WO2014052322A1 - Desmoglein 2 (dsg2) binding proteins and uses therefor - Google Patents
Desmoglein 2 (dsg2) binding proteins and uses therefor Download PDFInfo
- Publication number
- WO2014052322A1 WO2014052322A1 PCT/US2013/061431 US2013061431W WO2014052322A1 WO 2014052322 A1 WO2014052322 A1 WO 2014052322A1 US 2013061431 W US2013061431 W US 2013061431W WO 2014052322 A1 WO2014052322 A1 WO 2014052322A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- tumors
- adb
- fiber
- dsg2
- seq
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K49/00—Preparations for testing in vivo
- A61K49/0002—General or multifunctional contrast agents, e.g. chelated agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/10—Laxatives
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/18—Drugs for disorders of the alimentary tract or the digestive system for pancreatic disorders, e.g. pancreatic enzymes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
- A61P11/06—Antiasthmatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/12—Drugs for disorders of the urinary system of the kidneys
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/06—Antipsoriatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
- A61P31/06—Antibacterial agents for tuberculosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P5/00—Drugs for disorders of the endocrine system
- A61P5/14—Drugs for disorders of the endocrine system of the thyroid hormones, e.g. T3, T4
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N7/00—Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/10011—Adenoviridae
- C12N2710/10022—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/10011—Adenoviridae
- C12N2710/10033—Use of viral protein as therapeutic agent other than vaccine, e.g. apoptosis inducing or anti-inflammatory
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/10011—Adenoviridae
- C12N2710/10311—Mastadenovirus, e.g. human or simian adenoviruses
- C12N2710/10322—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/10011—Adenoviridae
- C12N2710/10311—Mastadenovirus, e.g. human or simian adenoviruses
- C12N2710/10333—Use of viral protein as therapeutic agent other than vaccine, e.g. apoptosis inducing or anti-inflammatory
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/10011—Adenoviridae
- C12N2710/10311—Mastadenovirus, e.g. human or simian adenoviruses
- C12N2710/10334—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
Definitions
- DSG2 Desmoglein 2 Binding Proteins and Uses Therefor
- Ads Human adenoviruses
- a to F Human adenoviruses
- Most Ad serotypes utilize the coxsackie-adenovirus receptor (CAR) as a primary attachment receptor (Bergelson et al, 1997). This is, however, not the case for species B Ad serotypes.
- CAR coxsackie-adenovirus receptor
- B Ad serotypes Recently, we have suggested a new grouping of species B Ads based on their receptor usage (Tuve et al, 2006).
- Group 1 (Adl6, 21, 35, 50) nearly exclusively utilize CD46 as a receptor;
- Group 2 (Ad3, Ad7, 14) share a common, unidentified receptor/s, which is not CD46 and which was tentatively named receptor X;
- Group 3 (Adl 1) preferentially interacts with CD46, but also utilizes receptor X if CD46 is blocked.
- AdB-2/3 All receptor X utilizing serotypes (Ad3, Ad7, Adl4, Ad 14a, and Adl 1) are referred to herein as AdB-2/3.
- AdB-2/3 have great relevance as gene transfer vectors, particularly with regard to tumors of epithelial origin, representing most solid tumors (Yamamoto and Curiel, 2010).
- Epithelial cells maintain several intercellular junctions and an apical-basal polarity. Key features of epithelial cells are conserved in epithelial cancers in situ and in cancer cell lines (Turley et al., 2008). Both CAR and CD46 are often trapped in tight and adherence junctions of epithelial cancer cells and are not accessible to Ads that use these attachment receptors (Coyne and Bergelson, 2005; Strauss et al, 2009).
- AdB-2/3 efficiently infect epithelial cancer cells, which is accomplished in part through induction of processes that are reminiscent of Epithelial-to-Mesenchymal Transition (EMT) (Strauss et al, 2009).
- EMT Epithelial-to-Mesenchymal Transition
- Another distinctive feature of AdB-2/3 is their ability to produce subviral dodecahedral particles during their replication, consisting of Ad fiber and penton base (Norrby et al., 1967).
- Penton- Dodecahedra (PtDd) cannot assemble from full-length penton base protein, but require spontaneous N-terminal truncation by proteolysis between residues 37 and 38 (Fuschiotti et al, 2006).
- the present invention provides isolated polypeptides comprising the amino acid sequence of any one of SEQ ID NOS: l-l 1.
