WO2014090905A1 - Modified coiled coil type proteins having improved properties - Google Patents

Modified coiled coil type proteins having improved properties Download PDF

Info

Publication number
WO2014090905A1
WO2014090905A1 PCT/EP2013/076289 EP2013076289W WO2014090905A1 WO 2014090905 A1 WO2014090905 A1 WO 2014090905A1 EP 2013076289 W EP2013076289 W EP 2013076289W WO 2014090905 A1 WO2014090905 A1 WO 2014090905A1
Authority
WO
WIPO (PCT)
Prior art keywords
protein
modified
seq
imx313
antigen
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2013/076289
Other languages
English (en)
French (fr)
Other versions
WO2014090905A8 (en
Inventor
Judith DEL CAMPO ASCARATEIL
Imene TURKI HANI
Fergal Hill
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Imaxio SA
Original Assignee
Imaxio SA
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to DK13802415.3T priority Critical patent/DK2931896T3/en
Priority to AU2013357367A priority patent/AU2013357367B2/en
Priority to BR112015013387A priority patent/BR112015013387B8/pt
Priority to JP2015547006A priority patent/JP6518193B2/ja
Priority to PL13802415T priority patent/PL2931896T3/pl
Priority to KR1020157018233A priority patent/KR102237130B1/ko
Priority to MX2015007421A priority patent/MX363443B/es
Priority to CA2893120A priority patent/CA2893120C/en
Priority to ES13802415T priority patent/ES2719256T3/es
Application filed by Imaxio SA filed Critical Imaxio SA
Priority to CN201380072637.5A priority patent/CN104981541B/zh
Priority to EP13802415.3A priority patent/EP2931896B1/en
Priority to RU2015126105A priority patent/RU2677799C2/ru
Publication of WO2014090905A1 publication Critical patent/WO2014090905A1/en
Publication of WO2014090905A8 publication Critical patent/WO2014090905A8/en
Priority to US14/570,133 priority patent/US9388225B2/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4702Regulators; Modulating activity
    • C07K14/4703Inhibitors; Suppressors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0006Contraceptive vaccins; Vaccines against sex hormones
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/002Protozoa antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/02Bacterial antigens
    • A61K39/04Mycobacterium, e.g. Mycobacterium tuberculosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/02Bacterial antigens
    • A61K39/085Staphylococcus
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/385Haptens or antigens, bound to carriers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04Antibacterial agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • A61P31/16Antivirals for RNA viruses for influenza or rhinoviruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P33/00Antiparasitic agents
    • A61P33/02Antiprotozoals, e.g. for leishmaniasis, trichomoniasis, toxoplasmosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/305Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Micrococcaceae (F)
    • C07K14/31Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Micrococcaceae (F) from Staphylococcus (G)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K7/00Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/04Linear peptides containing only normal peptide links
    • C07K7/06Linear peptides containing only normal peptide links having 5 to 11 amino acids
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N7/00Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/53DNA (RNA) vaccination
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55561CpG containing adjuvants; Oligonucleotide containing adjuvants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55566Emulsions, e.g. Freund's adjuvant, MF59
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/57Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/60Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    • A61K2039/6031Proteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/62Medicinal preparations containing antigens or antibodies characterised by the link between antigen and carrier
    • A61K2039/627Medicinal preparations containing antigens or antibodies characterised by the link between antigen and carrier characterised by the linker
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/64Medicinal preparations containing antigens or antibodies characterised by the architecture of the carrier-antigen complex, e.g. repetition of carrier-antigen units
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/40Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/70Fusion polypeptide containing domain for protein-protein interaction
    • C07K2319/73Fusion polypeptide containing domain for protein-protein interaction containing coiled-coiled motif (leucine zippers)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2760/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
    • C12N2760/00011Details
    • C12N2760/16011Orthomyxoviridae
    • C12N2760/16034Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2760/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
    • C12N2760/00011Details
    • C12N2760/16011Orthomyxoviridae
    • C12N2760/16111Influenzavirus A, i.e. influenza A virus
    • C12N2760/16134Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein

