for use in the present invention include Protective antigen (PA or PA63), LF and EF (proteins), poly-gamma-(D-glutamate) capsule, spore antigen (endospore specific components), BcIA (exosporium specific protein), BxpB (spore- associated protein), and secreted proteins. All anthrax antigens together with one or more antigenic portions or epitopes derived therefrom, whether or not presently characterized, that are capable of eliciting an immune response are contemplated.
- PA Protective antigen
- LF and EF proteins
- poly-gamma-(D-glutamate) capsule poly-gamma-(D-glutamate) capsule
- spore antigen endospore specific components
- BcIA exosporium specific protein
- BxpB spore- associated protein
- secreted proteins secreted proteins. All anthrax antigens together with one or more antigenic portions or epitopes
- F. tularensis antigens have been identified as potential candidates for vaccine development and are useful in the present invention.
- AcpA and IgIC are antigens suitable for vaccine development.
- Other exemplary Tularemia antigens suitable for use in the present invention include O-antigen, CPS, outer membrane proteins (e.g. FopA), lipoproteins (e.g . Tul4), secreted proteins and lipopolysaccharide. All tularemia antigens together with one or more antigenic portions or epitopes derived therefrom, whether or not presently characterized, that are capable of eliciting an immune response are contemplated.
- B. abortusis antigens have been identified as potential candidates for vaccine development and are useful in the present invention.
- Ompl6 is one such antigen for vaccine development.
- Other exemplary Brucellosis antigens suitable for use in the present invention include O-antigen, lipopolysaccharide, outer membrane proteins (e.g. Ompl6), secreted proteins, ribosomal proteins (e.g.
- N. meningitidis antigens have been identified as potential candidates for vaccine development and are useful in the present invention.
- Cys6, PorA, PorB, FetA, and ZnuD are antigens suitable for vaccine development.
- Other exemplary Meningitis antigens suitable for use in the present invention include O-antigen, factor H binding protein (fHbp), TbpB, NspA, NadA, outer membrane proteins, group B CPS, secreted proteins and lipopolysaccharide. All menigitis antigens together with one or more antigenic portions or epitopes derived therefrom, whether or not presently characterized, that are capable of eliciting an immune response are contemplated.
- Flavivirus antigens have been identified as potential candidates for vaccine development to treat dengue fever and are useful in the present invention.
- dengue virus envelope proteins El - E4 and the membrane proteins M l - M4 are antigens suitable for vaccine development.
- Other exemplary dengue antigens suitable for use in the present invention include C, preM, 1, 2A, 2B, 3, 4A, 4B and 5. All dengue antigens together with one or more antigenic portions or epitopes derived therefrom, whether or not presently characterized, that are capable of eliciting an immune response are contemplated.
- a number of ebola virus antigens have been identified as potential candidates for vaccine development to treat ebola infection and are useful in the present invention.
- Filoviridae Zaire ebolavirus and Sudan ebolavirus virion spike glycoprotein precursor antigens ZEBOV-GP, and SEBOV-GP, respectively are suitable for vaccine development.
- Other exemplary ebola antigens suitable for use in the present invention include NP, vp35, vp40, GP, vp30, vp24 and L. All ebola antigens together with one or more antigenic portions or epitopes derived therefrom, whether or not presently characterized, that are capable of eliciting an immune response are contemplated.
- Flavivirus envelope antigen (E) from West Nile virus (WNV) is a non-toxic protein expressed on the surface of WNV virions (WNVE) and are suitable for vaccine development.
- WNV antigens suitable for use in the present invention include Cp, Prm, NS1, NS2A, NS2B, NS3, NS4A, NS4B and NS5.
- All West Nile antigens together with one or more antigenic portions or epitopes derived therefrom, whether or not presently characterized, that are capable of eliciting an immune response are contemplated.
- the above-listed or referenced antigens are exemplary, not limiting, of the present invention.
- the present invention also relates to pharmaceutical composition
- a pharmaceutical composition comprising an effective amount of a peptide conjugate of the present invention or a pharmaceutically acceptable salt or solvent thereof, and a pharmaceutically acceptable carrier.
- the present invention relates to a pharmaceutical composition
- a pharmaceutical composition comprising an effective amount of a peptide of the present invention or a pharmaceutically acceptable salt or solvate thereof, and a pharmaceutically acceptable carrier.
- compositions may comprise an effective amount of two or more peptides of the invention, two or more peptide conjugates of the invention, or one more peptides of the invention and one or more peptide conjugates of the invention in combination.
- pharmaceutically acceptable carrier refers to a carrier (adjuvant or vehicle) that may be administered to a subject together with the peptide or peptide conjugate of the present invention, or a pharmaceutically acceptable salt or solvent thereof, and a pharmaceutically acceptable carrier.
- compositions include, but are not limited to, ion exchangers, alumina, aluminum stearate, lecithin, self-emulsifying drug delivery systems (SEDDS) such as d-a-tocopherol polyethyleneglycol 1000 succinate, surfactants used in pharmaceutical dosage forms such as Tweens or other similar polymeric delivery matrices, serum proteins, such as human serum albumin, buffer substances such as phosphates, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, salts or electrolytes, such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based substances, polyethylene glycol, sodium carboxymethylcellulose, polyacrylates, waxes, polyethylene-polyoxypropylene-block polymers, poly
- Cyclodextrins such as ⁇ -, ⁇ -, and ⁇ -cyclodextrin, or chemically modified derivatives such as hydroxyalkylcyclodextrins, including 2- and 3-hydroxypropyl-3- cyclodextrins, or other solubilized derivatives may also be advantageously used to enhance delivery.
- Oil solutions or suspensions may also contain a long-chain alcohol diluent or dispersant, or carboxymethyl cellulose or similar dispersing agents, which are commonly used in the formulation of pharmaceutically acceptable dosage forms such as emulsions and or suspensions.
- the compositions are formulated to allow for administration to a subject by any chosen route, including but not limited to oral or parenteral (including topical, subcutaneous, intramuscular and intravenous) administration.
- compositions may be formulated with an appropriate pharmaceutically acceptable carrier (including excipients, diluents, auxiliaries, and combinations thereof) selected with regard to the intended route of administration and standard pharmaceutical practice.
- an appropriate pharmaceutically acceptable carrier including excipients, diluents, auxiliaries, and combinations thereof
- the compositions may be administered orally as a powder, liquid, tablet or capsule, or topically as an ointment, cream or lotion.
- suitable formulations may contain additional agents as required, including emulsifying, antioxidant, flavouring or colouring agents, and may be adapted for immediate-, delayed-, modified-, sustained-, pulsed- or controlled-release.
- compositions may be formulated to optimize bioavailability, immunogenicity, or to maintain plasma, blood, or tissue concentrations within the immunogenic or therapeutic range, including for extended periods. Controlled delivery preparations may also be used to optimize the antigen concentration at the site of action, for example.
- compositions may be formulated for periodic administration, for example to provide continued exposure.
- Strategies to elicit a beneficial immunological response for example those that employ one or more "booster" vaccinations, are well known in the art, and such strategies may be adopted.
- compositions may be administered via the parenteral route.
- parenteral dosage forms include aqueous solutions, isotonic saline or 5% glucose of the active agent, or other well-known pharmaceutically acceptable excipients.
- Cyclodextrins for example, or other solubilising agents well-known to those familiar with the art, can be utilized as pharmaceutical excipients for delivery of the therapeutic agent.
- dosage forms suitable for oral administration include, but are not limited to tablets, capsules, lozenges, or like forms, or any liquid forms such as syrups, aqueous solutions, emulsions and the like, capable of providing a therapeutically effective amount of the composition.
- Capsules can contain any standard pharmaceutically acceptable materials such as gelatin or cellulose.
- Tablets can be formulated in accordance with conventional procedures by compressing mixtures of the active ingredients with a solid carrier and a lubricant. Examples of solid carriers include starch and sugar bentonite. Active ingredients can also be administered in a form of a hard shell tablet or a capsule containing a binder, e.g ., lactose or mannitol, a conventional filler, and a tabletting agent.
- dosage forms suitable for transdermal administration include, but are not limited, to transdermal patches, transdermal bandages, and the like.
- dosage forms suitable for topical administration of the compositions include any lotion, stick, spray, ointment, paste, cream, gel, etc., whether applied directly to the skin or via an intermediary such as a pad, patch or the like.