- the present invention provides recombinant AdB-2/3 fiber polypeptides, comprising:
- AdB-2/3 fiber polypeptide knob domain operatively linked to and located C-terminal to the one or more AdB-2/3 fiber polypeptide shaft domains, wherein the AdB-2/3 fiber polypeptide knob domain comprises the polypeptide of any SEQ ID NOS: l-l 1; and (c) one or more non-AdB-2/3 -derived dimerization domains operatively linked to and located N-terminal to the one or more AdB-2/3 fiber polypeptide shaft domains.
- the AdB-2/3 fiber polypeptide does not include an AdB-2/3 fiber polypeptide tail domain.
- each shaft domain is selected from the group consisting of an Ad3 fiber polypeptide shaft domain, an Ad7 fiber polypeptide shaft domain, an Adl 1 fiber polypeptide shaft domain, an Ad 14 fiber polypeptide shaft domain, an Ad 14a fiber polypeptide shaft domain, combinations thereof, and functional equivalents thereof.
- each shaft domain comprises the amino acid sequence of any one of SEQ ID NOS: 12- 18, or combinations thereof.
- the dimerization domain comprises an amino acid sequence selected from the group consisting of SEQ ID NO:24 and SEQ ID NO: 25.
- the recombinant AdB-2/3 fiber polypeptide comprises or consists of the amino acid sequence of any one of SEQ ID NO:28- 34.
- the AdB-2/3 fiber polypeptide is multimerized, such as dimerized.
- the AdB-2/3 fiber polypeptide further comprises one or more compounds conjugated to the recombinant AdB-2/3 fiber polypeptide, such as therapeutics, diagnostics, and imaging agents.
- the present invention provides isolated nucleic acids encoding the isolated peptide or the recombinant AdB-2/3 fiber polypeptides of the invention, recombinant expression vectors comprising the isolated nucleic acids, and .host cells comprising the recombinant expression vectors.
- the present invention provides pharmaceutical compositions, comprising
- the present invention provides methods for enhancing therapeutic treatment, or diagnosis of a disorder associated with epithelial tissue, and/or imaging epithelial tissues, comprising administering to a subject in need thereof:
- an amount of an AdB-2/3 fiber multimer or pharmaceutical composition of any embodiment or combination of embodiments of the invention sufficient to enhance efficacy of the one or more therapeutics, diagnostics, and/or imaging agents.
- disorders associated with epithelial tissue include solid tumors, irritable bowel syndrome, inflammatory bowel disorder, Crohn's disease, ulcerative colitis, constipation,
- gatroesophageal reflux disease Barrett's esophagus, chronic obstructive pulmonary disease, asthma, bronchitis, pulmonary emphysema, cystic fibrosis, interstitial lung disease, pneumonia, primary pulmonary hypertension, pulmonary embolism, pulmonary sarcoidosis, tuberculosis, pancreatitis, pancreatic duct disorders, bile duct obstruction, cholecystitis, choledocholithiasis, brain disorders, psoriasis, dermatitis, glomerulonephritis, hepatitis, diabetes, thyroid disorders, cellulitis, infection, pyelonephritis, and gallstones.
- the present invention provides methods for treating a disorder associated with epithelial tissue, comprising administering to a subject in need thereof an amount of an AdB-2/3 fiber multimer or pharmaceutical composition of any embodiment or combination of embodiments of the invention, sufficient to treat the disorder.
- a disorder may be a viral infection or a solid tumor.
- the present invention provides methods for improving delivery of a compound to an epithelial tissue, comprising contacting the epithelial tissue with
- the one or more compounds may be diagnostic or imaging agents.
- the present invention provides methods for improving delivery of a substance to a tissue expressing desmoglein 2 (DSG2), comprising contacting the tissue expressing DSG2 with
- the present invention provides methods for inducing an epithelial to mesenchymal transition (EMT) in a tissue, comprising contacting the epithelial tissue with an amount of an AdB-2/3 fiber multimer or pharmaceutical composition of any embodiment or combination of embodiments of the invention, sufficient to induce EMT.
- EMT epithelial to mesenchymal transition
- the present invention proivides methods for identifying candidate compounds for one or more of treating a disorder associated with epithelial tissue, improving delivery of a substance to an epithelial tissue, for improving delivery of a substance tissue expressing DSG2, inducing an EMT in a tissue, and/or treating an AdB-2/3 infection comprising
- the positive test compounds are candidate compounds for one or more of treating a disorder associated with epithelial tissue, improving delivery of a substance to an epithelial tissue, for improving delivery of a substance tissue expressing DSG2, inducing an EMT in a tissue, and/or treating an AdB-2/3 infection.
- FIG. 1 Residues found to be critically involved in binding to DSG2.
- Adl4(deWit), Adl4pl had a deletion of two amino acid residues within the FG loop of the fiber protein knob (24) indicated by a triangle.