Definitions

  • the present invention is related to recombinant antigens containing coiled coil domains or to antigens fused to proteins containing coiled coils, wherein the coiled coils are modified.
  • the modification improves the immunogenicity of the said antigens. Simultaneously, it improves their capacities to bind to negatively charged polymers such as nucleic acids including DNA and RNA, and to heparin.
  • a coiled coil is a structural motif in proteins, in which alpha-helices are coiled together like the strands of a rope. Coiled coil domains are abundant in natural proteins (1 , 2), and they may be the commonest method in nature of oligomerising proteins. Coiled-coils consist of two or more alpha-helices winding around each other in a supercoil, a simple yet versatile protein fold (3). A typical coiled-coil primary sequence is repetitive, made of seven-residue repeats called a 'heptad'.
  • coiled coil type proteins are involved in important biological functions. Of particular interest herein, are those found in antigens or in carrier proteins.
  • coiled coils found in antigens include, but are not limited to:
  • the dimeric coiled coils found in the OCA family are NadA, a Neisseria meningitidis protective antigen (4); YadA from Yersinia enterocolitica (5); UspA2 from Moraxella catarrhalis (6); BadA from Bartonella henselae (7) and HadA from Haemophilus influenzae (8).
  • the trimeric coiled coils found in, amongst others, the influenza hemagglutinin HA2 protein (9), the F glycoprotein of Respiratory Syncytial virus (10), the gp41 glycoproteins of HIV-1 (1 1 ) and HIV-2 (12), and gp1 ,2 of Ebolavirus (13).
  • Carrier proteins are in particular used to improve the immunogenicity of antigens.
  • Carrier proteins containing coiled coils have been described previously, notably a pentamer derived from COMP (15) and an artificial sequence which also forms pentamers (34), and heptamers derived from mammalian C4bp oligomerisation domains, such as the murine domain IMX108 (16), or avian C4bp oligomerisation domains (16, WO 2005/077976 and WO 2007/062819).
  • a hybrid avian oligomerisation domain called IMX313 (WO 2007/062819) is used as an example here.
  • nucleic acid binding peptides have been disclosed, such as the motif SPKK which was identified in the 1980s as a DNA binding motif, and peptides containing the motif SPKK can bind double-stranded DNA (21 ).
  • binding to RNA or to single-stranded DNA was not demonstrated, and Suzuki's data strongly suggest that binding to single-stranded DNA would not occur, as the minor groove only exists in double helical molecules.
  • peptides that have been shown to bind DNA include the protamine like domain of the Hepatitis B core antigen (38) which contains the peptide sequence SPRRRRS, used in some of the examples herein.
  • polyarginine tails are very susceptible to cleavage by proteases, especially serine proteases, and they have been replaced in routine use by polyhistidine tags, both for purification and immobilization purposes (45).
  • WO 2007/062819 describes complexes comprising as first component an avian C4bp domain and as second component an antigen, said components being in the form of a fusion protein or being non-covalently associated. This complex shows an increased immunogenicity of the antigen when administered to an organism.
  • WO 2011 /045612 describes a fusion protein containing a fragment of the C4bp protein from the chicken, and the mycobacterial antigen 85A. Said hybrid protein improves 85A immunogenicity, not only in animals such as rodents, but also in primates.
  • TLRs Toll-like receptors
  • TLRs Toll-Like Receptors
  • TLR3, TLR7, TLR8, TLR9 and TLR13 are ligands for a class of Toll-Like Receptors (hereafter TLRs), and notably for TLR3, TLR7, TLR8, TLR9 and TLR13 (23 and references therein). These are sometimes classed as the "Intracellular Toll-like Receptors", but at least TLR3 is also present on some cell surfaces (24).
  • TLR7 and TLR9 are localized in intracellular compartments (notably the endoplasmic reticulum and endosomes) and it has been shown clearly for TLR9 and TLR7 that cleavage of the receptor is necessary for activation of MyD88, through which the receptors' ligands signal (25, 26). As this cleavage occurs only in endolysosomes, it is possibly an evolutionary adaptation to prevent inappropriate signaling from self-nucleic acids.
  • TLR3 is expressed by a variety of epithelial cells including airway, uterine, corneal, vaginal, cervical, biliary and intestinal epithelial cell, and these cells appear to express TLR3 on their cell surfaces (24). It is perhaps not surprising, therefore, that the administration of poly l:C has been associated with a number of adverse effects (26). In that study, repeated administration at doses of 3 milligrams per gram was used. If the average mouse weighs nearly 35g, a dose of 100mg administered repeatedly can induce these effects. We needed only 2.5 g of poly l:C per dose in the immunizations described here.
  • TLR3 receptor The importance of limiting signaling through these receptors, and notably the TLR3 receptor, is dose-dependent.
  • An advantage of binding nucleic ligands tightly to the antigen is thus essential. Tightly bound intracellular TLR ligands are therefore highly preferred over formulations in which binding is less tight. Therefore, the man skilled in the art is looking for antigenic compositions able to bind efficiently TLR ligands, so that they are not separated from the antigen before the antigen arrives in the cells where it will trigger an immune response, with the goal of diminishing the potential adverse effects mediated by the binding of the ligands to TLR receptors elsewhere. DESCRIPTION OF THE INVENTION
  • the invention is related to proteins comprising coiled coil domains that are modified by the linkage of a positively charged peptide to the coiled coil domain.
  • the modified coiled coil type proteins have improved immunogenicity and simultaneously improved binding properties for negatively charged polymers such as heparin and nucleic acids. All the coiled coil proteins are recombinant, and the modification is obtained by fusing short peptide sequences to the termini of the coiled coils. In the examples herein the modification is carried out by genetic engineering techniques, but other methods of obtaining the modified coiled coils exist, such as peptide synthesis.
  • This positively charged peptide comprises preferentially arginines, but can also comprise instead lysines, or a combination of both.
  • This peptide is short, comprising seven amino acids or less, particularly 5, 6 or 7 amino acids.
  • One or more peptides may be used for each strand of the coiled coil.
  • Linkage is made directly to the coiled coil domain or through a linker peptide comprising one or more amino acids which does not affect the technical effects of the coiled coil domain, the positively charged peptide and their combination.
  • Linkers may contain any amino acids, but preferred linkers contain glycine, serine or proline, or combinations thereof.
  • the modified protein is the carrier protein IMX313, derived from the C4bp proteins of chicken.
  • the invention is also related to a fusion protein comprising a modified coiled-coil carrier protein fused to an antigen.
  • the invention is also related to a modified antigen comprising a modified coiled-coil domain.
  • the invention is also related to an immunogenic composition
  • an immunogenic composition comprising the modified fusion protein or a modified antigen, and nucleic acid ligands for intracellular TLRs.
  • the invention is also related to a support carrying the modified protein of the invention, the link to the support being formed through the peptide linked to the coiled coil domain.
  • the support heparin can be used in vitro or in vivo. Methods for using heparin to improve the immunogenicity of positively charged proteins are well known (47, and references therein).
  • the present application is also related to use of a modified antigen or of a modified fusion protein or an immunogenic composition such as described above, to induce an immune response in a patient.
  • a modified coiled coil type protein according to the present application wherein the positively charged peptide is linked to the coiled coil domain of the modified protein, presents advantages in comparison with the corresponding non-modified protein, and notably:
  • a “coiled coil type protein” also referenced as “coiled-coil containing protein” or "protein having a coiled coil domain” designates a protein comprising a coiled coil motif, i.e. at least two alpha-helical strands winding around each other in a supercoil.
  • coiled coil motif i.e. at least two alpha-helical strands winding around each other in a supercoil.
  • proteins containing such coiled coils have been reported in the literature.
  • the preferred coiled-coil type proteins are antigens and carrier proteins.
  • a “carrier protein” designates generally a protein to which antigens are conjugated or fused and thereby the antigens are rendered more immunogenic.
  • the term is used specifically in the meaning of a protein carrying an antigen.
  • the function of the protein is to increase the immunogenicity of said antigen to which it is conjugated or fused. Fusion has the advantage of creating a homogenous product.
  • the "conjugation” can be described as genetic: the DNA encoding the pro-immunogenic tag or carrier protein is spliced to the DNA encoding the antigen. With traditional, chemical conjugation methods, one is not always able to control precisely at which positions the antigen is joined to the protein. In this form, this subclass of carrier proteins is also called “pro-immunogenic tags" or even “adjuvant” (16) or “genetic adjuvant”.
  • a "modified protein” designates a protein having a modified sequence compared to the wild-type sequence, with the addition or partial substitution of a positively charged peptide according to the invention.
  • the difference between the unmodified protein and the modified protein of the invention lies in the positively charged peptide linked to the coiled coil domain, either added or partially substituted.
  • the modified protein of the invention is a recombinant protein, or a chimera not found in nature. Natural proteins comprising a coiled coil domain and a charged peptide domain modified elsewhere but not in the charged peptide domain are not part of the present invention.
  • the invention is related to a modified protein comprising (i) a protein having a coiled coil domain and (ii) at least one positively charged peptide linked to the coiled coil domain, the positively charged peptide having the sequence ZXBBBBZ (SEQ ID NO 1 ), wherein:
  • Z is any amino acid or is absent
  • - X is any amino acid
  • B is an arginine (R) or a lysine (K).
  • the last amino acid of the peptide may be neither an arginine nor a lysine residue when it is desired to protect the peptide against destruction by exoproteases such as carboxypeptidase B.
  • the modified protein of the invention comprises more than one positively charged peptide of SEQ ID N01
  • the peptides are preferably fused together to form one single positively charged peptide being a repetition of SEQ ID N01 of formula (ZXBBBBZ)n wherein n is an integer of 1 or more, up to at least 6, particularly 1 , 2, 3, 4, 5 or 6, preferably 2.
  • the 2, 3, 4, 5 or 6 peptides may be separated by one of more linkers as defined below.
  • the peptide has a sequence selected from the group consisting of the sequences SPRRRRS (SEQ ID NO 2), GRRRR (SEQ ID NO 3), SPKKKK (SEQ ID NO 4), GKKKK (SEQ ID NO 5) and GRRRRRS (SEQ ID NO 36) particularly for heptameric coiled coils.
  • a fusion of two positively charged peptides is preferred, more preferably with a sequence selected from the group consisting of the sequences SPRRRRRRRRRS (SEQ ID NO 37), a combination of a first peptide SPRRRR (SEQ ID NO 38) with a second peptide RRRRRS (SEQ ID NO 39) and GRRRRRRRRRRS (SEQ ID NO 40), a combination of a first peptide GRRRRR (SEQ ID NO 41 ) with the peptide RRRRRS (SEQ ID NO 39).
  • the peptide may be fused to the coiled coil at the C-terminus, or at the N-terminus.
  • the fusion of the peptide to the protein can be performed with a linker, a short peptidic sequence linking the peptide and the protein, or without.
  • Linkers may contain any amino acids, but preferred linkers contain glycine, serine or proline, or combinations thereof.
  • a few amino acids of the C-terminus of the protein can be deleted, and replaced with one or more copies of the peptide ZXBBBBZ.
  • the peptide is linked to the coiled coil at its C-terminal extremity.
  • the modified protein has a function of carrier protein, in particular acts as a carrier for antigens.
  • the modified protein is the chicken-derived carrier C4- binding protein called IMX313, comprising a heptameric coiled coil, described in the patent application WO 2007/062819.
  • a specific modified protein according to the invention is the protein IMX313 wherein the peptide GRRRR (SEQ ID NO 3) is linked to the coiled-coil domain of IMX313.
  • Another specific modified protein according to the invention is the protein IMX313 wherein the peptide SPKKKK (SEQ ID NO 4) is linked to the coiled-coil domain of IMX313.
  • Another specific modified protein according to the invention is the protein IMX313 wherein the peptide GKKKK (SEQ ID NO 5) is linked to the coiled-coil domain of IMX313.
  • a preferred specific modified protein according to the invention is the protein IMX313 wherein the peptide SPRRRRS (SEQ ID NO 2) is linked to the coiled-coil domain of IMX313.
  • the protein having function of a carrier protein is IMX313P (SEQ ID NO 42).
  • a protein comprising the sequence of IMX313P (SEQ ID NO 42) is also per se an object of the present invention, alone or fused with one or more positively charged peptide and an antigen or another protein.
  • the coiled coil domain of IMX313P (SEQ ID NO 42) is linked to a fusion of 2 positively charged peptides of SEQ ID NO 1 , more preferably the peptide of sequence SPRRRRRRRRRS (SEQ ID NO 37), or the peptide of sequence GRRRRRRRRRRS (SEQ ID NO 40).
  • the modified protein is not a carrier protein, but is an antigen.
  • Said oligomeric antigen is in particular selected from the group consisting of:
  • influenza hemagglutinin HA protein the influenza hemagglutinin HA protein
  • the invention is also related to an association between a modified carrier protein and an antigen.
  • a modified carrier protein IMX313
  • an antigen has already been shown to increase the immunogenicity of said antigen (see patent application WO 2007/062819).
  • a modified carrier protein With a modified carrier protein, the increase of immunogenicity is even better than with the unmodified IMX313 protein.
  • the modified carrier protein associated with an antigen is IMX313P having the sequence SEQ ID NO 42.
  • the two associated components are non-covalently associated with each other.
  • the two associated components are coupled chemically, and are in the form of a fusion protein. The man skilled in the art knows how to connect two peptidic components, in the aim of producing a fusion protein.
  • the invention is in particular related to a fusion protein comprising a carrier protein with a modified coiled coil and one or more antigens.
  • one of the following antigens is fused to the IMX313T or IMX313P modified protein:
  • Staphylococcus aureus Protein A protein mutated as described (27, 44), or the Staphylococcus aureus protein hemolysin alpha, or Staphylococcus aureus protein ClfB or Staphylococcus aureus protein Sortase A;
  • a specific fusion protein according to the invention is the protein IMX313P (SEQ ID NO 42) wherein the peptide GRRRRRS (SEQ ID NO 36) is linked to the coiled-coil domain of IMX313, and the modified protein is fused with the Staphylococcus aureus Protein A protein.
  • Another specific fusion protein according to the invention is the protein IMX313P (SEQ ID NO 42) wherein the peptide GRRRRRS (SEQ ID NO 36) is linked to the coiled-coil domain of IMX313, and the modified protein is fused with the protein 85A.
  • Another specific fusion protein according to the invention is the protein IMX313 (SEQ ID NO 6) wherein the peptide SPKKKK (SEQ ID NO 4) is linked to the coiled-coil domain of IMX313, and the modified protein is fused with the Staphylococcus aureus Protein A protein.