- dosage forms suitable for suppository administration of the compositions include any solid dosage form inserted into a bodily orifice particularly those inserted rectally, vaginally and urethrally.
- dosage of forms suitable for injection of the compositions include delivery via bolus such as single or multiple administrations by intravenous injection,
- subcutaneous, subdermal, and intramuscular administration or oral administration are subcutaneous, subdermal, and intramuscular administration or oral administration.
- dosage forms suitable for depot administration of the compositions include pellets of the peptides or peptide conjugates or solid forms wherein the peptides or peptide conjugates are entrapped in a matrix of biodegradable polymers,
- microemulsions liposomes or are microencapsulated.
- infusion devices for the compositions include infusion pumps for providing a desired number of doses or steady state administration, and include implantable drug pumps.
- implantable infusion devices for compositions include any solid form in which the peptides or peptide conjugates are encapsulated within or dispersed throughout a biodegradable polymer or synthetic, polymer such as silicone, silicone rubber, silastic or similar polymer.
- dosage forms suitable for transmucosal delivery of the compositions include depositories solutions for enemas, pessaries, tampons, creams, gels, pastes, foams, nebulised solutions, powders and similar formulations containing in addition to the active ingredients such carriers as are known in the art to be appropriate.
- dosage forms include forms suitable for inhalation or insufflation of the compositions, including compositions comprising solutions and/or suspensions in pharmaceutically acceptable, aqueous, or organic solvents, or mixture thereof and/or powders.
- Transmucosal administration of the compositions may utilize any mucosal membrane but commonly utilizes the nasal, buccal, vaginal and rectal tissues.
- Formulations suitable for nasal administration of the compositions may be administered in a liquid form, for example, nasal spray, nasal drops, or by aerosol administration by nebulizer, including aqueous or oily solutions of the polymer particles.
- Formulations may be prepared as aqueous solutions for example in saline, solutions employing benzyl alcohol or other suitable preservatives, absorption promoters to enhance bio-availability, fluorocarbons, and/or other solubilising or dispersing agents known in the art.
- Examples of dosage forms suitable for buccal or sublingual administration of the compositions include lozenges, tablets and the like.
- dosage forms suitable for opthalmic administration of the compositions include inserts and/or compositions comprising solutions and/or suspensions in pharmaceutically acceptable, aqueous, or organic solvents.
- compositions including vaccines
- sweetman S. C. (Ed.). Martindale. The Complete Drug Reference, 33rd Edition, Pharmaceutical Press, Chicago, 2002, 2483 pp. ; Aulton, M. E. (Ed.)
- the USP also provides examples of modified-release oral dosage forms, including those formulated as tablets or capsules. See, for example, The United States Pharmacopeia 23/National Formulary 18, The United States Pharmacopeial Convention, Inc., Rockville MD, 1995 (hereinafter "the USP"), which also describes specific tests to determine the drug release capabilities of extended-release and delayed- release tablets and capsules.
- the USP test for drug release for extended-release and delayed-release articles is based on drug dissolution from the dosage unit against elapsed test time. Descriptions of various test apparatus and procedures may be found in the USP.
- Extended release oral dosage forms development, evaluation, and application of in vitro/in vivo correlations. Rockville, MD : Center for Drug Evaluation and Research, Food and Drug Administration, 1997).
- composition may comprise one or more extrinsic adjuvants, advantageously in some embodiments this is not necessary.
- the peptide conjugate comprises an epitope and is self adjuvanting.
- the present invention provides a method of vaccinating or eliciting an immune response in a subject comprising administering to the subject an effective amount of a peptide conjugate or peptide of the present invention.
- the present invention also relates to use of a peptide conjugate or peptide of the invention for vaccinating or eliciting an immune response in a subject, and to use of a peptide conjugate or a peptide of the invention in the manufacture of a medicament for vaccinating or eliciting an immune response in a subject.
- the present invention also provides a method of vaccinating or eliciting an immune response in a subject comprising administering to the subject an effective amount of the pharmaceutical composition of the present invention.
- the present invention also relates to use of a pharmaceutical composition of the invention for vaccinating or eliciting an immune response in a subject, and to the use of one or more peptides of the present invention or one or more peptide conjugates of the present invention in the manufacture of a medicament for vaccinating or eliciting an immune response in a subject.
- the present invention provides a method of eliciting an immune response in a subject comprising administering to the subject an effective amount of a peptide of the present invention.
- the present invention also relates to use of a conjugate of the invention for eliciting an immune response, and to use of a peptide conjugate of the invention in the manufacture of a medicament for eliciting an immune response in a subject.
- the present invention provides a method of vaccinating a subject comprising
- the present invention also relates to use of a conjugate of the invention for eliciting an immune response, and to use of a peptide conjugate of the invention in the manufacture of a medicament for eliciting an immune response in a subject.
- peptides of the present invention administered or use of one or more peptides of the present invention and/or one or more peptide conjugates of the present invention, for example one or more peptide in together with one or more peptide conjugates, for vaccinating or eliciting an immune response in the subject is contemplated herein.
- two or more peptides, two or more peptide conjugates, or one or more peptides and one or more peptide conjugates are administered or used, the two or more peptides, two or more peptide conjugates, or one or more peptides and one or more peptide conjugates may be administered or used simultaneously, sequentially, or separately.
- a “subject” refers to a vertebrate that is a mammal, for example, a human. Mammals include, but are not limited to, humans, farm animals, sport animals, pets, primates, mice and rats.
- An "effective amount” is an amount sufficient to effect beneficial or desired results including clinical results. An effective amount can be administered in one or more administrations by various routes of administration.
- the effective amount will vary depending on, among other factors, the disease indicated, the seventy of the disease, the age and relative health of the subject, the potency of the compound administered, the mode of administration and the treatment desired . A person skilled in the art will be able to determine appropriate dosages having regard to these any other relevant factors.
- compositions can be evaluated both in vitro and in vivo.
- the composition can be tested in vitro or in vivo for its ability to induce a cell-mediated immune response.
- the composition can be fed to or injected into an animal (e.g., a mouse) and its effects on eliciting an immune response are then assessed. Based on the results, an appropriate dosage range and administration route can be determined.
- the composition may be administered as a single dose or a multiple dose schedule. Multiple doses may be used in a primary immunisation schedule and/or in a booster immunisation schedule.
- eliciting an immune response comprises raising or enhancing an immune response.
- eliciting an immune response comprises eliciting a humoral and a cell mediated response.
- eliciting an immune response provides immunity.
- the immune response is elicited for treating a disease or condition.
- a person skilled in the art will appreciate that the peptides and peptide conjugates described herein are useful for treating a variety of diseases and conditions, depending, for example, on the nature of epitope.
- the diseases or conditions are selected from those associated with the various antigens described herein.
- an infectious disease, cancer, or viral re-activation post-bone marrow transplant or following induction of profound immunosuppression for any other reason In some embodiments an infectious disease, cancer, or viral re-activation post-bone marrow transplant or following induction of profound immunosuppression for any other reason.
- treatment relates generally to treatment, of a human or a non-human subject, in which some desired therapeutic effect is achieved.
- the therapeutic effect may, for example, be inhibition, reduction, amelioration, halt, or prevention of a disease or condition.
- compositions may be used to elicit systemic and/or mucosal immunity.
- Enhanced systemic and/or mucosal immunity may be reflected in an enhanced TH1 and/or TH2 immune response.
- the enhanced immune response may include an increase in the production of IgGl and/or IgG2a and/or IgA.
- TLC Thin layer chromatography
- Nuclear magnetic resonance (NMR) spectra were acquired at room temperature in CDCI 3 or D 2 0 on a Bruker DRX400 spectrometer operating at 400 MHz for X H nuclei and 100 MHz for 13 C nuclei. Reference peaks for 1 H and 13 C spectra were respectively set to ⁇ .00 and ⁇ 77.0 for CDCI 3 and ⁇ 4.79 for X H spectra in D 2 0. NMR data were reported in values of chemical shift as parts per million (ppm) on the ⁇ scale, and coupling constants in hertz (Hz).
- High resolution mass spectra were obtained on a Bruker microOTOF-Q II mass spectrometer at a nominal resolution of 5000.
- Analytical high-performance liquid chromatography (HPLC) and liquid chromatography-mass spectrometry (LC-MS) chromatograms were acquired on either a Dionex UltiMate 3000 HPLC system with a Finnigan Surveyor MSQ Plus mass spectrometer or an Agilent 1120 Compact LC system with a Hewlett Packard Series 1100 MSD mass spectrometer.
- Analytical reverse phase (RP) HPLC was performed using the MeCN/H 2 0 + 0.1% TFA solvent system.
- Swelled peptide-resin was treated with 20% v/v/ piperidine in DMF (5.0 mL) and shaken for 20 min at r.t. The solution was drained and the resin washed with DMF (x 2) and DCM (x 2). A coupling mixture of Fmoc-AA-OH (2.0 eq.), HBTU (2.0 eq) and / ' Pr 2 NEt (4.0 eq.) in DMF (1 mL) was added and the resin shaken for 1 hr. Resin was drained and washed again. The procedure was repeated for the remaining residues in the sequence.
- Peptido-resin was transferred to the reaction vessel of a Tribute automated peptide synthesiser. Automated synthesis was undertaken with cycles of Fmoc deprotection and Fmoc-AA-OH coupling steps. Deprotection was undertaken by addition of 20% v/v piperidine in DMF (6.0 mL) and agitation (2 x 7 min). Following resin drainage and DMF washing (4 mL x 3), a coupling step was performed with 5 eq. Fmoc-AA-OH dissolved in HBTU (0.24 mM, in DMF, 4 mL). 2 M /V-methylmorpholine (NMM) in DMF (4 mL) was utilised in the base-addition step. Coupling proceeded for 1 hr. After DMF washing steps, the next cycle of deprotection and coupling commenced, repeating until all amino acids were coupled.
- Peptido-resin was swelled in 1 : 1 CH 2 CI 2 : DMF for 30 min, then drained.
- a coupling mixture of a Cys amino acid (0.2 mmol, 2 eq.), BOP (0.4 mmol, 4 eq.) and HOBt.H 2 0 (0.4 mmol, 4 eq.) was dissolved in 1 : 1 CH 2 CI 2 : DMF (2 mL). 2,4,6-collidine (0.4 mmol, 4 eq.) was then added and the resultant solution added to the peptido-resin.
- the resin was agitated for 1 hr, or until ninhydrin test indicated no free amines.
- the resin was then drained, washed with DMF (2x) and CH 2 CI 2 (2x), and dried.
- Fmoc-Cys(Trt)-OH (1.0 g, 1.7 mmol) was dissolved in CH 2 CI 2 (50 mL). TFA (1.5 mL, 19.6 mmol) and / ' Pr 3 SiH (0.75 mL) were added, causing the solution to turn yellow. The solution was agitated for 2 hrs at room temperature, at which point the solution had turned colourless. The mixture was basified to pH 9 by addition of Na 2 C0 3 .H 2 0 and washed with EtOAc. The solution was acidified with 10M HCI, extracted with EtOAc and concentrated in vacuo to give a white powder and a pink residue. The powder and residue were dissolved in 4: 1 MeCN : H 2 0 and lyophilised, giving a crude pink-white powder (424 mg, crude yield 73.1%). This crude product was carried through to the thiol-ene reactions described below.
- Fmoc-Cys-OH 100 mg, 0.29 mmol was dissolved in degassed, anhydrous DMF (500 ⁇ _). Vinyl palmitate (90 ⁇ _, 0.3 mmol) and DMPA (5.0 mg, 20 pmol) were dissolved in degassed CH 2 CI 2 (200 ⁇ _). The two solutions were combined and the resultant mixture irradiated for 6 hr (365 nm UV) in a standard photochemical apparatus. When no further change in the reaction mixture could be observed by TLC, solvent was removed under reduced pressure.
- the cleavage cocktail was then treated with cold diethyl ether to precipitate the crude peptide, which was centrifuged at 4000 rpm for 5 minutes. The supernatant was discarded and the pellet washed with diethyl ether, before repeating the spinning step. The ether phase was then discarded and the peptide dried with N 2 flow. The crude peptide was then lyophilised from H 2 0 + 0.1% TFA. The crude product was carried through to the thiol-ene reaction step outlined below.
- Photo-initiation of the reaction was conducted with 1 eq. vinyl palmitate and 0.2 eq. DMPA as the photo-initiator. Reactions were conducted in a degassed DMF: DCM solvent mixture, irradiated for 1 hr with 365nm UV light in a standard photo-chemical apparatus. Near complete conversion of the Fmoc-Cys-OH was observed by TLC. Minimal byproducts were formed. Purification provided the product 200 in about 15% yield. Using 2 eq. vinyl palmitate provided 200 in 44% yield after purification.
- NMP N- methylpyrrolidone
- N-acetylated monoacyl lipopeptide 22 was achieved by semi- preparative RP-HPLC using a Phenomenex C18 column, running a gradient of 5-95% MeCN : H 2 0 + 0.1% TFA, 3% MeCN per min.
- the purified peptide was then lyophilised to afford the desired product as a white powder (5.1 mg, 14.9% from crude peptide).
- the relatively low yield may be due to by-product formation in the thiol-ene reaction.
- the thiol-ene reaction was also carried out using non-acetylated analogue CSK 4 .
- the NLV sequence was built up by automated Fmoc-SPPS, using standard conditions. A K 4 tag and a serine residue were then coupled to the N-terminus of the sequence. The peptidyl resin was then removed from the synthesiser and the cysteine residue coupled manually, using standard conditions. N-acetylation was then carried out. The peptide was then cleaved from the resin and lyophilised to give a white powder in good yield.
- WB heparinised whole blood
- 100 ⁇ of heparinised whole blood (WB) was incubated with 100 nM, 1 ⁇ and 10 ⁇ of each compound, in duplicate, and incubated overnight at 37 °C in a 5% C0 2 humidified incubator.
- Pam 3 CSK 4 (10 ⁇ ; EMC Microcollections) was used as a positive control.
- WB samples were stained with anti-CD14-FITC, anti-HLA- DR-Alexa700, anti-CD80-PE-Cy7, anti-CD40-PE, anti-CD86-APC, anti-CD16-APC-Cy7 (all from Biolegend) for 20mins at RT, protected from light.
- peptide syntheses described below were carried out using standard iterative Fmoc Solid-Phase Peptide Synthesis techniques on a Tribute peptide synthesiser (Protein Technologies International, Arlington, AZ).
- a typical deprotection and coupling cycle carried out on a 0.1 mmol scale entailed removal of the Fmoc protecting group from the resin- bound amino-acid using two treatments of 20% piperidine in DMF (4ml_ x 5min) then washing the resin with DMF.
- Reverse phase (RP)-HPLC was carried out using a Dionex Ultimate 3000 HPLC system.
- a peptide sample was injected into a reverse-phase Phenomenex Gemini C18 column (5 ⁇ , l lOA; 10x250mm) equilibrated in a suitable mixture of eluent A (water/0.1% TFA) and eluent B (MeCN/0.1%TFA) then an increasing gradient of eluent B was generated to elute the constituent components.
- Analytical HPLC was performed similarly, using a Phenomenex Gemini C18 column (3 ⁇ , llOA;
- Quadrapole mass spectrometer Quadrapole mass spectrometer.
- NMR spectra were obtained using a Bruker BRX400 spectrometer operating at 400MHz for X H NMR and at 100MHz for 13 C NMR.
- Fmoc-cysteine was introduced as the /V-terminal residue of the on- resin peptide by reaction with Fmoc-Cys(Trt)-OH, HATU, and 4-methylmorpholine in DMF.
- the Fmoc group was removed using 20% piperidine in DMF.
- the resulting amine group was converted to an acetamide by treatment with a mixture of 20% acetic anhydride in DMF (2 ml.) and 4-methylmorpholine (1 mmol).
- the solid was dissolved in 1 : 1 water/MeCN and lyophilised. If the peptide contained a methionine residue the solution was heated at 60°C for 1 hour prior to freeze-drying to reverse any S-alkylation that may have occurred during cleavage. The peptides were then purified by RP-HPLC to give material of >95%.
- Peptide 102 was synthesised with the side-chain of the non-terminal cysteine residue as a tert-butyl thioether so as to avoid unwanted side reactions at this location.