  • Another specific fusion protein according to the invention is the protein IMX313 (SEQ ID NO 6) wherein the peptide SPKKKK (SEQ ID NO 4) is linked to the coiled-coil domain of IMX313, and the modified protein is fused with the protein 85A.
  • Another specific fusion protein according to the invention is the protein IMX313 (SEQ ID NO 6) wherein the peptide GKKKK (SEQ ID NO 5) is linked to the coiled-coil domain of IMX313, and the modified protein is fused with the Staphylococcus aureus Protein A protein.
  • Another specific fusion protein according to the invention is the protein IMX313 (SEQ ID NO 6) wherein the peptide GKKKK (SEQ ID NO 5) is linked to the coiled-coil domain of IMX313, and the modified protein is fused with the protein 85A.
  • Another specific fusion protein according to the invention is the protein IMX108T (SEQ ID NO 64) wherein the peptide SPRRRRS (SEQ ID NO 2) is fused to the coiled coil domain of the protein IMX108 (SEQ ID NO 63).
  • a preferred specific modified protein according to the invention is the protein IMX313 (SEQ ID NO 6) wherein the peptide SPRRRRS (SEQ ID NO 2) is linked to the coiled-coil domain of IMX313, and the modified protein is fused with the Staphylococcus aureus Protein A protein.
  • Another preferred specific modified protein according to the invention is the protein IMX313 (SEQ ID NO 6) wherein the peptide SPRRRRS (SEQ ID NO 2) is linked to the coiled-coil domain of IMX313, and the modified protein is fused with the protein 85A.
  • these two model antigens were used to demonstrate that the modification of coiled coils improved their immunogenicity. Both B and T cell responses were improved. Furthermore, the modified coiled coils were more immunogenic when administered either as proteins or as nucleic acids.
  • the invention is also related to an immunogenic composition
  • an immunogenic composition comprising a modified coiled coil type protein such as described above, or a fusion protein such as described above, and nucleic acid ligands for intracellular TLRs.
  • These nucleic acid ligands for TLRs are preferentially complexed with a modified carrier protein.
  • the nucleic acid ligands are bound to the modified protein, although the corresponding unmodified carrier protein was unable to bind significantly these nucleic acid ligands for TLRs.
  • the invention is also related to an immunogenic composition
  • a modified coiled coil type protein such as described above, or a fusion protein such as described above, and heparin.
  • Heparin is preferentially complexed with a modified carrier protein.
  • heparin is bound to the modified protein, although the corresponding unmodified carrier protein was unable to bind significantly to heparin.
  • the invention is also related to a solid support carrying a modified protein, wherein said protein is bound to the support with the peptide ZXBBBBZ. Indeed, the abundance of charges in the peptide is sufficient to bind strongly the modified protein to the surface.
  • the invention is also related to a method for increasing the binding capacities to a support of a protein comprising a coiled coil domain, comprising the linking of at least one peptide ZXBBBBZ to the coiled coil domain, wherein:
  • Z is any amino acid, or is absent,
  • X is any amino acid
  • B is an arginine (R) or a lysine (K).
  • the support is a chromatography column. All soluble modified coiled coils proteins can be bound to such columns, using the positively charged peptide as an affinity tag.
  • the operator can modify the number of arginine residues in the peptide of general sequence ZXBBBBZ to strengthen or diminish the binding. Alternatively the operator can modify the number of peptides of the general sequence ZXBBBBZ to strengthen the binding.
  • the smaller the number of protein chains in the oligomer the larger the number of arginines in the peptide or peptides that should be used.
  • nine or more arginines per chain should preferably be used to ensure similar purification on heparin- sepharose.
  • the invention is also related to a method for increasing the immunogenicity of a carrier protein or of an antigen comprising a coiled coil domain, comprising the linking of at least one peptide ZXBBBBZ to the coiled coil domain of said protein wherein:
  • Z is any amino acid, or is absent,
  • X is any amino acid
  • B is an arginine (R) or a lysine (K).
  • the invention is also related to a method for increasing the immunogenicity of an antigen comprising:
  • the invention is in particular related to a method for increasing the Th1 immunogenicity of an antigen, characterized by a very high lgG2a to lgG1 ratios such as exemplified below, comprising:
  • the invention is also related to a modified antigen according to the invention, or of a fusion protein according to the invention, for its use as a vaccine.
  • the present application is also related to a method for inducing an immune response in a patient in need, comprising the administration to the patient of a vaccine composition comprising a fusion protein comprising a modified carrier protein and an antigen.
  • the present application is also related to a method for inducing an immune response in a patient in need, comprising the administration to the patient of a vaccine composition comprising an immunogenic composition comprising a modified protein and nucleic acid ligands for intracellular TLRs or heparin.
  • the invention is also related to the nucleic acid molecules encoding the modified proteins and fusion proteins such as described above.
  • the present invention concerns a vaccine composition
  • a vaccine composition comprising at least one nucleic acid molecule such as described above.
  • Vaccine compositions comprising nucleic acids molecules are well known by the man skilled in the art, and are in particular described in the patent application WO2008/122817, hereby incorporated by reference.
  • nucleic acids can be used per se, or they can be administered in viral vectors which are also described in the patent application WO2008/122817. Some viral vectors have been modified to produce nucleic acids which could then bind to the modified antigens which are encoded in viral vectors. Modification of viral vectors to produce nucleic acids is disclosed in WO2007/ 100908, hereby incorporated by reference.
  • the present invention is also related to a method for purifying a modified coiled-coil type proteins such as described above, comprising the following successive steps:
  • FIG. 1 Chromatogram of IMX313T purified on a Hi Trap heparin HP column. A Heparin- sepharose column clearly separates contaminants (peaks A and B) from the largely pure IMX313T protein (peak C). The dotted line shows the salt gradient used to elute the modified protein.
  • FIG. 1 IFN- ⁇ expression levels in total T cell populations.
  • IFN- ⁇ responses in co-culture supernatants are expressed as cells secreting IFN-Y/million of cells.
  • Figure 7. IFN- ⁇ expression levels in CD8+T cell populations.
  • 85A-specific cell-mediated immune responses in intramuscularly immunized mice. Groups of female BALB/c mice (n 5) immunized twice, 14 days apart, with plasmids expressing: 85A, 85A-IR14, 85A-TL18, 85A-IMX313, or 85A- IMX313T. Two weeks after the last immunization, the mice were sacrificed and purified splenic CD8+ T cells. Cells were co-cultured with the 85A peptide p1 1 .
  • IFN- ⁇ responses in co-culture supernatants were expressed as cells secreting IFN-Y/million of cells.
  • FIG. 8 IFN- ⁇ expression levels in CD4+T cell populations.
  • Figure 10 map of the parental plasmid pcDNA3 NP - This plasmid and its derivatives, constructed as described in the Examples, were used for DNA vaccination.
  • Figure 1 1 Comparison of total T cells secreting IFN- ⁇ in response to immunization with plasmids encoding NP, on NP fused to IMX313.
  • Figure 12 Comparison of CD8 and CD4 T cells secreting IFN- ⁇ in response to immunization with a plasmid encoding NP or a plasmid encoding NP fused to IMX313.
  • Figure 13 Comparison of IgG antibody responses to recombinant NP induced by DNA plasmids encoding either NP or NP fused to IMX313
  • Figure 14 Comparison of IgG antibody subclass responses to recombinant NP induced by DNA plasmids encoding either NP or NP fused to IMX313.
  • Figure 15 Comparison of total T cell responses to plasmids encoding NP, monomeric NP (NP-M), monomeric NP fused to IMX313 (NP-M-IMX313) and monomeric NP fused to IMX313T (NP-M- IMX313T).
  • Figure 16 Comparison of CD8+ and CD4+ T cell responses to plasmids encoding NP, monomeric NP (NP-M), monomeric NP fused to IMX313 (NP-M-IMX313) and monomeric NP fused to IMX313T (NP-M-IMX313T).
  • Figure 17 Comparison of IgG antibody responses, measured by ELISA using recombinant NP, to plasmids encoding NP, monomeric NP (NP-M), monomeric NP fused to IMX313 and monomeric NP fused to IMX313T.
  • Figure 18 Comparison of IgG antibody subclass responses, measured using recombinant NP, to plasmids encoding NP, monomeric NP (NP-M), monomeric NP fused to IMX313 and monomeric NP fused to IMX313T.
  • FIG. 19 Influence of the secretion, by the tPA signal peptide, of the various NP fusion proteins.
  • Total T cells were measured by IFNy ELISpots comparing NP, secreted NP (tPA-NP), secreted monomeric NP (tPA-NP-M), secreted NP fused to IMX313 (tPA-NP-IMX313), secreted monomeric NP fused to IMX313, and secreted monomeric NP fused to IMX313T (tPA-NP-M- IMX313T).
  • Figure 20 Influence of the secretion, by the tPA signal peptide, on the CD8+ and CD4+ responses to various NP fusion proteins, measured by IFNy ELISpots comparing: NP, secreted NP (tPA-NP), secreted monomeric NP (tPA-NP-M), secreted NP fused to IMX313 (tPA-NP-IMX313), secreted monomeric NP fused to IMX313, and secreted monomeric NP fused to IMX313T (tPA-NP-M- IMX313T).
  • Figure 21 Influence of the secretion, by the tPA signal peptide, of the IgG responses to various NP fusion proteins, measured by ELISAs comparing: NP, secreted NP (tPA-NP), secreted monomeric NP (tPA-NP-M), secreted NP fused to IMX313 (tPA-NP-IMX313), secreted monomeric NP fused to IMX313, and secreted monomeric NP fused to IMX313T (tPA-NP-M-IMX313T).
  • Figure 22 Influence of the secretion, by the tPA signal peptide, on the IgG subclass responses to various NP fusion proteins, measured by ELISAs comparing: NP, secreted NP (tPA-NP), secreted monomeric NP (tPA-NP-M), secreted NP fused to IMX313 (tPA-NP-IMX313), secreted monomeric NP fused to IMX313, and secreted monomeric NP fused to IMX313T (tPA-NP-M-IMX313T).
  • FIG. 23 This figure shows that the IMX743 protein binds a DNA oligonucleotide ODN1826 strongly, whereas the IMX744 binds only weakly to the same oligonucleotide.
  • Agarose gel electrophoresis was carried out in 0.8% in TAE buffer. The position in the gel to which the oligonucleotide migrated is observable under ultraviolet light when the gel is stained with ethidium bromide.
  • Different combinations of the TLR9 ligand ODN1826 and the IMX744 and IMX743 proteins were prepared, as described in the Table above the gel, and complex formation was analyzed by agarose gel electrophoresis.
  • IMX313 was produced by cloning this oligomerisation domain in a T7-based expression vector by standard methods.
  • the PCR product contained an Ndel site at the N-terminus and a Hindi 11 site overlapping the second stop codon.
  • the nucleotide sequence is:
  • This gene encodes the following protein sequence (SEQ ID NO 9):
  • IMX313 was expressed in the Escherichia coli strain C43(DE3).
  • the transformed cells were grown in Terrific Broth medium at 37° C to an OD600 of approximately 0.6, then expression was induced with IPTG at a concentration of 1 mM, and the culture was grown overnight at 37° C.
  • the harvested bacteria were lysed by sonication in a buffer containing 50 mM sodium phosphate pH 7.4 and centrifuged at 18,000 rpm for 30 minutes at 4°C.
  • the IMX313 protein was found in the soluble fraction.
  • IMX313T was generated by replacing the last five C-terminal amino acids (GLSKE) of IMX313 with the positively charged peptide (SPRRRRS) as follows: a PstI restriction site (CTGCAG: encoding the amino acids leucine and glutamine) was created by site-directed mutagenesis immediately preceding the amino acids to be substituted (GLSKE). This permits the substitution of the last five amino acids of IMX313 by any amino acids encoded by two complementary oligonucleotides which can be annealed and ligated to the PstI site and the Hind III site just downstream of the stop codons.
  • CGSKE C-terminal amino acids
  • SPRRRRS positively charged peptide
  • SEQ ID NO 12 5' GTCTCCGCGTCGCCGTCGCTCCTAATA 3' and
  • SEQ ID NO 13 5' AGCTTATTAGGAGCGACGGCGACGCGGAGACTGCA 3'.
  • nucleotide sequence encoding IMX313T is as follows (SEQ ID NO 14):
  • IMX313T was also expressed in the Escherichia coli strain C43(DE3).
  • the transformed cells were grown in Terrific Broth medium at 37° C to an OD600 of approximately 0.6, then expression was induced by adding IPTG to 1 mM, and the culture was grown overnight at 37° C.
  • the bacteria were lysed by sonication in a buffer containing 50 mM sodium phosphate pH 7.4 and centrifuged at 18,000 rpm for 30 minutes at 4° C.
  • the IMX313T protein was also found in the soluble fraction.
  • IMX313P was constructed by mutating the plasmid expressing IMX313T with the oligonucleotides: IMX205: 5' GGAGATTCAAAAACTGAAGGTGGAAGGTCGCCGTCGCCGTCGCTCC 3' (SEQ ID NO 43) and IMX139: 5' GGGCGATCGGTGCGGGCCTCTTCGC 3' (SEQ ID NO 44).
  • the PCR product was inserted by the method of Geiser (29) into a T7 vector expressing the IMX313T protein.
  • nucleotide sequence encoding IMX313P is as follows (SEQ ID NO 45):
  • the IMX313P protein was purified produced in the same manner as the IMX313T protein except that the lysis buffer also contained 1M NaCl.
  • the clarified bacterial lysate was heated at 80° C for 20 minutes and clarified again by centrifugation at 18,000 rpm for 30 minutes are 4°C.
  • IMX313P and IMX313T are heptameric
  • the protein IMX313T was purified on a Hi Trap SP FF 5 ml column equilibrated with 50 mM sodium phosphate pH 7.4. The protein was eluted in a 0 to 1M NaCl gradient. Fractions containing the protein IMX313T were pooled, dialyzed against 1x PBS and applied to a Hi Load 26/60 Superdex 75 pg column which was equilibrated with 1x PBS. The elution volume for IMX313T (Ve 170 ml) was very similar to that of IMX313 (Ve 162 ml).
  • the protein IMX313P was purified on a Heparin Sepharose column. The protein was first dialyzed against a solution of Tris-HCl pH8.0 and 150mM NaCl, before being loaded onto the column. The column was then developed with Tris-HCl pH8.0 and 2M NaCl. The eluted IMX313P protein fractions were pooled, dialyzed against PBS containing 500mM NaCl, and applied to a Hi Load 26/60 Superdex 75 pg column which was equilibrated with 1x PBS containing 500mM NaCl. The elution volume was indistinguishable from that of IMX313T.
  • IMX313T and IMX313P proteins were analyzed under native, denaturing and reducing conditions.
  • IMX313Tand IMX313P oligomerized as did IMX313, and all migrated with a much higher molecular weight than their monomers.
  • the IMX313T protein purified as above was subsequently loaded onto a HiTrap Heparin HP 5ml column in a buffer consisting of 10mM Tris-HCl and 150mM NaCl pH 7.5. Elution of bound proteins was carried out with a salt gradient: 15 column volumes of 2M NaCl in the same buffer.
  • the positively charged IMX313T protein bound to the heparin column and was eluted with approximately 1M NaCl. In a separate column run, it was shown that IMX313 did not bind to the heparin-sepharose column but was found instead in the flow through fraction.
  • Heparin sepharose is an affinity chromatography column. It is widely used for purifying serum proteins including coagulation factors, lipases, lipoproteins and hormone receptors and has also been used successfully for purifying growth factors.
  • the polyanionic structure of heparin which serves as an analogue of DNA and RNA, has enabled the purification of many types of proteins that interact with DNA or RNA, including polymerases, ligases, kinases, and ribosomal proteins.
  • Heparin-Sepharose columns can be used as affinity columns for proteins fused to IMX313T, and other coiled coils modified in the manner described here.
  • Heparin-Sepharose columns are more useful because they are more specific for modified coiled coils.