- DMPA dithiothreitol (9.2 mg), and vinyl palmitate (40mg, mmol) were dissolved in degassed NMP (2 ml_). ⁇ . of this solution was then added to 1 ⁇ of the peptide weighed into a small polypropylene vessel to give a solution containing 10 mM peptide, 5 mM DMPA, 30 mM DTT and 50 mM vinyl palmitate. NMP was compatible with the reaction conditions and effectively solvated all of the components of the reaction mixture.
- Peptide conjugates 110 and 113-116 were also prepared from peptides 100 and 103- 106 by the following alternative procedure (Table 2B).
- tert-butyl mercaptan (tBuSH) thiol was used in place of DTT. This resulted in increased and cleaner conversion of the substrate peptides to the desired peptide conjugate.
- Trifluoroacetic acid was also introduced to the reaction mixture. This further improved the reaction profile.
- DMPA degassed NMP
- tert-butyl mercaptan 17 ⁇ _
- vinyl palmitate 11.3 mg
- NMP degassed N-methylpyrrolidinone
- the peptide (1 ⁇ ) was weighed into a small polypropylene vessel equipped with a small stirrer and 10 ⁇ of the DMPA/tBuSH solution added followed by 100 ⁇ of the vinyl palmitate solution, to give a solution of approximately 10 mM peptide, 5 mM DMPA, 30 mM DTT and 80 mM vinyl palmitate. TFA (5.5 ⁇ _) was then added, to give a 5% solution.
- the reaction vessel was flushed with nitrogen and the vigorously stirred mixture irradiated with a hand-held 6 watt UV lamp (Spectronics, NY) operating at 365nm. After 20 minutes further DMPA (10 ⁇ _) and vinyl palmitate (50 ⁇ _) were added and irradiation continued for 20 min.
- Amino acid conjugates 200, 120, and 121 were prepared from /V-a-Fmoc-, /V-a-acetyl-, and /V-o-Boc-protected cysteine, respectively, as described and depicted below (Scheme 2).
- Solid N-a- protected cysteine was dissolved or suspended to a concentration of lOOmg/mL in the indicated solvent (Table 3) and vinyl palmitate (1.5 molar equivalents) added followed by the indicated quantity of initiator.
- the solution was prepared in a polypropylene vessel, DMPA added in the indicated molar proportions (Table 3) and the stirred mixture then irradiated at 365nm.
- the solution was prepared in a glass tube, the indicated quantity of AIBN (azobisisobutyronitriie) added and the stirred mixture heated either in an oil bath or in a microwave oven.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Public Health (AREA)
- Medicinal Chemistry (AREA)
- Veterinary Medicine (AREA)
- General Health & Medical Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Immunology (AREA)
- Animal Behavior & Ethology (AREA)
- Mycology (AREA)
- Microbiology (AREA)
- Epidemiology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Virology (AREA)
- Oncology (AREA)
- Organic Chemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Communicable Diseases (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicinal Preparation (AREA)
Priority Applications (11)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| HK16112681.1A HK1224279B (en) | 2013-06-28 | 2014-06-27 | Amino acid and peptide conjugates and conjugation process |
| EP19192675.7A EP3604271A1 (en) | 2013-06-28 | 2014-06-27 | Peptides for amino acid and peptide conjugates and conjugation process |
| US14/392,231 US10576144B2 (en) | 2013-06-28 | 2014-06-27 | Amino acid and peptide conjugates and conjugation process |
| AU2014300503A AU2014300503B2 (en) | 2013-06-28 | 2014-06-27 | Amino acid and peptide conjugates and conjugation process |
| CN201480042833.2A CN105555756B (zh) | 2013-06-28 | 2014-06-27 | 氨基酸缀合物和肽缀合物及缀合方法 |
| JP2016522936A JP6659535B2 (ja) | 2013-06-28 | 2014-06-27 | アミノ酸及びペプチド接合体及び接合方法 |
| CA2953747A CA2953747A1 (en) | 2013-06-28 | 2014-06-27 | Amino acid and peptide conjugates and conjugation process |
| EP14818659.6A EP3013789B1 (en) | 2013-06-28 | 2014-06-27 | Amino acid and peptide conjugates and conjugation process |
| AU2019200884A AU2019200884B2 (en) | 2013-06-28 | 2019-02-08 | Amino acid and peptide conjugates and conjugation process |
| US16/773,241 US20200306370A1 (en) | 2013-06-28 | 2020-01-27 | Amino acid and peptide conjugates and conjugation process |
| AU2020277160A AU2020277160A1 (en) | 2013-06-28 | 2020-11-25 | Amino acid and peptide conjugates and conjugation process |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| NZ61265413 | 2013-06-28 | ||
| NZ612654 | 2013-06-28 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US14/392,231 A-371-Of-International US10576144B2 (en) | 2013-06-28 | 2014-06-27 | Amino acid and peptide conjugates and conjugation process |
| US16/773,241 Continuation US20200306370A1 (en) | 2013-06-28 | 2020-01-27 | Amino acid and peptide conjugates and conjugation process |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2014207708A2 true WO2014207708A2 (en) | 2014-12-31 |
| WO2014207708A3 WO2014207708A3 (en) | 2015-04-16 |
Family
ID=52142779
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/IB2014/062648 Ceased WO2014207708A2 (en) | 2013-06-28 | 2014-06-27 | Amino acid and peptide conjugates and conjugation process |
Country Status (8)
| Country | Link |
|---|---|
| US (2) | US10576144B2 (https=) |
| EP (2) | EP3604271A1 (https=) |
| JP (2) | JP6659535B2 (https=) |
| CN (2) | CN105555756B (https=) |
| AU (3) | AU2014300503B2 (https=) |
| CA (1) | CA2953747A1 (https=) |
| TW (2) | TWI655201B (https=) |
| WO (1) | WO2014207708A2 (https=) |
Cited By (13)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2016103192A1 (en) * | 2014-12-23 | 2016-06-30 | Margaret Anne Brimble | Amino acid and peptide conjugates and uses thereof |
| WO2017145097A3 (en) * | 2016-02-26 | 2017-10-05 | Auckland Uniservices Limited | Amino acid and peptide conjugates and conjugation process |
| WO2019043604A1 (en) * | 2017-08-30 | 2019-03-07 | Auckland Uniservices Limited | PEPTIDE CONJUGATES, CONJUGATION METHOD, AND USES THEREOF |
| WO2019087161A1 (en) * | 2017-11-06 | 2019-05-09 | Auckland Uniservices Limited | Peptide conjugate cgrp receptor antagonists and methods of preparation and uses thereof |
| US10576144B2 (en) | 2013-06-28 | 2020-03-03 | Auckland Uniservices Limited | Amino acid and peptide conjugates and conjugation process |
| WO2020178739A1 (en) * | 2019-03-04 | 2020-09-10 | University Health Network | T cell receptors and methods of use thereof |
| US12017979B2 (en) | 2019-06-26 | 2024-06-25 | Ena Respiratory Pty Ltd | Molecules |
| US12195557B2 (en) | 2017-12-21 | 2025-01-14 | Axelia Oncology Pty Ltd | Optimised compounds |
| US12522644B2 (en) | 2019-03-04 | 2026-01-13 | University Health Network | T cell receptors and methods of use thereof |
| US12527809B2 (en) | 2019-03-04 | 2026-01-20 | University Health Network | T cell receptors and methods of use thereof |
| US12569431B2 (en) | 2010-09-22 | 2026-03-10 | Ena Respiratory Pty Ltd | Immunostimulatory method |
| US12577287B2 (en) | 2019-03-25 | 2026-03-17 | University Health Network | T cell receptors and methods of use thereof |
| US12611450B2 (en) | 2019-03-04 | 2026-04-28 | University Health Network | T cell receptors and methods of use thereof |
Families Citing this family (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| MX2020009950A (es) * | 2018-03-23 | 2021-04-28 | Carmot Therapeutics Inc | Moduladores de receptores acoplados a proteina g. |
| EP4141110A4 (en) | 2020-04-24 | 2025-04-09 | Sf Biotech Laboratuvar Danismanlik Anonim Sirketi | Method for producing particles of bacteriophages of the genus levivirus |
| CN111921001A (zh) * | 2020-08-19 | 2020-11-13 | 兰州百源基因技术有限公司 | 一种用于伤口愈合的薄膜及其制备方法 |
| US12281149B2 (en) | 2021-05-13 | 2025-04-22 | Carmot Therapeutics, Inc. | Modulators of G-protein coupled receptors |
| WO2023195516A1 (ja) * | 2022-04-08 | 2023-10-12 | 中外製薬株式会社 | ペプチド化合物の製造方法 |
Citations (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4743543A (en) | 1985-09-09 | 1988-05-10 | Coulter Corporation | Method for enhancing and/or accelerating immunoassay detection of human carcinoma tumor associated antigen in a pathology sample |
| US4914021A (en) | 1988-03-04 | 1990-04-03 | New England Deaconess Hospital Corporation | Carcinoma orosomucoid-related antigen, a monoclonal antibody thereto, and their uses |
| US4918164A (en) | 1987-09-10 | 1990-04-17 | Oncogen | Tumor immunotherapy using anti-idiotypic antibodies |
| US4921789A (en) | 1988-04-20 | 1990-05-01 | New England Deaconess Hospital Corporation | Marker for colorectal carcinoma and methods of detecting the same |
| US4921790A (en) | 1987-04-24 | 1990-05-01 | Research Corporation | Tumor specific assay for CA125 ovarian cancer antigen |
| US4939240A (en) | 1983-03-04 | 1990-07-03 | Health Research, Inc. | Monoclonal antibodies to human breast carcinoma cells and their use in diagnosis and therapy |
| US4963484A (en) | 1988-01-29 | 1990-10-16 | Dana-Farber Cancer Institute, Inc. | Genetically engineered polypeptides with determinants of the human DF3 breast carcinoma-associated antigen |
| US5053489A (en) | 1988-01-29 | 1991-10-01 | Dana-Farber Cancer Institute, Inc. | Genetically engineered polypeptides with determinants of the human DF3 breast carcinoma-associated antigen |
| US5110911A (en) | 1989-11-02 | 1992-05-05 | Biomira, Inc. | Human tumor-associated thomsen-friedenreich antigen |
| US5808005A (en) | 1993-02-05 | 1998-09-15 | Epigen, Inc. | Human carcinoma antigen |
| US5855866A (en) | 1992-03-05 | 1999-01-05 | Board Of Regenis, The University Of Texas System | Methods for treating the vasculature of solid tumors |
| US5892020A (en) | 1992-12-11 | 1999-04-06 | The Dow Chemical Company | Multivalent single chain antibodies |
| US20040057963A1 (en) | 2002-07-13 | 2004-03-25 | Peter Andersen | Therapeutic TB vaccine |
| US7037510B2 (en) | 1997-04-18 | 2006-05-02 | Statens Serum Institut | Hybrids of M. tuberculosis antigens |
| US20080199493A1 (en) | 2004-05-25 | 2008-08-21 | Picker Louis J | Siv and Hiv Vaccination Using Rhcmv- and Hcmv-Based Vaccine Vectors |
| US20080267990A1 (en) | 1997-04-02 | 2008-10-30 | Statens Serum Institut | Tb diagonostic based on antigens from m. tuberculosis |
Family Cites Families (84)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0014815A3 (de) | 1978-12-20 | 1980-10-29 | Ciba-Geigy Ag | Peptidderivate, Verfahren zu deren Herstellung und Zwischenprodukte sowie pharmazeutische Präparate mit einer dieser Verbindungen |
| US6074650A (en) | 1985-06-24 | 2000-06-13 | Hoechst Aktiengesellschaft | Membrane anchor/active compound conjugate, its preparation and its uses |
| DE3813821A1 (de) | 1988-04-22 | 1989-11-02 | Hoechst Ag | Synthetische vakzine gegen die maul- und klauenseuche und verfahren zu deren herstellung |
| US6024964A (en) | 1985-06-24 | 2000-02-15 | Hoechst Aktiengesellschaft | Membrane anchor/active compound conjugate, its preparation and its uses |
| JPH02172946A (ja) | 1988-12-26 | 1990-07-04 | Shinetsu Sakusan Vinyl Kk | カルボン酸アルケニルエステルの製造方法 |
| US6310180B1 (en) | 1993-06-21 | 2001-10-30 | Vanderbilt University | Method for synthesis of proteins |
| DE4331011A1 (de) | 1993-09-13 | 1995-03-16 | Bayer Ag | Nukleinsäuren-bindende Oligomere mit C-Verzweigung für Therapie und Diagnostik |
| AUPM446594A0 (en) | 1994-03-16 | 1994-04-14 | Csl Limited | Cytotoxic t-cell epitopes identified within epstein-barr virus |
| JPH08248579A (ja) | 1995-03-14 | 1996-09-27 | Mitsubishi Paper Mills Ltd | ハロゲン化銀写真感光材料及びその処理方法 |
| US5994294A (en) | 1996-02-02 | 1999-11-30 | Nitromed, Inc. | Nitrosated and nitrosylated α-adrenergic receptor antagonist compounds, compositions and their uses |
| AUPO007396A0 (en) | 1996-05-24 | 1996-06-20 | Csl Limited | Ebv ctl epitopes |
| US6251603B1 (en) * | 1996-10-03 | 2001-06-26 | Ludwig Institute For Cancer Research | Method for determining status of a cancerous condition by determining antibodies to NY-ESO-1 in a patient sample |
| AUPO784197A0 (en) | 1997-07-10 | 1997-08-07 | Csl Limited | Treatment of nasopharyngeal carcinoma |
| US5965535A (en) * | 1997-09-12 | 1999-10-12 | Ludwig Institute For Cancer Research | Mage-3 peptides presented by HLA class II molecules |
| ES2281935T3 (es) * | 1997-10-08 | 2007-10-01 | The Government Of The Usa, As Represented By The Secretary, Department Of Health And Human Services | Antigeno cancerigeno humano ny eso-1/ca6 y gen que codifica para el mismo. |
| IL125608A0 (en) | 1998-07-30 | 1999-03-12 | Yeda Res & Dev | Tumor associated antigen peptides and use of same as anti-tumor vaccines |
| US20040006242A1 (en) | 1999-02-01 | 2004-01-08 | Hawkins Lynn D. | Immunomodulatory compounds and method of use thereof |
| DE60044570D1 (de) | 1999-02-01 | 2010-07-29 | Eisai R&D Man Co Ltd | Verbindungen mit immunologischem Adjuvanseffekt |
| WO2001055393A2 (en) * | 2000-01-28 | 2001-08-02 | The Government Of The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Mhc class ii restricted t cell epitopes from the cancer antigen ny-eso-1 |
| AUPQ776100A0 (en) * | 2000-05-26 | 2000-06-15 | Australian National University, The | Synthetic molecules and uses therefor |
| AU2001273639A1 (en) | 2000-06-26 | 2002-01-08 | Neurogen Corporation | Aryl fused substituted 4-oxy-pyridines |
| US6506875B1 (en) | 2000-09-26 | 2003-01-14 | Ludwig Institute For Cancer Research | Isolated peptides which bind to HLA-C molecules and uses thereof |
| GB0030067D0 (en) | 2000-12-11 | 2001-01-24 | Univ Bristol | Therapeutic agent |
| EP1229043A1 (en) | 2001-01-30 | 2002-08-07 | Cyto-Barr B.V. | Peptides derived from Epstein Barr virus (EBV) proteins LMP1, LMP2 and BARF1 antibody reagents reactive therewith |