  • the protein IMX313T which eluted from the cation exchange column (Hi Trap SP FF; pH7.4) was not totally pure.
  • Heparin Sepharose acts as an affinity column for modified coiled coils
  • IMX313 was produced as described in example 1.
  • the soluble fraction was obtained after sonication of the bacterial lysate in a buffer containing 10mM Tris-HCl, 150mM NaCl pH7.5 and centrifugation at 18,000 rpm for 30 minutes at 4° C in a Sorvall SS34 rotor.
  • the supernatant containing the fusion protein was loaded on Hi Trap heparin HP column equilibrated with 10mM Tris-HCl and 150mM NaCl pH7.5. Elution was carried out with a salt gradient: 2M NaCl in the same buffer. Almost all contaminants were removed in the flow through, or with low concentration of salt; and the IMX313T protein was eluted later with approximately 1 M NaCl with a very high purity (approximately 95%) in just a single chromatographic step. Further purification by gel filtration produces an essentially pure protein. Results are presented in figure 1 .
  • IMX313T Three other modifications of IMX313T were made in order to compare different linkers (glycine versus serine and proline) or to compare arginine with lysine.
  • IMX206 5' GGAGATTCAAAMCTGAAGGTGGAAGGTCGCCGTCGCCGTTAATMGCTTGATCCGGC 3' (SEQ ID NO 46) or IMX207: 5' CTGAAGGTGGAATCTCCGaaaaagaaaaagTMTAAGCTTGATCCGGCTG 3' (SEQ ID NO 47) or
  • IMX208 G G AG ATTCAAAMCTG MG GTG G MG GTAAAAAG AAAAAGTMTMG CTTG ATCCG G C 3' (SEQ ID NO 48) and
  • plMX427, plMX428 and plMX429 encode the proteins:
  • IMX427 MSKKQGDADVCGEVAYIQSWSDCHVPTAELRTLLEIRKLFLEIQKLKVEGRRRR * (SEQ ID NO 50)
  • IMX428 MSKKQGDADVCGEVAYIQSVVSDCHVPTAELRTLLEIRKLFLEIQKLKVESPKKKK * (SEQ ID NO 51 )
  • IMX429 MSKKQGDADVCGEVAYIQSVVSDCHVPTAELRTLLEIRKLFLEIQKLKVEGKKKK *
  • the conditions were as follows: Loading buffer 20 mM Tris pH 7.5 150 mM NaCl. Then a gradient elution using a second buffer was carried out. The second buffer was 20 mM Tris pH 7.5 and 2M NaCl.
  • the protein A from Staphylococcus aureus open reading frame was amplified from the plasmid pEZZ18 (Amersham Pharmacia) using the oligonucleotides:
  • SEQ ID NO 15 - IMX1078 5' CTTTAAGAAGGAGATATACATATGgctgatgcgcaacaaataac 3' and SEQ ID NO 16 - IMX1079: 5' CCGCACACatcagcatcaccttgcttttttggtgcttgagcatcatttagc 3' and the PCR product of ⁇ 233bp base pairs was inserted by the method of Geiser (29) into a T7 vector expressing the IMX313 protein. The protein A reading frame was then mutated using the oligonucleotides:
  • IMX313 lacks the last five amino acids (GLSKE) found in the fifty-five amino acid version to facilitate the interpretation of the planned immunizations.
  • the IMX494 fusion protein (PAm-IMX313) was expressed in the C43(DE3) strain on induction with IPTG. The cell pellet was lysed by sonication in 20mM Tris-HCl pH 7 and centrifuged at 18,000 rpm for fifteen minutes at 4° C. The fusion protein was found in the pellet which was then sonicated in a buffer composed of 50mM Tris-HCl, 3M urea pH 7.4 and centrifuged again at 18 000 rpm. This time, the fusion protein was in the supernatant, which was loaded on Hi Trap Q FF 5ml column and the column developed with a 1 M NaCl gradient.
  • Fractions containing the IMX494 protein were pooled dialysed against PBS and further purified by gel filtration on a Hi Load 26/60 Superdex 75 column.
  • the IMX313 coding sequence was deleted from the vector plMX494 using the oligonucleotides:
  • a 500ml culture of plMX495 in the strain C43(DE3) was induced with 1 mM IPTG and grown overnight.
  • the harvested bacteria were lysed by sonication in the buffer: 50mM sodium phosphate pH 7.4 and centrifuged at 18,000 rpm for 15 minutes at 4°C in a Sorvall SS34 rotor.
  • the protein IMX495 (PAm without its N-terminal methionine) was found in the supernatant, and purified by heating the supernatant at 76 °C for fifteen minutes followed by a second centrifugation at 18k for 15 minutes.
  • IMX495 was found in the supernatant, which was dialysed against a buffer of 50mM MES pH6.
  • the supernatant was loaded onto a Hi Trap SP FF 5ml column and eluted with a gradient of NaCl. Finally, the IMX495 protein was polished by gel filtration in PBS on a Hi prep 26/60 sephacryl S-100 HR column.
  • the vector plMX497 encoding the fusion protein PAm-IMX313T
  • the vector plMX494 was modified by synonymously mutating the sequence encoding the last two amino acids leucine and glutamine from TTGCAA to CTGCAG, and then cloning between the newly created Pst I site and the Hind III site overlapping the second stop codon the oligonucleotides;
  • the encoded protein IMX497 was then expressed in the C43(DE3) strain and purified by lysing the bacterial pellet in 50mM sodium phosphate pH 7.4 and centrifuging at 18k rpm. The fusion protein was found in the pellet and was resuspended by sonication in 50mM sodium phosphate, 8M urea, pH 7.4. After a further centrifugation, the supernatant was dialysed against 50mM sodium phosphate pH 7.4 and the dialysate was centrifuged. The supernatant was heated to 75° C for fifteen minutes and then centrifuged again.
  • the supernatant was purified on a Hi Trap SP FF column developed with an NaCl gradient to 2M, and fractions containing the IMX497 fusion protein were pooled, dialysed against PBS and polished by gel filtration on a Hi Load 26/60 superdex 75 column. 7. Binding of intracellular TLR ligands
  • electrophoretic mobility shift assays were carried out.
  • TLR ligands used were as follows:
  • poly l:C being a duplex of a polynucleotide of polyinosinic acid hybridized to polycytidylic acid, an analogue of double-stranded RNA.
  • the chain length was twenty nucleotides for each strand.
  • TLR7 an oligonucleotide, called ssRNA40, with the sequence 5' GsCsCsCsGsUsCsUsGsUsUsGsUsGsUsGsAsCsUsC 3' where "s" represents a phosphothioate linkage (SEQ ID NO 25);
  • TLR9 an oligonucleotide called ODN1826 with the sequence: 5' tccatgacgttcctgacgtt 3' (SEQ ID NO 26).
  • Lane 1 Low molecular mass ladder (NEB);
  • Lane 3 FITC CpG ODN (Eurogentec) 10 ⁇ ;
  • Lane 7 Protein IMX497 (0.125 mg/ml) & FITC CpG ODN 10 ⁇ .
  • Lane 1 low mass ladder (NEB);
  • Lane 3 FITC ssRNA (Eurogentec) 10 ⁇ ;
  • Lane 7 Protein IMX497 (0.25 mg/ml)/ FITC ssRNA 10 ⁇ ;
  • Lane 8 Protein IMX497 (0.125 mg/ml)/ FITC ssRNA 10 ⁇ ;
  • Lane 9 FITC ssRNA ⁇ M
  • Lane 11 Poly (l:C)(R&D TOCRIS Bioscience) 0.5 mg/ml;
  • Lane 12 Protein IMX497 (1.5 mg/ml)/ Poly (l:C) 0.5 mg/ml;
  • Lane 13 Protein IMX497 (1 mg/ml)/ Poly (l:C) 0.5 mg/ml;
  • Lane 15 Protein IMX497 (0.5 mg/ml)/ Poly (l:C) 0.5 mg/ml;
  • Lane 1 low molecular mass ladder (NEB);
  • Lane 5 FITC CpG ODN (Eurogentec) 10 ⁇ ;
  • Lane 8 Protein IMX497 (0.5 mg/ml)& FITC CpG ODN 10 ⁇ ;
  • Lane 12 Protein IMX494 (0.25mg/ml) & FITC CpG ODN 10 ⁇ ;
  • Lane 14 Protein IMX495 (0.5 mg/ml)& FITC CpG ODN 10 ⁇ ;
  • the gel in figure 4 shows that the gel shift is reproducible with IMX497, but that IMX495 (lanes 13-15) produces no detectable gel shift and that the gel shifts seen with IMX494 (lanes 10-12) are barely detectable, and much less marked than those seen with IMX497.
  • IMX494 and IMX497 The difference between IMX494 and IMX497 is the presence of the sequence SPRRRRS present in IMX497, fused to the C-terminus of the coiled coil of the protein.
  • mice Immunisations of mice were then performed to determine the immunogenicity of PAm, whether alone or fused to IMX313 or IMX313T, and with or without formulation with the intracellular TLR ligands.
  • PAm formulated with complete or incomplete Freund's adjuvant (CFA/IFA) was used as a control.
  • mice Female BALB/C mice were immunized subcutaneously twice, with a 14 day interval, using 2 nanomoles of each protein per injection, with PAm, PAm-IMX313, PAm-IMX313T or PAm formulated first in CFA and then in IFA. Twenty-eight days after the first immunization, the PAm- specific IgG titers in sera were determined using an ELISA in which plates were coated with PAm. Results are expressed as the OD of samples measured at 405nm+ SEM. Significant differences between the means of different groups were determined by one-way ANOVA followed by Tukey's multiple comparison test. A p-value of ⁇ 0.05 was considered statistically significant, and is represented by different * , whereas *** represents p ⁇ 0.001 and ** is represents p ⁇ 0.01.
  • the antigen PAm was formulated with the intracellular TLR ligands (whether single- stranded DNA or RNA or double-stranded RNA), its immunogenicity was substantially improved, and similar improvements were seen when the antigen was fused to IMX313 before formulation. However, clearly the best results were seen when the antigen was fused to IMX313T before being formulated with the TLR ligands.
  • Th1 or Th2 responses we examined whether the formulation with intracellular TLR ligands could be used to re-direct the immune system to produce either Th1 or Th2 responses.
  • IgG antibody isotype data were used to evaluate the type of Th response, with a predominance of lgG2a or lgG1 antibodies indicating a Th1 - or Th2-like response, respectively.
  • Th1 -like responses had very high lgG2a-to-lgG1 ratios, such that the group mean was also high.
  • IMX313 14-mer and 18-mer fragments of IMX313 were chosen because they remained heptameric at 37° C, (and even 42 ° C), and should thus form heptameric fusion proteins when expressed after DNA vaccination.
  • the modifications of IMX313 were carried out as follows:
  • the forward primers IMX043 and IMX044 and the reverse primer IMX045 were used to amplify the fragments of IMX313 and this PCR product was used (29) to replace IMX313 in the parental plasmid.
  • IMX043 5 'gaagcccgacctgcaacgtggatccATACGAAMCTCTTCCTGGAGA 3' (SEQ ID NO 29)
  • IMX044 5' gaagcccgacctgcaacgtggatccACTCTGCTGGAAATACGA 3' (SEQ ID NO 30)
  • IMX045 5' agggccctctagatgcatgctcgagcggccgcttattaTTCCACCTTCAG I I I I G 3' (SEQ ID NO 31 )
  • the IMX313 coding sequence was deleted using the primers IMX037 and IMX047 and the parental plasmid as a template; the resulting PCR product was then used (29) to replace the IMX313 sequence.
  • IMX037 5' cagaatagaatgacacctactcag 3' (SEQ ID NO 32)
  • IMX047 5' GAAGCCCGACCTGCMCGTTMTAAgcggccgctcgagcatg 3' (SEQ ID NO 33)
  • IMX1030 5' GTGCCTACAGAGGACGTGAAAATGCTGCTGGAAATACGAAMCTCTTCCTGG 3' (SEQ ID NO 34)
  • mice Fives groups of BALB/c mice were immunized intramuscularly with each of the five plasmids on days 0 and 14, using 25 g per injection. The induction of antigen-specific T-cell responses were measured by ELISPOTs, using splenocytes, on day 28. Purified spleen CD4+, CD8+ and Total T cells isolated from the immunized mice were co-cultured with either recombinant 85A protein (Clinibiosciences) or the peptides p1 1 or p1 5 (26) purchased from Eurogentec.
  • ELISPOT Assays Flat-bottomed, 96-well nitrocellulose plates (Millititer; Millipore) were coated with IFN- ⁇ mAb (1 5pg/ml; MABTECH, Sweden) and incubated overnight at 4 ° C. After washing with PBS, plates were blocked with 10% fetal bovine serum for one hour at 37 °C. 2x10 6 cells per well were stimulated with relevant peptides at a final concentration of 2 pg/ml (CD8 epitope p1 1 , CD4 epitope p15 or 85A protein) on IPVH-membranes coated with 15 pg/ml anti-human IFN- ⁇ and incubated for 20 hours.
  • 2 pg/ml CD8 epitope p1 1 , CD4 epitope p15 or 85A protein
  • spleen CD4+ T, CD8+ T and Total T cells isolated from the 85A-IMX313, 85A-IR1 or 85A- TL18 or 85A-IMX313T immunized mice showed significantly higher IFNy responses compared with those of the 85A immunized mice, and confirmed the ability of IMX313 and the other modified sequences to increase T cell responses. Further, spleen CD4+, CD8+ and total T cells from the 85A-IMX313T vaccinated mice produced significantly more IFNy than those of any of the other immunized groups (p ⁇ 0.001 ) ( Figures 6, 7, 8).
  • the CD8+ T cells demonstrated a different cytokine profile compared to CD4+ T cells; the predominant cytokine producing population observed was CD8+ T cells that produced IFN- ⁇ ( Figures 7 & 8).
  • CD4+ and CD8+ antigen-specific T cells responses are enhanced when IMX313 is replaced by IMX313T.
  • T cell responses to the antigen 85A which are improved by IMX313 are further improved by the use of IMX313T instead.
  • Antibody titers to the antigen 85A were measured by ELISAs in the sera of the mice which were immunized with DNA vaccines ( Figure 9).
  • mice immunized with the 85A-IMX313 plasmid, the 85A-IMX313T plasmid and the shorter versions of IMX313 (IR14 and TL18) developed significantly higher antigen-specific total IgG titers ( Figure 9) those immunized with the plasmid expressing 85A.
  • the group immunized with 85A-IMX313T showed the highest IgG responses (p ⁇ 0.001 ). Mice immunized with 85A alone had very low levels of anti-85A IgG antibody in their sera.
  • the redirection of immune responses towards Th1 when the short positively charged peptide SPRRRRS is added was also seen when DNA is used for vaccination.
  • the IgG isotypes specific for the 85A protein in ELISAs (table 3).
  • the lgG2a isotype is associated with a Th1 and the lgG1 isotype is associated with a Th2 type immune response in BALB/c mice.
  • IMX313 or IMX 313T led to a shift toward T helper type 1 (Th1 ) associated antigen-specific IgGs, with significantly elevated levels of lgG2a and reduced levels of lgG1 compared to antigen 85A alone (table 3) and these results constitute direct evidence of a Th1 polarization; these results are consistent with the results seen with the cellular immune responses.
  • Th1 T helper type 1
  • the parent plasmid pcDNA3-NP was modified as described in the example below. 1 1.1 - Insertion of IMX313 into NP encoding plasmids
  • the IMX313 coding sequence was amplified from the plasmid plMX494 using the oligonucleotide primers IMX1289 5' caatgcagaggagtacgacaatggatccaagaagcaaggtgatgctgatg 3' (SEQ ID NO 53) and IMX1290 5' GTAGAMCMGGGTATTTTTCTTtattactccttgctcagtccttgc 3'(SEQ ID NO 54) and inserted into the plasmid pcDNA3-NP as described by Geiser (29). 1 1.2 - Insertion of the tPA signal peptide
  • the tPA signal peptide was amplified from the vector pSG2-85A (28) using the oligonucleotides IMX1305 5' cactgagtgacatcaaaatcatgGATGCAATGAAGAGAGGGC 3' (SEQ ID NO 55) and IMX1306 5' cgtaagaccgtttggtgccttggctagctcttctgaatcgggcatggatttcc 3' (SEQ ID NO 56) and inserted in-frame with the N-terminus of the NP coding sequence in a number of plasmids as described by Geiser (29).
  • the oligonucleotide primers IMX1287 5' ccattctgccgcatttgCagatctaagag 3' (SEQ ID NO 57) and IMX1288 5' CAAAAGGGAGATTTGCCTGTACTGAGMC 3' (SEQ ID NO 58) were used to amplify an internal fragment of the NP gene, and the resulting PCR product was inserted into NP-encoding plasmids as described by Geiser. Because both oligonucleotides were imperfectly matched to the NP gene, the insertion of the PCR product generated two point mutations.
  • the IMX1287 primer created the mutation E339A (GM to GCA), whereas the IMX1288 primer created the mutation R416A in the NP gene (AGA to GCA).
  • the IMX313T coding sequence was amplified from the plasmid plMX497 using the oligonucleotide primers IMX1289 (SEQ ID NO 53) and IMX051 5' GTAGAMCMGGGTATTTTTCTTtattaggagcgacggcgacgc 3' (SEQ ID NO 59) and inserted into the various pcDNA3-NP-derived plasmids as described by Geiser.
  • mice Groups of five female BALB/C mice were immunized intramuscularly twice, 14 days apart, with various plasmid DNAs, using 20 ⁇ g of each plasmid per injection. Immune responses were measured on day 28, to determine the influence of various modifications: +/- IMX313 or IMX313T; +/- the tPA signal peptide; +/- the monomerizing mutations.
  • Antigen-specific T-cell responses were measured by ELISPOTs, using splenocytes, on day 28.
  • Purified spleen CD4+, CD8+ and Total T cells isolated from the immunized mice were co-cultured with NP A Influenza peptide (amino acids 366-374) purchased from Eurogentec.
  • ELISPOT Assays Flat-bottomed, 96-well nitrocellulose plates (Millititer; Millipore) were coated with IFN- ⁇ mAb (15pg/ml; MABTECH, Sweden) and incubated overnight at 4 °C. After washing with PBS, plates were blocked with 10% fetal bovine serum for one hour at 37 °C. 2x10 6 cells per well were stimulated with relevant peptides at a final concentration of 2 g/ml (NP A Influenza peptide) on IPVH-membranes coated with 15 ⁇ g/ml anti-human IFN- ⁇ and incubated for 20 hours.
  • antigens were diluted to a concentration of 5 mg/ml in 0.1 M sodium carbonate/bicarbonate (pH 9.6) and were then used to coat the wells of MaxiSorb plates (Nunc- Immulon, Denmark). Twofold serial dilutions of the test sera were added to the wells, and following washing, bound antibodies were detected with anti-mouse IgG, or anti-mouse lgG1 or anti-mouse lgG2a (Sigma) conjugated to horseradish peroxidase. Absorbance at 490 nm was determined after o-phenylenediamine (Sigma) and H2O2 were added; the reactions were stopped with 1 M Sulphuric acid.
  • Figure 11 shows that fusing the parental NP antigen gene to the IMX313 gene improves T cell responses to NP.
  • Figure 12 shows that fusing the NP antigen gene to the IMX313 gene improves both CD4+ and CD8+ responses to the NP antigen.
  • NP-specific IgG Ab responses were measured in sera.
  • NP control mice and mice given NP-IMX313 showed moderate NP-specific IgG Abs (Fig. 13), which were higher in the group immunized with NP-IMX313.
  • Figure 13 shows that fusing the NP gene to the IMX313 gene improves IgG antibody responses to the NP antigen.
  • Sera were also examined for the presence of NP-specific lgG1 and lgG2a antibodies (representative of Th2 and Th1 types of response in Balb/C mice, respectively).
  • NP-specific lgG1 and lgG2a antibody isotypes were detected in the sera of the NP-IMX313 immunized mice; however serum samples from mice given NP alone showed only low levels of lgG1 and lgG2a Ab (Fig. 14).
  • Figure 14 shows the subclass distributions of the antibodies induced against the NP antigen. Fusion to the IMX313 gene improved the lgG2A response more than the lgG1 response, converting a Th2-biased response against NP to a Th1 -biased response against NP-IMX313.
  • a synthetic gene encoding the protein NP-M-IMX313T was synthesized with codons optimized for expression in Escherichia coli. This synthetic gene was cloned into a T7-based expression vector plMX04 (this is the vector pRsetC from Invitrogen in which the f1 origin has been replaced by the par locus of the plasmid pSC101 ). Expression was induced in several standard media (LB, Studier's Auto-Induction medium) and the overexpressed protein was purified initially as described by Ye (30) and by Tarus (31 ) for the clarification and ion-exchange steps, but in a final step the fusion protein was purified by affinity on Heparin Sepharose, as described above.
  • LB Studier's Auto-Induction medium
  • the recombinant protein NP-M-IMX313T is used for immunizations as follows:
  • mice Groups of five female BALB/C mice are immunized intramuscularly twice, 14 days apart, with various protein preparations (with or without formulation with TLR ligands), using 2 nanomoles of protein per injection. Immune responses are measured on day 28, to determine antigen- specific T-cell responses, (measured by ELISPOTs), using splenocytes. Pre-immune and day 28 antibody responses were measured by ELISAs with NP as antigen.
  • Figure 15 shows that monomerisation of NP improves its immunogenicity slightly, that this is further improved by fusion to the IMX313 gene, but that the largest improvement is obtained by fusing the monomeric NP to the IMX313T gene.
  • Figure 16 shows that, on analysis of the CD4+ and CD8+ responses, the same rank ordering as in Figure 6 is seen: monomerisation of NP improves NPs immunogenicity slightly; this is further improved by fusion to the IMX313 gene, but that the largest improvement is obtained by fusing the monomeric NP to the IMX313T gene.
  • Figure 17 shows that the same rank ordering is seen for B cell responses as was seen for T cell responses (both CD4+ and CD8+) in Figures 6 and 7.
  • Total IgG responses against NP were higher with IMX313T than with IMX313.
  • Figure 18 shows the subclass distributions of the antibodies induced against the monomeric NP antigen.
  • fusion to the IMX313 gene augmented the lgG2A response more than the lgG1 response, converting a Th2-biased response against NP to a Th1 -biased response against NP- IMX313.
  • this reversal of a Th2 to a Th1 bias was amplified by fusion to IMX313T rather than to IMX313.
  • Expression of lgG2a antibodies in the influenza vaccines is a correlated with clearance of virus and increased protection against lethal influenza challenge. Increased induction of both antibody isotypes as measured by ELISA was a better correlate for vaccine efficacy than neutralization alone (32).
  • NP DNA vaccine constructs containing the tissue plasminogen activator (tPA) secretory signal sequence was made: tPA-NP, tPA-NP-M, tPA-NP-M-IMX313, and tPA-NP-M-IMX313T.
  • tPA-NP tissue plasminogen activator
  • mice immunized with tPA containing constructs showed significantly higher IFNy responses compared with those of the NP immunized mice and confirmed the ability of IMX313T and the monomerizing mutations to increase T cell responses.
  • Figure 19 shows that forcing the secretion of the NP antigen improved its immunogenicity (NP versus tPA-NP), whether it was monomeric or not (tPA-NP versus tPA-NP-M).
  • fusion to IMX313 showed that use of a monomeric version of NP was more immunogenic than use of the unmodified antigen (tPA-NP-IMX313 versus tPA-NP-M-IMX313).
  • substitution of IMX313 by IMX313T further improved the immunogenicity of NP (tPA-NP-M-IMX313 versis tPA-NP-M-IMX313T).
  • Figure 20 shows the CD8+ and CD4+ responses to the different secreted versions of NP.
  • Figure 21 shows the total IgG responses to the antigen NP and invites the same conclusions as Figure 20 for T cell responses: the largest responses are seen when IMX313T is used, but secretion (NP versus tPA-NP) and monomerisation (tPA-NP-IMX313 versus tPA-NP-M-IMX313) are also important contributions.
  • mice immunized with NP alone had no or very low levels of anti-NP IgG antibody in their sera (Figure 21 ) Mice immunized with NP-M-IMX313, tPA-NP-M-IMX313, NP-M-IMX313T or tPA-NP-M- IMX313T on the other hand, showed high levels of systemic NP-specific IgG antibody responses; however, the tPA-NP-M-IMX313T immunized mice had significantly higher (p ⁇ 0.001 ) IgG antibody responses compared to all the groups of immunized mice.
  • FIG. 22 shows the subclass analysis of the B cell responses to NP, and illustrates that the initial Th2 bias with NP alone is reversed by IMX313 and by IMX313T.
  • Th1 response LgG2a
  • the supernatants of the transfected cells was recovered by centrifugation, and filtered before being loaded onto a Heparin Sepharose column, as described above.
  • two plasmids were constructed using a synthetic HA2 gene encoding the trimeric coiled coil of the influenza hemagglutinin.
  • the first plasmid was plMX743, in which the HA2 coiled coil was modified by the fusion of a peptide: SPRRRRRRRRRS (SEQ ID NO 37)
  • control plasmid plMX744 was created by deleting the peptide using the oligonucleotide primers
  • IMX203 5' GTTAG C AG CCG G ATC AAG CTTATTAG G C ATTGTTCTTCAG CTG G C 3' (SEQ ID NO 62) and T7F to amplify the HA2 insert which was then reinserted into the parental plasmid.
  • the nucleotide sequence was:
  • Both proteins were then purified first on an IMAC affinity column, and then on a heparin Sepharose column.
  • the IMX743 protein eluted at a higher salt (NaCl) concentration than the IMX744 protein: the IMX743 protein eluted at a salt concentration of 1 .4 M (sic) whereas the IMX744 protein eluted at a salt concentration of 600 mM.
  • Both proteins were then used to immunize four groups of 5-6 week old female BALB/c mice, on days 0 and 14, with 20 g per injection. Sera and spleens were collected for ELISAs and ELISPOTs on day 21 . Two groups received the protein in the adjuvant Addavax, while the other two groups were immunized without an adjuvant.
  • the protein IMX744 was used as the ELISA antigen, and also to stimulate the splenic cells.
  • the coiled coil of the fusion protein DsbA-IMX108 was modified to determine whether it too acquired improved properties conferred on IMX313.
  • the DsbA-IMX108 gene was amplified with the oligonucleotide IMX212: 5' GGAGCGACGGCGACGCGGAGActggagctgtagtagttcaacctcc 3' (SEQ ID NO 65) and T7F, and inserted (29) into the plasmid expressing IMX313T, in place of IMX313.
  • the protein was purified by ion- exchange chromatography, and then on a heparin-Sepharose column, to which it bound, whereas the parental construct DsbA-IMX108 did not.
  • the parental IMX108 sequence (SEQ ID NO 66) is aligned here to the IMX108T sequence (SEQ ID NO 67);
  • IMX108 EASEDLKPALTGNKTMQYVPNSHDVKMALEIYKLTLEVELLQLQIQKEKHTEAH*
  • IMX108T EASEDLKPALTGNKTMQYVPNSHDVKMALEIYKLTLEVELLQLQSPRRRRS*
  • modified IMX108 protein is useful for immunizing poultry, where potential auto-immune effects of using modified IMX313 fusion proteins should be avoided (16).
  • Other mammalian C4bp oligomerisation domains listed in reference 16, and WO 2007/062819 can also be modified as described herein for this purpose.
  • Fusion proteins comprising the N-terminus of Staphylococcal hemolysin alpha and modified IMX313 proteins
  • the truncated hemolysin gene was amplified from genomic DNA of the Newman strain and cloned into a T7 expression vector.
  • the oligonucleotides used were:
  • IMX056 5' GTTTAACTTTAAGAAGGAGATATAcatatggcagattctgatattaatattaaaaccgg 3' (SEQ ID NO 68) and
  • IMX057 5' GTTAGCAGCCGGATCAAGCTTATTAatcgattttatatctttctgaagaacgatctgtc 3' (SEQ ID NO 69).
  • IMX313T was amplified with the primers:
  • IMX110 5' AGAACGAAAGGTACCATTGCTGGATCCAAGAAGCAAGGTGATGCT 3' (SEQ ID NO 70) and IMX139: 5' GGGCGATCGGTGCGGGCCTCTTCGC 3' (SEQ ID NO 44) from the IMX313T expression plasmid and the PCR product was used to truncate further the Hla toxin gene, while fusing amino acid 63 to the modified IMX313 gene.
  • the resulting plasmid expresses the fusion protein, called Hla63-IMX313T, which has the following protein sequence:
  • ATG G C AG ATTCTG ATATTAATATTAAMCCG GTACTAC AG ATATTG G MG C MTACTAC AGTAAAAAC AG GT GATTTAGTCACTTATGATAMGAA TGGCATGCACAAAA GTATTTTATAGTTTTATCGATGATAAAAATC ATAATAAAAAACTG CTAGTTATTAG AACG AAAG GTACC ATTG CTG G ATCC AAG AAG C AAG GTG ATG CTG ATGTGCGGAGAGGTTGCTTATATTCAGAGCGTCGTCTCCGATTGCCACGTGCCTACAGCGGAACTGCGTACT CTGCTGGAAATACGAAAACTCTTCCTGGAGATTCAAAAACTGAAGGTGGAACTGCAGTCCGCGTCGCCG TCGCTCCTAA (SEQ ID NO 72).
  • the partially purified protein was dialyzed against the buffer 50 mM Tris pH 7.5, 150 mM NaCl, and loaded onto a Heparin Sepharose column, from which it was eluted with an NaCl gradient (50 mM Tris pH 7.5, 1 M NaCl).
  • the eluted protein was dialyzed against PBS and further purified by gel filtration.
  • N-terminal fragment (lacking IMX313T) was modified by cloning a C-terminal 6 His tag, and purified by IMAC Nickel affinity chromatography and gel filtration.
  • mice Four groups of five female BALB/c mice aged 5-6 weeks were immunised with 5 mmoles of either the Hla63 protein or the same antigen fused to IMX313T on days 0 & 14. On day 28, sera and spleens were collected for ELISAs and ELISPOTs. The protein 63 Hla 6 His was used as the ELISA antigen, and also to stimulate the splenic cells.
  • HLA-IMX313T ISA 51 600 128 The results clearly show that the N-terminus of hemolysin alpha (HLA) is more immunogenic when fused to the IMX313T protein, whether an adjuvant is used or not. 15. Full length Staphylococcal Protein A fused to modified IMX313 proteins
  • IMX313T and IMX313P could improve the immunogenicity of the full-length Staphylococcal protein A antigen (SpA).
  • SpA Staphylococcal protein A antigen
  • the BamH l-Hind III fragment encoding the C-terminal His tag was replaced by BamH l-Hind III fragments encoding the 313 proteins.
  • Proteins were purified as follows: SpA-6His was produced in the bacterial strain BLR, and the bacterial pellet was lysed in buffer A (1 xPBS, 1M NaCl, 20mM Imidazole, 1 mM PMSF), the bacterial lysate was heated to 75° C for 15 minutes, and then clarified by centrifugation before being loaded on an IMAC Nickel affinity column.
  • the protein was eluted with a gradient of Imidazole in buffer B (1 xPBS, 500mM Imidazole). The protein was further purified by gel filtration. SpA-IMX313T and SpA-IMX313P were also expressed in the strain BLR, and the bacterial lysates were heated to 75°C for 15 minutes, and clarified by centrifugation. Both proteins were then purified on an SP ion exchange column, and then on a heparin Sepharose column.
  • the N2N3 domains was amplified with the following oligos:
  • IMX239 5' C ATC ATC ATC ATC ATC ATCACggtG CTG AACCG GTAGTAAATG CTG CTG ATG CTAAAG G 3' (SEQ ID NO 75) and
  • IMX240 5' ccccaaggggttatgctagttaATTTACTGCTGAATCACCATCagcacttccaccacc 3' (SEQ ID NO 76) and the PCR product was cloned into a T7 expression vector with an N-terminal His tag (27).
  • the nucleotide sequence of the N2N3 fragment is:
  • IMX248 5' gctgatggtgattcagcagtaaatggatccaagaagcaaggtgatgctgatg 3' (SEQ ID NO 79) and IMX139 and cloned C-terminal to the N3 domain.
  • the unmodified N2N3 domains, and the fusion proteins N2N3-IMX313T and IMX313P are expressed as follows:
  • 500 ml cultures of the strain C43(DE3) were induced with 1 mM IPTG and after overnight induction, the bacterial pellets was lysed in buffer A (1xPBS, 1M NaCl, 20mM Imidazole, 1 mM PMSF), and then clarified by centrifugation before being loaded on an IMAC Nickel affinity column.
  • the protein was eluted with a gradient of Imidazole in buffer B (1xPBS, 500mM Imidazole).
  • the fusion proteins are further purified by affinity chromatography on Heparin- Sepharose, followed by Sephacryl S-300 HR gel filtration, while the unfused protein is further purified by gel filtration on an S-75 gel filtration column.
  • sortase A Staphylococcal protease known as sortase A, or SrtA
  • an inactivated version was cloned in frame to IMX313, IMX313T and IMX313P as follows: the wild type sortase A gene was amplified from Newman strain genomic DNA with the oligonucleotides
  • IMX1275 5' GTTAG C AG CCG G ATC AAG CTTATTATTTG ACTTCTGTAG CTAC AA 3' (SEQ ID NO 81 ) and cloned into a T7 expression vector.
  • the active site cysteine residue was then mutated to serine with the oligonucleotide IMX215: 5'
  • IMX313, 313T and 313P genes were then amplified with the oligonucleotides IMX006: 5' TTGTAG CTAC AG AAGTC AAAAAG AAG C AAG GTG ATG CTG ATG 3' (SEQ ID NO 83) and IMX139: 5' GGGCGATCGGTGCGGGCCTCTTCGC 3' (SEQ ID NO 44) from their respective expression vectors, and inserted in-frame with the inactivated protease gene (29).
  • IMX313T and IMX313P fusion proteins were purified by ion-exchange on an SP column, and then on a Heparin Sepharose column. 18. CP15 DNA IMMUNIZATION
  • IMX313 proteins could further improve the immunogenicity of the cryptosporidial antigen CP15, beyond the improvement obtained by using IMX313 itself
  • three plasmids designed to express Cp15, Cp15-IMX313 and IMX313T in Escherichia coli were used to prepare pcDNA3 vectors as DNA vaccines.
  • the primers used to amplify the three genes from the T7 expression vectors for insertion into pcDNA3 downstream of the tPA signal peptide were:
  • IMX092 5' ggaaatccatgcccgattcagaaga GCGCGTGTTCTGATCAAAGAGAAGC 3' (SEQ ID NO 84) and
  • IMX093 5' gccagtgtgatggatggcggtagttattgctcagcggtgg 3' (SEQ ID NO 85).
  • the three PCR products were inserted separately into a pcDNA3 vector, which contained an N- terminal tPA signal peptide.
  • the pcDNA3 vector with no insert was used as a control plasmid. These four plasmids were used to immunize four groups of 5-6 week old Balb/c female mice on days 0 & 14. Twenty-five micrograms of each plasmid was injected intramuscularly for each immunisation. On day 28, sera and spleens were collected for ELISAs and ELISPOTs. The Cp1 5-6His protein, purified from Escherichia coli was used as the ELISA antigen, and also to stimulate the splenic cells.
  • the protein coding sequence was:
  • the following proteins were formulated: PAm, PAm-IMX313 and PAm-IMX313T (prepared as described in Example 6 above), as indicated in the column "Adjuvant" in the table below.
  • the formulated proteins were then used to immunize seven groups of 5-6 week old Balb/c female mice on days 0 & 14. 5 mmoles of each protein was used per immunisation, with or without the adjuvant AddaVax, and with or without the TLR ligand poly l:C. In the seventh group, the TLR ligand poly l:C was first formulated with the protein PAm-IMX313T, and then with the adjuvant AddaVax.
  • HA2 hemagglutinin
  • C4-binding protein acts as an adjuvant, and the fusion protein comprised of the 19-kilodalton merozoite surface protein 1 fused with the murine C4bp domain protects mice against malaria.
  • C4bp C4-binding protein