| WO2003008537A2 (en) | 2001-04-06 | 2003-01-30 | Mannkind Corporation | Epitope sequences |
| AU2002353485B2 (en) | 2001-12-04 | 2009-01-15 | Ben Gurion University Of The Negev Research And Development Authority | Amphiphilic compounds and vesicles/liposomes for organ-specific drug targeting |
| FR2836684B1 (fr) * | 2002-03-04 | 2004-12-17 | Inst Nat Sante Rech Med | Peptides ras mutes et leur utilisation en immunotherapie |
| AU2003274463B2 (en) * | 2002-06-10 | 2009-10-29 | University Of Rochester | Gene differentially expressed in breast and bladder cancer and encoded polypeptides |
| GB0214528D0 (en) | 2002-06-24 | 2002-08-07 | Univ Aberdeen | Materials and methods for induction of immune tolerance |
| BR0313101A (pt) | 2002-08-12 | 2005-06-28 | Queensland Inst Med Res | Novos lipopeptìdeos imunogênicos que compreendem epitopos de linfócitos t-helper e linfócitos t citotóxicos (ctl), e métodos para sua produção e uso |
| AU2003250586B2 (en) | 2002-08-12 | 2010-09-23 | The Council Of The Queensland Institute Of Medical Research | Novel immunogenic lipopeptides comprising T-helper and B-cell epitopes |
| US20070048329A1 (en) | 2002-11-07 | 2007-03-01 | Rajiv Khanna | Epstein barr virus peptide epitopes, polyepitopes and delivery system therefor |
| US7491395B2 (en) | 2002-11-20 | 2009-02-17 | Bestewil Holding B.V. | Compositions comprising antigen-complexes, method of making same as well as methods of using the antigen-complexes for vaccination |
| WO2005000870A2 (en) | 2003-05-30 | 2005-01-06 | Ludwig Institute Of Cancer Research | Isolated ny-eso-1 peptides which bind to hla class ii molecules and uses thereof |
| JP2007500707A (ja) | 2003-07-29 | 2007-01-18 | リブ−エックス ファーマシューティカルズ,インコーポレイテッド | ビアリールヘテロ環状のアミン、アミドおよび硫黄−含有化合物、並びに該化合物の製造方法および使用方法 |
| EP1666056A1 (en) | 2004-12-06 | 2006-06-07 | Bestewil Holding B.V. | Cancer vaccine vesicles |
| US20080233143A1 (en) | 2005-02-07 | 2008-09-25 | Lipotek Pty Ltd. | Adjuvanting Material |
| FR2881746B1 (fr) | 2005-02-07 | 2007-04-13 | Centre Nat Rech Scient | Epitopes t cd4+des antigenes de latence de type i et ii du virus epstein-barr aptes a etre reconnus par la majorite des individus de la population caucasienne et leurs applications |
| CN101151280A (zh) | 2005-02-08 | 2008-03-26 | 昆士兰医学研究学院委员会 | 免疫原性分子 |
| GB0507003D0 (en) * | 2005-04-06 | 2005-05-11 | Molmed Spa | Therapeutic |
| EP1888121A2 (en) | 2005-05-12 | 2008-02-20 | Tapestry Pharmaceuticals, Inc. | Anticancer targeted conjugates comprising a succinyl or glutaryl linker |
| EP1943344A2 (en) * | 2005-10-04 | 2008-07-16 | The Ludwig Institute for Cancer Research | Methods for stimulating an immune response using bacterial antigen delivery system |
| JP2009511559A (ja) | 2005-10-12 | 2009-03-19 | バイオリポックス エービー | 炎症の治療に有用なベンゾオキサゾール類 |
| JP4824389B2 (ja) | 2005-10-28 | 2011-11-30 | 株式会社医学生物学研究所 | エプスタイン−バールウイルス感染細胞を特異的に攻撃する細胞傷害性t細胞エピトープペプチド及びその用途 |
| CN101379078A (zh) | 2005-12-06 | 2009-03-04 | 赛文医疗私人有限公司 | 爱泼斯坦-巴尔病毒相关疾病的治疗 |
| WO2007078879A2 (en) | 2005-12-21 | 2007-07-12 | Vaxinnate Corporation | Lipopeptide compositions and methods of use thereof |
| FR2896162B1 (fr) | 2006-01-13 | 2008-02-15 | Sanofi Pasteur Sa | Emulsion huile dans eau thermoreversible |
| WO2008021296A2 (en) | 2006-08-14 | 2008-02-21 | Thymon, L.L.C. | Compositions and methods for the treatment and prophylaxis of alzheimer's disease |
| ES2398492T3 (es) | 2007-01-15 | 2013-03-19 | Glaxosmithkline Biologicals Sa | Proteínas de fusión que comprenden los antígenos de rechazo tumoral NY-ESO-1 y LAGE-1 |
| US8309096B2 (en) * | 2007-01-15 | 2012-11-13 | Glaxosmithkline Biologicals S.A. | Fusion protein |
| CN101687022B (zh) | 2007-03-26 | 2016-09-07 | 莱顿大学医学中心附属莱顿教学医院 | Prame衍生的肽以及包括该肽的免疫原组合物 |
| WO2008151197A2 (en) | 2007-06-04 | 2008-12-11 | The Regents Of The University Of California | Tumor-derived endogenous toll-like receptor 4 ligands |
| WO2010003178A1 (en) | 2008-07-07 | 2010-01-14 | The University Of Melbourne | A synthetic vaccine component |
| US20100266623A1 (en) | 2008-07-07 | 2010-10-21 | The University Of Melbourne | Synthetic, self adjuvanting vaccines |
| WO2010028246A2 (en) | 2008-09-05 | 2010-03-11 | Id Biomedical Corporation Of Quebec | Novel compositions and adjuvants |
| EP2346830B1 (en) | 2008-09-15 | 2015-05-13 | Merck Sharp & Dohme Corp. | Glucagon receptor antagonist compounds, compositions containing such compounds and methods of use |
| EP2504330A1 (en) | 2009-11-23 | 2012-10-03 | Amgen Inc. | Amino heteroaryl compounds as beta-secretase modulators and methods of use |
| WO2011063233A1 (en) | 2009-11-23 | 2011-05-26 | Amgen Inc. | Amino heteroaryl compounds as beta-secretase modulators and methods of use |
| US20130045203A1 (en) | 2010-03-02 | 2013-02-21 | Emory University | Uses of Noscapine and Derivatives in Subjects Diagnosed with FAP |
| WO2011119628A2 (en) | 2010-03-23 | 2011-09-29 | The Regents Of The University Of California | Compositions and methods for self-adjuvanting vaccines against microbes and tumors |
| US20130029358A1 (en) | 2010-04-01 | 2013-01-31 | Ludwig Institute For Cancer Research Ltd. | Immunodominant mhc dr52b restricted ny-eso-1 epitopes, mhc class ii monomers and multimers, and uses thereof |
| WO2011156686A2 (en) | 2010-06-11 | 2011-12-15 | The Regents Of The University Of Colorado, A Body Corporate | Method for synthesizing a cyclic multivalent peptide using a thiol-mediated reaction |
| WO2012020215A1 (en) | 2010-08-09 | 2012-02-16 | Centro Nacional De Investigaciones Oncológicas (Cnio) | Amino- imidazolothiadiazoles for use as protein or lipid kinase inhibitors |
| US20140227305A1 (en) | 2010-08-25 | 2014-08-14 | Romana Lange-Ruiss | Epstein-barr-virus vaccine |
| EP2611905A4 (en) | 2010-09-01 | 2014-02-12 | Baylor College Medicine | EBV-SPECIFIC CYTOTOXIC T-LYMPHOCYTES FOR THE TREATMENT OF LOCOREGIONAL NANOPHARYNX CARCINOMA (NPC) |
| WO2012035558A2 (en) | 2010-09-14 | 2012-03-22 | Council Of Scientific & Industrial Research | A synthetic immunogen useful for generating long lasting immunity and protection against pathogens |
| HRP20171164T1 (hr) | 2010-09-20 | 2017-10-20 | Biontech Cell & Gene Therapies Gmbh | Antigen-specifični t stanični receptori i t stanični epitopi |
| EP2618842B1 (en) | 2010-09-22 | 2019-04-24 | Ena Therapeutics Pty Ltd | Novel immunostimulatory method |
| WO2012069188A1 (en) | 2010-11-24 | 2012-05-31 | Max-Planck-Gesellschaft Zur Foerderung Der Wissenschaften E.V | Continuous flow processes for photoconjugation of high-molecular chemical entities |
| US9187534B2 (en) * | 2011-03-11 | 2015-11-17 | Universite De Geneve | Multi-epitopic vaccine |
| CN103561771B (zh) | 2011-03-17 | 2019-01-04 | 伯明翰大学 | 重新定向的免疫治疗 |