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Organic Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Immunology (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Epidemiology (AREA)
  • Virology (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Communicable Diseases (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Zoology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Pulmonology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Reproductive Health (AREA)
  • Wood Science & Technology (AREA)
  • Toxicology (AREA)
  • Oncology (AREA)
  • General Engineering & Computer Science (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
PCT/EP2013/076289 2012-12-11 2013-12-11 Modified coiled coil type proteins having improved properties Ceased WO2014090905A1 (en)

Priority Applications (13)

Application Number Priority Date Filing Date Title
ES13802415T ES2719256T3 (es) 2012-12-11 2013-12-11 Proteínas de tipo superhélice modificadas que presentan unas propiedades mejoradas
BR112015013387A BR112015013387B8 (pt) 2012-12-11 2013-12-11 Proteínas tipo coiled-coil modificadas possuindo propriedades melhoradas
JP2015547006A JP6518193B2 (ja) 2012-12-11 2013-12-11 改善された特性を有する改変コイルドコイル型タンパク質
PL13802415T PL2931896T3 (pl) 2012-12-11 2013-12-11 Zmodyfikowane białka typu superhelisy mające ulepszone właściwości
KR1020157018233A KR102237130B1 (ko) 2012-12-11 2013-12-11 향상된 특성을 갖는 변형된 코일드 코일 유형 단백질
MX2015007421A MX363443B (es) 2012-12-11 2013-12-11 Proteinas de tipo espiral enrollada modificadas que tienen propiedades mejoradas.
CA2893120A CA2893120C (en) 2012-12-11 2013-12-11 Modified coiled coil type proteins having improved properties
DK13802415.3T DK2931896T3 (en) 2012-12-11 2013-12-11 MODIFIED COILED COIL TYPE WITH IMPROVED PROPERTIES
CN201380072637.5A CN104981541B (zh) 2012-12-11 2013-12-11 具有改进特性的经修饰的卷曲螺旋型蛋白
AU2013357367A AU2013357367B2 (en) 2012-12-11 2013-12-11 Modified coiled coil type proteins having improved properties
EP13802415.3A EP2931896B1 (en) 2012-12-11 2013-12-11 Modified coiled coil type proteins having improved properties
RU2015126105A RU2677799C2 (ru) 2012-12-11 2013-12-11 Модифицированные суперспиральные белки с улучшенными свойствами
US14/570,133 US9388225B2 (en) 2012-12-11 2014-12-15 Modified coiled coil type proteins having improved properties

Applications Claiming Priority (5)

Application Number Priority Date Filing Date Title
EP12306560 2012-12-11
EP12306560.9 2012-12-11
US201361802836P 2013-03-18 2013-03-18
US61/802,836 2013-03-18
US06/802,836 2013-03-18

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US14/570,133 Continuation US9388225B2 (en) 2012-12-11 2014-12-15 Modified coiled coil type proteins having improved properties

Publications (2)

Publication Number Publication Date
WO2014090905A1 true WO2014090905A1 (en) 2014-06-19
WO2014090905A8 WO2014090905A8 (en) 2014-08-21

Family

ID=47458800

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2013/076289 Ceased WO2014090905A1 (en) 2012-12-11 2013-12-11 Modified coiled coil type proteins having improved properties

Country Status (12)

Country Link
US (1) US9388225B2 (cg-RX-API-DMAC7.html)
EP (1) EP2931896B1 (cg-RX-API-DMAC7.html)
JP (1) JP6518193B2 (cg-RX-API-DMAC7.html)
KR (1) KR102237130B1 (cg-RX-API-DMAC7.html)
CN (1) CN104981541B (cg-RX-API-DMAC7.html)
AU (1) AU2013357367B2 (cg-RX-API-DMAC7.html)
BR (1) BR112015013387B8 (cg-RX-API-DMAC7.html)
CA (1) CA2893120C (cg-RX-API-DMAC7.html)
MX (1) MX363443B (cg-RX-API-DMAC7.html)
PL (1) PL2931896T3 (cg-RX-API-DMAC7.html)
RU (1) RU2677799C2 (cg-RX-API-DMAC7.html)
WO (1) WO2014090905A1 (cg-RX-API-DMAC7.html)

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20150098958A1 (en) * 2013-03-18 2015-04-09 Imaxio Influenza Nucleoprotein Vaccines
EP3134104A4 (en) * 2014-04-25 2017-04-12 Tria Bioscience Corp. Synthetic hapten carrier compositions and methods
WO2023025864A1 (en) 2021-08-24 2023-03-02 Osivax Immunogenic compositions and their use
WO2023117742A1 (en) 2021-12-22 2023-06-29 Osivax Vaccine compositions and their use
WO2023180394A1 (en) 2022-03-22 2023-09-28 Osivax Mrna vaccine compositions and their use

Families Citing this family (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10738338B2 (en) 2016-10-18 2020-08-11 The Research Foundation for the State University Method and composition for biocatalytic protein-oligonucleotide conjugation and protein-oligonucleotide conjugate
RU2732013C1 (ru) * 2019-12-11 2020-09-10 Федеральное бюджетное учреждение науки "Государственный научный центр прикладной микробиологии и биотехнологии" Федеральной службы по надзору в сфере защиты прав потребителей и благополучия человека (ФБУН ГНЦ ПМБ) Способ сенсибилизации планшета для иммуноферментного анализа нерастворимыми белковыми антигенами
KR102613348B1 (ko) * 2020-01-07 2023-12-13 에이치케이이노엔 주식회사 알부민 및 코일드코일 형성 도메인이 연결된 융합단백질, 및 이를 이용한 이중 표적 결합체
CN115322247B (zh) * 2021-05-11 2025-07-15 中国人民解放军军事科学院军事医学研究院 一种新型冠状病毒受体结合区电荷突变体抗原及应用
NL2031833B1 (en) 2022-05-11 2023-11-17 Univ Leiden Immunotherapeutic compositions and adjuvants
WO2024067182A1 (zh) * 2022-10-01 2024-04-04 中国人民解放军军事科学院军事医学研究院 一种可增强与佐剂协同免疫效力的电荷调控型抗原蛋白

Citations (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1999012036A1 (en) * 1997-09-04 1999-03-11 Stanford University Reversible immobilization of arginine-tagged moieties on a silicate surface
WO2005077976A2 (en) 2004-02-13 2005-08-25 Avidis Sa Coiled-coil domains from c4b-binding protein
WO2007062819A2 (en) 2005-11-30 2007-06-07 Imaxio Multimeric complexes of antigens and an adjuvant
WO2007100908A2 (en) 2006-02-28 2007-09-07 Vaxart, Inc Chimeric adenoviral vectors
EP1953550A1 (en) * 2005-11-10 2008-08-06 National University of Corporation Hiroshima University Method and agent for immobilizing protein via protein bound to silicon oxide containing-substance
WO2008122817A2 (en) 2007-04-10 2008-10-16 Isis Innovation Immunogenic compositions
WO2011045612A1 (en) 2009-10-16 2011-04-21 Isis Innovation Limited Mycobacterial vaccines

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE60122300T2 (de) * 2000-04-07 2007-08-30 The University Of Leeds Hepatitis b kernprotein fusionsproteine
US7270921B2 (en) * 2002-02-08 2007-09-18 Kabushiki Kaisha Toshiba Pattern writing and forming method
EP1590440A4 (en) * 2003-02-03 2009-03-18 Palo Alto Inst Of Molecular Me CELL-KILLING MOLECULES AND METHODS FOR THEIR USE
ES2505695T3 (es) * 2003-07-31 2014-10-10 Novartis Vaccines And Diagnostics, Inc. Composiciones inmunógenas para Streptococcus pyogenes
EP2060586A1 (en) * 2007-11-14 2009-05-20 PharmaSurgics in Sweden AB New synthetic arginine substituted peptides and their use
CN105143251B (zh) * 2013-03-18 2021-05-11 奥西瓦科斯公司 流感核蛋白疫苗

Patent Citations (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1999012036A1 (en) * 1997-09-04 1999-03-11 Stanford University Reversible immobilization of arginine-tagged moieties on a silicate surface
WO2005077976A2 (en) 2004-02-13 2005-08-25 Avidis Sa Coiled-coil domains from c4b-binding protein
EP1953550A1 (en) * 2005-11-10 2008-08-06 National University of Corporation Hiroshima University Method and agent for immobilizing protein via protein bound to silicon oxide containing-substance
WO2007062819A2 (en) 2005-11-30 2007-06-07 Imaxio Multimeric complexes of antigens and an adjuvant
WO2007100908A2 (en) 2006-02-28 2007-09-07 Vaxart, Inc Chimeric adenoviral vectors
WO2008122817A2 (en) 2007-04-10 2008-10-16 Isis Innovation Immunogenic compositions
WO2011045612A1 (en) 2009-10-16 2011-04-21 Isis Innovation Limited Mycobacterial vaccines

Non-Patent Citations (52)