| WO2012158122A1 (en) | 2011-05-13 | 2012-11-22 | Nanyang Technological University | Method for modification of organic molecules |
| US20120328660A1 (en) | 2011-06-03 | 2012-12-27 | Tsuji Takemasa | Immunogenic compositions useful in provoking an integrated response to tumor antigens |
| CN102839186A (zh) * | 2011-06-21 | 2012-12-26 | 上海生物制品研究所有限责任公司 | 表达ny-eso-1重组耻垢分枝杆菌的制备及应用 |
| GB201114051D0 (en) | 2011-08-15 | 2011-09-28 | Domainex Ltd | Compounds and their uses |
| WO2013036543A2 (en) * | 2011-09-10 | 2013-03-14 | H. Lee Moffitt Cancer Center And Research Institute, Inc. | Molecular imaging of cancer cells in vivo |
| NL2007536C2 (en) | 2011-10-05 | 2013-04-08 | Academisch Ziekenhuis Leiden Lumc | Adjuvant compound. |
| CN113876945A (zh) | 2011-10-06 | 2022-01-04 | 免疫疫苗技术有限公司 | 包括激活或增加tlr2活性的佐剂的脂质体组合物及其应用 |
| WO2013181597A2 (en) | 2012-05-31 | 2013-12-05 | Synchem, Inc. | Thiol-ene click chemistry for drug conjugates |
| US9861702B2 (en) | 2012-10-22 | 2018-01-09 | Wisconsin Alumni Research Foundation | Lipid-conjugated rhamnose for immune system recruitment and oncotherapy |
| WO2014088432A1 (en) * | 2012-12-06 | 2014-06-12 | Callaghan Innovation Research Limited | Conjugate compounds |
| EP3604271A1 (en) | 2013-06-28 | 2020-02-05 | Auckland Uniservices Limited | Peptides for amino acid and peptide conjugates and conjugation process |
| CN107250103A (zh) | 2014-12-23 | 2017-10-13 | 玛格丽特·安妮·布林布尔 | 氨基酸缀合物和肽缀合物以及其用途 |
| TW201735952A (zh) | 2016-02-26 | 2017-10-16 | 瑪格蕾特 安 布萊博 | 胺基酸及肽共軛物以及共軛過程 |
-
2014
- 2014-06-27 EP EP19192675.7A patent/EP3604271A1/en not_active Withdrawn
- 2014-06-27 CN CN201480042833.2A patent/CN105555756B/zh not_active Expired - Fee Related
- 2014-06-27 AU AU2014300503A patent/AU2014300503B2/en not_active Ceased
- 2014-06-27 EP EP14818659.6A patent/EP3013789B1/en active Active
- 2014-06-27 JP JP2016522936A patent/JP6659535B2/ja not_active Expired - Fee Related
- 2014-06-27 US US14/392,231 patent/US10576144B2/en active Active
- 2014-06-27 CN CN201811491358.3A patent/CN109893648A/zh active Pending
- 2014-06-27 WO PCT/IB2014/062648 patent/WO2014207708A2/en not_active Ceased
- 2014-06-27 CA CA2953747A patent/CA2953747A1/en not_active Abandoned
- 2014-06-30 TW TW103122466A patent/TWI655201B/zh not_active IP Right Cessation
- 2014-06-30 TW TW108105646A patent/TW201920229A/zh unknown
-
2019
- 2019-02-08 AU AU2019200884A patent/AU2019200884B2/en not_active Ceased
- 2019-10-25 JP JP2019194647A patent/JP2020023567A/ja active Pending
-
2020
- 2020-01-27 US US16/773,241 patent/US20200306370A1/en not_active Abandoned
- 2020-11-25 AU AU2020277160A patent/AU2020277160A1/en not_active Abandoned
Patent Citations (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4939240A (en) | 1983-03-04 | 1990-07-03 | Health Research, Inc. | Monoclonal antibodies to human breast carcinoma cells and their use in diagnosis and therapy |
| US4743543A (en) | 1985-09-09 | 1988-05-10 | Coulter Corporation | Method for enhancing and/or accelerating immunoassay detection of human carcinoma tumor associated antigen in a pathology sample |
| US4921790A (en) | 1987-04-24 | 1990-05-01 | Research Corporation | Tumor specific assay for CA125 ovarian cancer antigen |
| US4918164A (en) | 1987-09-10 | 1990-04-17 | Oncogen | Tumor immunotherapy using anti-idiotypic antibodies |
| US4963484A (en) | 1988-01-29 | 1990-10-16 | Dana-Farber Cancer Institute, Inc. | Genetically engineered polypeptides with determinants of the human DF3 breast carcinoma-associated antigen |
| US5053489A (en) | 1988-01-29 | 1991-10-01 | Dana-Farber Cancer Institute, Inc. | Genetically engineered polypeptides with determinants of the human DF3 breast carcinoma-associated antigen |
| US4914021A (en) | 1988-03-04 | 1990-04-03 | New England Deaconess Hospital Corporation | Carcinoma orosomucoid-related antigen, a monoclonal antibody thereto, and their uses |
| US4921789A (en) | 1988-04-20 | 1990-05-01 | New England Deaconess Hospital Corporation | Marker for colorectal carcinoma and methods of detecting the same |
| US5110911A (en) | 1989-11-02 | 1992-05-05 | Biomira, Inc. | Human tumor-associated thomsen-friedenreich antigen |
| US5855866A (en) | 1992-03-05 | 1999-01-05 | Board Of Regenis, The University Of Texas System | Methods for treating the vasculature of solid tumors |
| US5892020A (en) | 1992-12-11 | 1999-04-06 | The Dow Chemical Company | Multivalent single chain antibodies |
| US5808005A (en) | 1993-02-05 | 1998-09-15 | Epigen, Inc. | Human carcinoma antigen |
| US20080267990A1 (en) | 1997-04-02 | 2008-10-30 | Statens Serum Institut | Tb diagonostic based on antigens from m. tuberculosis |
| US7037510B2 (en) | 1997-04-18 | 2006-05-02 | Statens Serum Institut | Hybrids of M. tuberculosis antigens |
| US20040057963A1 (en) | 2002-07-13 | 2004-03-25 | Peter Andersen | Therapeutic TB vaccine |
| US20080199493A1 (en) | 2004-05-25 | 2008-08-21 | Picker Louis J | Siv and Hiv Vaccination Using Rhcmv- and Hcmv-Based Vaccine Vectors |
Non-Patent Citations (37)
| Title |
|---|
| "Animal Cell Culture", 1987 |
| "Antibodies: A Laboratory Manual", 1987 |
| "Beilsteins Handbuch der organischen Chemie" |
| "Current Protocols in Immunology", 1991 |
| "Current Protocols in Molecular Biology", 1987 |
| "Gene Transfer Vectors for Mammalian Cells", 1987 |
| "Handbook of Experimental Immunology" |
| "Martindale. The Complete Drug Reference", 2002, PHARMACEUTICAL PRESS, pages: 2483 |
| "Methods of Immunological Analysis", 1993, VCH VERLAGS GESELLSCHAFT MBH |
| "Oligonucleotide Synthesis", 1984 |
| "PCR: The Polymerase Chain Reaction", 1994 |
| "Pharmaceutics. The Science of Dosage Form Design", 2000, CHURCHILL LIVINGSTONE, pages: 734 |
| "Protective Groups in Organic Synthesis", 1999, JOHN WILEY & SONS |
| "Solid Phase Peptide Synthesis - A Practical Approach", 2000, OXFORD UNIVERSITY PRESS |
| "The Immunoassay Handbook", 1994, STOCKTON PRESS |
| ANSEL, H. C.; ALLEN, L. V.; POPOVICH, N. G.: "Pharmaceutical Dosage Forms and Drug Delivery Systems", 1999, LIPPINCOTT, pages: 676 |
| ATHERTON; SHEPPARD: "Solid Phase Peptide Synthesis: A Practical Approach", 1989, IRL PRESS |
| COFFMAN, R. L.; SHER, A.; SEDER, R. A., IMMUNITY, vol. 33, 2010, pages 492 - 503 |
| DEEPAK B. SALUNKE ET AL.: "Structure-Activity Relationships in Human Toll-like Receptor 2-specific Monoacyl Lipopeptides", JOURNAL OF MEDICINAL CHEMISTRY, vol. 55, no. 7, 12 April 2012 (2012-04-12), pages 3353 - 3363, XP055330670, DOI: doi:10.1021/jm3000533 |
| ERIKSSON, E. M. Y.; JACKSON, D. C., CURR. PROT. AND PEPT. SCI., vol. 8, 2007, pages 412 - 417 |
| FELDMANN, M.; STEINMAN, L., NATURE, vol. 435, 2005, pages 612 - 619 |
| FERNANDO ALBERICIO; ALBERT ISIDRO-LLOBET; MERCEDES ALVAREZ: "Amino Acid-Protecting Groups", CHEMICAL REVIEWS, vol. 109, 2009, pages 2455 - 2504, XP055081001, DOI: doi:10.1021/cr800323s |