* Cited by examiner, † Cited by third party
Title
AKIRA S; UEMATSU S; TAKEUCHI 0: "Pathogen recognition and innate immunity", CELL, vol. 124, 2006, pages 783 - 801, XP003018351, DOI: doi:10.1016/j.cell.2006.02.015
ALEXANDRA J. SPENCER ET AL: "Fusion of the Mycobacterium tuberculosis Antigen 85A to an Oligomerization Domain Enhances Its Immunogenicity in Both Mice and Non-Human Primates", PLOS ONE, vol. 7, no. 3, 28 March 2012 (2012-03-28), pages e33555, XP055061807, DOI: 10.1371/journal.pone.0033555 *
ARNAU J; LAURITZEN C; PETERSEN GE; PEDERSEN J.: "Current strategies for the use of affinity tags and tag removal for the purification of recombinant proteins", PROTEIN EXPR PURIF., vol. 48, 2006, pages 1 - 13, XP024908794, DOI: doi:10.1016/j.pep.2005.12.002
BIRNBAUM F; NASSAL M: "Hepatitis B virus nucleocapsid assembly: primary structure requirements in the core protein", J VIROL., vol. 64, 1990, pages 3319 - 3330, XP002378507
BLASIUS AL; BEUTLER B: "Intracellular Toll-like Receptors", IMMUNITY, vol. 32, 2010, pages 305 - 315
BOMMAKANTI G; CITRON MP; HEPLER RW; CALLAHAN C; HEIDECKER GJ; NAJAR TA; LU X; JOYCE JG; SHIVER JW; CASIMIRO DR: "Design of an HA2-based Escherichia coli expressed influenza immunogen that protects mice from pathogenic challenge", PROC NATL ACAD SCI U S A., vol. 107, 2010, pages 13701 - 13706
BOMMAKANTI G; LU X; CITRON MP; NAJAR TA; HEIDECKER GJ; TER MEULEN J; VARADARAJAN R; LIANG X: "Design of Escherichia coli-expressed stalk domain immunogens of H 1 N 1 hemagglutinin that protect mice from lethal challenge", J VIROL., vol. 86, 2012, pages 13434 - 13444, XP055100077, DOI: doi:10.1128/JVI.01429-12
BURKHARD P; STETEFELD J; STRELKOV SV: "Coiled coils: a highly versatile protein folding motif", TRENDS CELL BIOL., vol. 11, 2001, pages 82 - 88, XP002255516, DOI: doi:10.1016/S0962-8924(00)01898-5
CHAMBERS RS; JOHNSTON SA: "High-level generation of polyclonal antibodies by genetic immunization", NAT BIOTECHNOL., vol. 21, 2003, pages 1088 - 1092, XP002382543, DOI: doi:10.1038/nbt858
CHEN J; WHARTON SA; WEISSENHORN W; CALDER LJ; HUGHSON FM; SKEHEL JJ; WILEY DC: "A soluble domain of the membrane-anchoring chain of influenza virus hemagglutinin (HA2) folds in Escherichia coli into the low-pH-induced conformation", PROC NATL ACAD SCI U S A., vol. 92, 1995, pages 12205 - 12209
CHEN YH; CHRISTIANSEN A; BOCK G; DIERICH MP: "HIV-2 transmembrane protein gp36 like HIV-1 gp41 binds to human lymphocytes and monocytes", AIDS, vol. 9, 1995, pages 1193 - 1194
CHUDASAMA SL; ESPINASSE B; HWANG F; QI R; JOGLEKAR M; AFONINA G; WIESNER MR; WELSBY IJ; ORTEL TL; AREPALLY GM: "Heparin modifies the immunogenicity of positively charged proteins", BLOOD, vol. 116, 2010, pages 6046 - 6053
COTTER SE; SURANA NK: "St. Geme III JW. 2005. Trimeric autotransporters: a distinct subfamily of autotransporter proteins", TRENDS MICROBIOL., vol. 13, pages 199 - 205
DATABASE UniProt [Online] 1 December 2001 (2001-12-01), "RecName: Full=Serine/Arginine-related protein 53; Short=SRrp53; AltName: Full=Arginine/serine-rich coiled-coil protein 1;", XP002696762, retrieved from EBI accession no. UNIPROT:Q96IZ7 Database accession no. Q96IZ7 *
EL TAHIR Y; SKURNIK M: "YadA, the multifaceted Yersinia adhesin", INT. J. MED. MICROBIOL., vol. 291, 2001, pages 209 - 218, XP004959893, DOI: doi:10.1078/1438-4221-00119
EMILY K. FORBES ET AL: "T Cell Responses Induced by Adenoviral Vectored Vaccines Can Be Adjuvanted by Fusion of Antigen to the Oligomerization Domain of C4b-Binding Protein", PLOS ONE, vol. 7, no. 9, 12 September 2012 (2012-09-12), pages e44943, XP055061808, DOI: 10.1371/journal.pone.0044943 *
EWALD SE; LEE BL; LAU L; WICKLIFFE KE; SHI GP; CHAPMAN HA; BARTON GM: "The ectodomain of Toll-like receptor 9 is cleaved to generate a functional receptor", NATURE, vol. 456, 2008, pages 658 - 662
FROMM JR; HILEMAN RE; CALDWELL EE; WEILER JM; LINHARDT RJ: "Differences in the interaction of heparin with arginine and lysine and the importance of these basic amino acids in the binding of heparin to acidic fibroblast growth factor", ARCH BIOCHEM BIOPHYS., vol. 323, 1995, pages 279 - 287, XP000891918, DOI: doi:10.1006/abbi.1995.9963
FUCHS SM; RAINES RT: "Polyarginine as a multifunctional fusion tag", PROTEIN SCIENCE, vol. 14, 2005, pages 1538 - 1544, XP002428590, DOI: doi:10.1110/ps.051393805
GEISER M; CEBE R; DREWELLO D; SCHMITZ R: "Integration of PCR fragments at any specific site within cloning vectors without the use of restriction enzymes and DNA ligase", BIOTECHNIQUES, vol. 31, 2001, pages 88 - 92, XP001019204
HUBER VC; MCKEON RM; BRACKIN MN; MILLER L; KEATING R; BROWN SA; MAKAROVA N; PEREZ DR; MACDONALD GH; MCCULLERS JA: "Distinct Contributions of Vaccine-Induced Immunoglobulin G1 (IgG1) and IgG2a Antibodies to Protective Immunity against Influenza", CLINICAL AND VACCINE IMMUNOLOGY, vol. 13, 2006, pages 981 - 990, XP002631035, DOI: doi:10.1128/CVI.00156-06
KIM HK; CHENG AG; KIM HY; MISSIAKAS DM; SCHNEEWIND 0: "Nontoxigenic protein A vaccine for methicillin-resistant Staphylococcus aureus infections in mice", J EXP MED., vol. 207, 2010, pages 1863 - 1870, XP002737099, DOI: doi:10.1084/jem.20092514
KRAMMER F; PONTILLER J; TAUER C; PALMBERGER D; MACCANI A; BAUMANN M; GRABHERR R: "Evaluation of the influenza A replicon for transient expression of recombinant proteins in mammalian cells", PLOS ONE, vol. 5, 2010, pages E13265
LEE JE; FUSCO ML; HESSELL AJ; OSWALD WB; BURTON DR; SAPHIRE EO: "Structure of the Ebola virus glycoprotein bound to an antibody from a human survivor", NATURE, vol. 454, 2008, pages 177 - 182, XP055066642, DOI: doi:10.1038/nature07082
MENDLOWSKI B; FIELD AK; TYTELL AA; HILLEMAN MR: "Safety assessment of poly I:C in NZB/NZW mice", PROC SOC EXP BIOL MED., vol. 148, 1975, pages 476 - 483, XP000764985
MITSUI H; INOZUME T; KITAMURA R; SHIBAGAKI N; SHIMADA S: "Polyarginine-mediated protein delivery to dendritic cells presents antigen more efficiently onto MHC class I and class II and elicits superior antitumor immunity", J INVEST DERMATOL., vol. 126, 2006, pages 1804 - 1812
MITSUI H; OKAMOTO T; KANZAKI M; INOZUME T; SHIBAGAKI N; SHIMADA S: "Intradermal injections of polyarginine-containing immunogenic antigens preferentially elicit Tc1 and Th activation and antitumour immunity", BRJ DERMATOL., vol. 162, 2010, pages 29 - 41, XP055312694, DOI: doi:10.1111/j.1365-2133.2009.09490.x
MULCAHY ME; GEOGHEGAN JA; MONK IR; O'KEEFFE KM; WALSH EJ; FOSTER TJ; MCLOUGHLIN RM: "Nasal colonisation by Staphylococcus aureus depends upon clumping factor B binding to the squamous epithelial cell envelope protein loricrin", PLOS PATHOG., vol. 8, no. 12, 2012, pages E1003092
ODGREN PR; HARVIE LW JR; FEY EG: "Phylogenetic occurrence of coiled coil proteins: implications for tissue structure in metazoan via coiled coil tissue matrix", PROTEINS, vol. 24, 1996, pages 467 - 484
OGUN SA; DUMON-SEIGNOVERT L; MARCHAND JB; HOLDER AA; HILL F: "The oligomerization domain of C4-binding protein (C4bp) acts as an adjuvant, and the fusion protein comprised of the 19-kilodalton merozoite surface protein 1 fused with the murine C4bp domain protects mice against malaria", INFECT IMMUN., vol. 76, 2008, pages 2817 - 3823
O'SEAGHDHA M; VAN SCHOOTEN CJ; KERRIGAN SW; EMSLEY J; SILVERMAN GJ; COX D; LENTING PJ; FOSTER TJ: "Staphylococcus aureus protein A binding to von Willebrand factor A1 domain is mediated by conserved IgG binding regions", FEBS J., vol. 273, 2006, pages 4831 - 4841, XP008152781, DOI: doi:10.1111/j.1742-4658.2006.05482.x
PARRY DA; FRASER RD; SQUIRE JM: "Fifty years of coiled-coils and alpha-helical bundles: a close relationship between sequence and structure", J STRUCT BIOL., vol. 163, 2008, pages 258 - 269, XP025410595, DOI: doi:10.1016/j.jsb.2008.01.016
ROSE A; SCHRAEGLE SJ; STAHLBERG EA; MEIER I: "Coiled-coil protein composition of 22 proteomes--differences and common themes in subcellular infrastructure and traffic control", BMC EVOL BIOL., vol. 5, 2005, pages 66, XP021001547, DOI: doi:10.1186/1471-2148-5-66
SASSENFELD HM; BREWER SJ: "A polypeptide fusion designed for the purification of recombinant proteins", BIOTECHNOLOGY, vol. 2, 1984, pages 76 - 81, XP008020827, DOI: doi:10.1038/nbt0184-76
SERRUTO D; SPADAFINA T; SCARSELLI M; BAMBINI S; COMANDUCCI M; HÖHLE S; KILIAN M; VEIGA E; COSSART P; OGGIONI MR: "HadA is an atypical new multifunctional trimeric coiled-coil adhesin of Haemophilus influenzae biogroup aegyptius, which promotes entry into host cells", CELL MICROBIOL., vol. 11, 2009, pages 1044 - 1063
SHIBAGAKI N; OKAMOTO T; MITSUI H; INOZUME T; KANZAKI M; SHIMADA S: "Novel immunotherapeutic approaches to skin cancer treatments using protein transduction technology", J DERMATOL SCI., vol. 61, 2010, pages 153 - 161, XP028145237, DOI: doi:10.1016/j.jdermsci.2010.12.003
SHIBAGAKI N; UDEY MC: "Dendritic cells transduced with protein antigens induce cytotoxic lymphocytes and elicit antitumor immunity", J /MMUNO/., vol. 168, 2002, pages 2393 - 2401, XP003009075
SMITH J C ET AL: "Chemical synthesis and cloning of a poly(arginine)-coding gene fragment designed to aid polypeptide purification", GENE, ELSEVIER, AMSTERDAM, NL, vol. 32, no. 3, 1 December 1984 (1984-12-01), pages 321 - 327, XP025682441, ISSN: 0378-1119, [retrieved on 19841201], DOI: 10.1016/0378-1119(84)90007-6 *
SMITH JC; DERBYSHIRE RB; COOK E; DUNTHORNE L; VINEY J; BREWER SJ; SASSENFELD HM; BELL LD: "Chemical synthesis and cloning of a poly(arginine)-coding gene fragment designed to aid polypeptide purification", GENE, vol. 32, 1984, pages 321 - 327, XP023538498, DOI: doi:10.1016/0378-1119(84)90007-6
SPENCER AJ; HILL F; HONEYCUTT JD; COTTINGHAM MG; BREGU M; ROLLIER CS; FURZE J; DRAPER SJ; SOGAARD KC; GILBERT SC: "Fusion of the Mycobacterium tuberculosis antigen 85A to an oligomerization domain enhances its immunogenicity in both mice and non-human primates", PLOS ONE, vol. 7, 2012, pages E33555
STEMPFER G; HÖLL-NEUGEBAUER B; KOPETZKI E; RUDOLPH R: "A fusion protein designed for noncovalent immobilization: stability, enzymatic activity, and use in an enzyme reactor", NAT BIOTECHNOL., vol. 14, 1996, pages 481 - 484
STEMPFER G; HÖLL-NEUGEBAUER B; RUDOLPH R: "Improved refolding of an immobilized fusion protein", NAT BIOTECHNOL., vol. 14, 1996, pages 329 - 334, XP001182925, DOI: doi:10.1038/nbt0396-329
SUZUKI M.: "SPKK, a new nucleic acid-binding unit of protein found in histone", EMBO J., vol. 8, 1989, pages 797 - 804
SWANSON KA; SETTEMBRE EC; SHAW CA; DEY AK; RAPPUOLI R; MANDL CW; DORMITZER PR; CARFI A: "Structural basis for immunization with postfusion respiratory syncytial virus fusion F glycoprotein (RSV F) to elicit high neutralizing antibody titers", PROC NATL ACAD SCI U S A., vol. 108, 2011, pages 9619 - 9624, XP055032519, DOI: doi:10.1073/pnas.1106536108
SZCZESNY P; LINKE D; URSINUS A; BAR K; SCHWARZ H; RIESS TM; KEMPF VA; LUPAS AN; MARTIN J; ZETH K: "Structure of the head of the Bartonella adhesin BadA", PLOS PATHOG, vol. 4, 2008, pages E1000119
TAN K; LIU J; WANG J; SHEN S; LU M: "Atomic structure of a thermostable subdomain of HIV-1 gp41", PROC NATL ACAD SCI U S A., vol. 94, 1997, pages 12303 - 12308, XP002170631, DOI: doi:10.1073/pnas.94.23.12303
TARPE K: "Overview of tag protein fusions: from molecular and biochemical fundamentals to commercial systems", APPLIED MICROBIOLOGY AND BIOTECHNOLOGY, SPRINGER, BERLIN, DE, vol. 60, 1 January 2003 (2003-01-01), pages 523 - 533, XP009091798, ISSN: 1432-0614 *
TARUS B; BAKOWIEZ 0; CHENAVAS S; DUCHEMIN L; ESTROZI LF; BOURDIEU C; LEJAL N; BERNARD J; MOUDJOU M; CHEVALIER C: "Oligomerization paths of the nucleoprotein of influenza A virus", BIOCHIMIE, vol. 94, 2012, pages 776 - 785
TAVANO R; CAPECCHI B; MONTANARI P; FRANZOSO S; MARIN 0; SZTUKOWSKA M; CECCHINI P; SEGAT D; SCARSELLI M; ARIC6 B: "Mapping of the Neisseria meningitidis NadA cell-binding site: relevance of predicted {alpha}-helices in the NH2-terminal and dimeric coiled-coil regions", J BACTERIOL., vol. 193, 2011, pages 107 - 115, XP055111711, DOI: doi:10.1128/JB.00430-10
YANG Y; RINGLER P; MULLER SA; BURKHARD P.: "Optimizing the refolding conditions of self-assembling polypeptide nanoparticles that serve as repetitive antigen display systems", J STRUCT BIOL., vol. 177, 2012, pages 168 - 176, XP028444092, DOI: doi:10.1016/j.jsb.2011.11.011
YE Q; KRUG RM; TAO YJ: "The mechanism by which influenza A virus nucleoprotein forms oligomers and binds RNA", NATURE, vol. 444, 2006, pages 1078 - 1082, XP055125420, DOI: doi:10.1038/nature05379
YUAN P; SWANSON KA; LESER GP; PATERSON RG; LAMB RA; JARDETZKY TS: "Structure of the Newcastle disease virus hemagglutinin-neuraminidase (HN) ectodomain reveals a four-helix bundle stalk", PROC NATL ACAD SCI U S A., vol. 108, 2011, pages 14920 - 14925

Cited By (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20150098958A1 (en) * 2013-03-18 2015-04-09 Imaxio Influenza Nucleoprotein Vaccines
US9243047B2 (en) * 2013-03-18 2016-01-26 Imaxio Influenza nucleoprotein vaccines
US9963490B2 (en) 2013-03-18 2018-05-08 Osivax Sas Influenza nucleoprotein vaccines
EP3134104A4 (en) * 2014-04-25 2017-04-12 Tria Bioscience Corp. Synthetic hapten carrier compositions and methods
US10111948B2 (en) 2014-04-25 2018-10-30 Tria Bioscience Corp. Synthetic hapten carrier compositions and methods
WO2023025864A1 (en) 2021-08-24 2023-03-02 Osivax Immunogenic compositions and their use
WO2023117742A1 (en) 2021-12-22 2023-06-29 Osivax Vaccine compositions and their use
WO2023180394A1 (en) 2022-03-22 2023-09-28 Osivax Mrna vaccine compositions and their use

Also Published As

Publication number Publication date
KR20150094697A (ko) 2015-08-19
CN104981541A (zh) 2015-10-14
MX363443B (es) 2019-03-21
EP2931896A1 (en) 2015-10-21
MX2015007421A (es) 2015-12-07
AU2013357367B2 (en) 2019-10-24
US9388225B2 (en) 2016-07-12
EP2931896B1 (en) 2019-01-16
KR102237130B1 (ko) 2021-04-08
CA2893120C (en) 2022-03-15
PL2931896T3 (pl) 2019-07-31
BR112015013387B1 (pt) 2022-12-20
US20150093406A1 (en) 2015-04-02
JP2016501266A (ja) 2016-01-18
BR112015013387A2 (pt) 2017-11-14
BR112015013387B8 (pt) 2023-01-10
CA2893120A1 (en) 2014-06-19
JP6518193B2 (ja) 2019-05-22
WO2014090905A8 (en) 2014-08-21
AU2013357367A1 (en) 2015-06-11
CN104981541B (zh) 2022-06-28
RU2015126105A (ru) 2017-01-18
RU2677799C2 (ru) 2019-01-21

Similar Documents

Publication Publication Date Title
AU2013357367B2 (en) Modified coiled coil type proteins having improved properties
CA2901888C (en) Influenza nucleoprotein vaccines
KR20110088526A (ko) 구제역 백신 조성물 및 이의 제조 방법
TWI621627B (zh) 用於豬生殖與呼吸綜合症及豬環狀病毒關聯疾病之疫苗組成物
KR102608642B1 (ko) 폐렴구균 표면 단백질 a의 선택된 알파 나선 도메인 및 프롤린 풍부 도메인을 조합한 폐렴구균 백신
WO2011084967A2 (en) Methods and compositions for providing protective immunity in the elderly
DK2931896T3 (en) MODIFIED COILED COIL TYPE WITH IMPROVED PROPERTIES
CN119836300A (zh) 狂犬病毒g蛋白及其用途
CN114699521A (zh) 基于金属硫蛋白家族的免疫佐剂及其应用
CN115715326A (zh) 可形成三聚体的源自于流感病毒表面蛋白的重组血球凝集素蛋白及其用途
Kamzina et al. Virus-like particles presenting conformational epitopes as a promising vaccine platform
EP3135295A1 (en) Coupling of borrelial protein bb0689 to virus-like particles for generation of lyme disease vaccine

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 13802415

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2893120

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2013802415

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2015547006

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: MX/A/2015/007421

Country of ref document: MX

ENP Entry into the national phase

Ref document number: 2013357367

Country of ref document: AU

Date of ref document: 20131211

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112015013387

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 20157018233

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2015126105

Country of ref document: RU

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 112015013387

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20150609