| JONES: "The Chemical Synthesis of Peptides", 1994, CLARENDON PRESS |
| KAWAI, T.; AKIRA, S., IMMUNITY, vol. 34, 2011, pages 637 - 650 |
| KIBBE, E. H.: "Handbook of Pharmaceutical Excipients", 2000, AMERICAN PHARMACEUTICAL ASSOCIATION, pages: 665 |
| KOPYCINSKI, J. ET AL.: "Sequence flexibility of the immunodominant HLA A* 0201 restricted ppUL83 CD8 T-cell of human cytomegalovirus", JOURNAL OF MEDICAL VIROLOGY, vol. 82, no. 1, 2009, pages 94 - 103 |
| LAU Y.F. ET AL.: "Lipid-contaiing mimetics of natural triggers of innate immunity as CTL-inducing influenza vaccines", INTERNATIONAL IMMUNOLOGY, vol. 18, no. 12, 1 January 2006 (2006-01-01), pages 1801 - 1813, XP055018602, DOI: doi:10.1093/intimm/dxl114 |
| LI, J.; DONG, S. ET AL.: "Chemistry as an Expanding Resource in Protein Science: Fully Synthetic and Fully Active Human Parathyroid Hormone-Related Protein (1-141", ANGEWANDTE CHEMIE INTERNATIONAL EDITION, vol. 51, no. 49, 2012, pages 12263 - 12267 |
| LOUIS F FIESER; MARY F: "Reagents for Organic Synthesis", vol. 1-19, 1967, WILEY |
| MARGLIN, A.; MERRIFIELD, R.B., ANNU. REV, BIOCHEM., vol. 39, 1970, pages 841 - 66 |
| MERRIFIELD R.B., JAMA, vol. 210, no. 7, 1969, pages 1247 - 54 |
| MERRIFIELD, J. AM. SOC., vol. 85, 1963, pages 2146 - 2149 |
| SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 1989 |
| See also references of EP3013789A4 |
| SHIMIZU, T.; Y. KIDA; K. KUWANO: "A dipalmitoylated lipoprotein from Mycoplasma pneumoniae activates NF-kappa B through TLR1, TLR2, and TLR6", J IMMUNOL, vol. 175, no. 7, 2005, pages 4641 - 4646, XP002429117 |
| STEWART; YOUNG: "Solid-Phase Peptide Synthesis", 1984, PIERCE CHEMICAL CO. |
| T. W. GREENE; P. G. M. WUTS: "Protective Groups in Organic Synthesis", 1999, WILEY & SONS, INC. |
Cited By (23)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12569431B2 (en) | 2010-09-22 | 2026-03-10 | Ena Respiratory Pty Ltd | Immunostimulatory method |
| US10576144B2 (en) | 2013-06-28 | 2020-03-03 | Auckland Uniservices Limited | Amino acid and peptide conjugates and conjugation process |
| WO2016103192A1 (en) * | 2014-12-23 | 2016-06-30 | Margaret Anne Brimble | Amino acid and peptide conjugates and uses thereof |
| JP2018505152A (ja) * | 2014-12-23 | 2018-02-22 | アン ブリンブル マーガレット | アミノ酸複合体及びペプチド複合体ならびにそれらの使用 |
| US10253062B2 (en) | 2014-12-23 | 2019-04-09 | Margaret Anne Brimble | Amino acid and peptide conjugates and uses thereof |
| US11014960B2 (en) | 2014-12-23 | 2021-05-25 | Auckland Uniservices Limited | Amino acid and peptide conjugates and uses thereof |
| WO2017145097A3 (en) * | 2016-02-26 | 2017-10-05 | Auckland Uniservices Limited | Amino acid and peptide conjugates and conjugation process |
| CN108884020A (zh) * | 2016-02-26 | 2018-11-23 | 奥克兰联合服务有限公司 | 氨基酸及肽共轭物以及共轭过程 |
| US11464853B2 (en) | 2016-02-26 | 2022-10-11 | Auckland Uniservices Limited | Amino acid and peptide conjugates and conjugation process |
| AU2017223267B2 (en) * | 2016-02-26 | 2021-07-22 | Auckland Uniservices Limited | Amino acid and peptide conjugates and conjugation process |
| EP3676250A4 (en) * | 2017-08-30 | 2021-05-26 | Auckland Uniservices Limited | PEPTIDE CONJUGATES, CONJUGATION METHODS AND USES THEREOF |
| WO2019043604A1 (en) * | 2017-08-30 | 2019-03-07 | Auckland Uniservices Limited | PEPTIDE CONJUGATES, CONJUGATION METHOD, AND USES THEREOF |
| WO2019087161A1 (en) * | 2017-11-06 | 2019-05-09 | Auckland Uniservices Limited | Peptide conjugate cgrp receptor antagonists and methods of preparation and uses thereof |
| US12195557B2 (en) | 2017-12-21 | 2025-01-14 | Axelia Oncology Pty Ltd | Optimised compounds |
| WO2020178739A1 (en) * | 2019-03-04 | 2020-09-10 | University Health Network | T cell receptors and methods of use thereof |
| CN113906141A (zh) * | 2019-03-04 | 2022-01-07 | 大学健康网络 | T细胞受体及其使用方法 |
| US20220152104A1 (en) * | 2019-03-04 | 2022-05-19 | University Health Network | T cell receptors and methods of use thereof |
| US12522644B2 (en) | 2019-03-04 | 2026-01-13 | University Health Network | T cell receptors and methods of use thereof |
| US12527809B2 (en) | 2019-03-04 | 2026-01-20 | University Health Network | T cell receptors and methods of use thereof |
| CN113906141B (zh) * | 2019-03-04 | 2026-03-31 | 大学健康网络 | T细胞受体及其使用方法 |
| US12611450B2 (en) | 2019-03-04 | 2026-04-28 | University Health Network | T cell receptors and methods of use thereof |
| US12577287B2 (en) | 2019-03-25 | 2026-03-17 | University Health Network | T cell receptors and methods of use thereof |
| US12017979B2 (en) | 2019-06-26 | 2024-06-25 | Ena Respiratory Pty Ltd | Molecules |
Also Published As
| Publication number | Publication date |
|---|---|
| US10576144B2 (en) | 2020-03-03 |
| AU2019200884A1 (en) | 2019-03-21 |
| TW201920229A (zh) | 2019-06-01 |
| CN105555756B (zh) | 2018-12-07 |
| CN109893648A (zh) | 2019-06-18 |
| EP3013789B1 (en) | 2020-03-04 |
| US20170095554A1 (en) | 2017-04-06 |
| AU2019200884B2 (en) | 2020-11-05 |
| AU2014300503A1 (en) | 2016-01-21 |
| EP3013789A2 (en) | 2016-05-04 |
| JP2016523891A (ja) | 2016-08-12 |
| JP6659535B2 (ja) | 2020-03-04 |
| EP3013789A4 (en) | 2017-02-08 |
| TW201542583A (zh) | 2015-11-16 |
| CA2953747A1 (en) | 2014-12-31 |
| US20200306370A1 (en) | 2020-10-01 |
| WO2014207708A3 (en) | 2015-04-16 |
| EP3604271A1 (en) | 2020-02-05 |
| AU2020277160A1 (en) | 2020-12-24 |
| HK1224279A1 (en) | 2017-08-18 |
| CN105555756A (zh) | 2016-05-04 |
| TWI655201B (zh) | 2019-04-01 |
| JP2020023567A (ja) | 2020-02-13 |
| AU2014300503B2 (en) | 2018-11-22 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| AU2019200884B2 (en) | Amino acid and peptide conjugates and conjugation process | |
| US11014960B2 (en) | Amino acid and peptide conjugates and uses thereof | |
| AU2017223267B2 (en) | Amino acid and peptide conjugates and conjugation process | |
| AU2018323043A1 (en) | Peptide conjugates, conjugation process, and uses thereof | |
| HK40013754A (en) | Peptides for amino acid and peptide conjugates and conjugation process | |
| HK1224279B (en) | Amino acid and peptide conjugates and conjugation process |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 201480042833.2 Country of ref document: CN |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2014818659 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 14392231 Country of ref document: US |
|
| ENP | Entry into the national phase |
Ref document number: 2016522936 Country of ref document: JP Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2014300503 Country of ref document: AU Date of ref document: 20140627 Kind code of ref document: A |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 14818659 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 2953747 Country of ref document: CA |