- C and D Coomassie staining. 10 ⁇ g of purified Ad3 fiber knob (unboiled) were loaded per lane. Trimeric forms of the fiber knobs are indicated by an arrow.
- E and F Western blot using soluble recombinant DSG2 as a probe, followed by anti-DSG2-mAb and anti- mouse IgG-HRP. For comparison, JO-1 (O ⁇ g/lane) is shown. The Western blots were scanned and signals were quantified.
- FIG. 1D model of the Ad3 fiber knob The structure is based on PDB accession number 1H7Z A.
- Upper panel Four critical areas involved in DSG2 binding. The critical residues are shown on the isosurface of the trimeric fiber knob. View from the top (apical side) facing the receptor. Lower panel: All critical residues combined.
- Right side An enlargement of the groove after a slight side rotation.
- FIG. 3 Competition of Ad3 virus by dimerized Ad3 knob mutants.
- Ad3 fiber knobs containing different numbers shaft motifs and the wild-type Ad3 fiber knob (lane 1 : Ad3- S6/Kn, lane 2: Ad3-S5/Kn, lane 3 : Ad3-S4/Kn, lane 4: Ad3-S3/Kn, lane 5: Ad3-S2/Kn, lane 6: Ad3-S/Kn), JO-1 (lane 7) and the CD46-binding Ad35 fiber knob (lane 8) were blotted and hybridized with soluble DSG2 (upper panel) or soluble CD46 (lower panel). Binding was detected by anti-DSG2 mAb or anti-CD46 mAb .
- FIG. 5 Correlation of reduced DSG2 binding with the ability to open epithelial junctions.
- FIG. 6 Amino acid substitutions that increase the binding to DSG2.
- Residues are show in magenta in two knob monomers. Isosurface of one monomer is shown in grey transparency.
- FIG. 7 SPR analysis of non-dimerized Ad3 fiber knob interactions with DSG2.
- DSG2 was immobilized on sensorchips, and background was automatically subtracted from the control flow cell.
- the Ad3 fiber knobs (w/o dimerization domain: "noDD") were injected for 3 minutes at 2.5 ⁇ g/ml followed by a 2.5 minutes dissociation period.
- noDD dimerization domain
- FIG. 8 Electron microscopy and 3D structure of Ad3 fiber knob mutant JO-2. A-C) Negative staining of JO-2 with SST. Dimeric forms can be seen but higher
- FIG. 9 Analysis of dimeric Ad3 fiber knob mutants with increased affinity to DSG2.
- A) Competition of Ad3-GFP virus infection on HeLa cells with dimeric affinity- enhanced mutant Y250F and JO-1 (deimeric wt Ad3 fiber knob). The experimental setting is as described for Fig.3C. left panel: percentage of GFP positive cells. Right panel: mean fluorescence intensity. N 3. The standard deviation was less than 10%.
- FIG. 10 Combination of affinity-enhanced JO-1 versions with chemotherapy.
- A) Enhancement of irinotecan (I) therapy. The experimental setting was the same as in Fig.5B. The differences in the groups “JO- 1+1” vs "JO-2+irinotecan” and “JO-2+I” vs "JO- 4+1 were significant from day 20 on. N 5.
- mice were injected intravenously with 2 mg/kg JO-1 or with 0.5mg/kg JO-4, followed by an intravenous injection of PEGylated liposomal doxorubicin (PLD) (1 mg/kg) one hour later. Treatment was repeated weekly.
- PEGylated liposomal doxorubicin PEGylated liposomal doxorubicin (1 mg/kg) one hour later. Treatment was repeated weekly.
- C) JO-4 enhances therapy in poor-prognosis triple negative breast cancer (TNBC). A total of 4xl0 6 TNBC MDA-MB-231 cells were injected into the mammary fat pad of CB 17 SCID-beige mice.
- TNBC triple negative breast cancer
- FIG. 11 Pharmacokinetics, toxicity, and immunogenicity of JO-4.
- hDSG2 transgenic mice with subcutaneous TCl-hDSG2 tumors ( ⁇ 600mm 3 ) were intravenously injected with JO-1 or JO-4 (2mg/kg) and serum samples were analyzed for by ELISA. N 3. Note that the y-axis has a log scale.
- B) Lymphocyte and platelet counts in hDSG2/TCl-hDSG2 transgenic mice after JO-1 or JO-4 injection. N 3.
- FIG. 13 Sera from humans and hypervaccinated mice do not inhibit activity of JO-4.
- PI to P38 are serum sample for ovarian cancer patients obtained from the Pacific Ovarian Cancer Research Consortium.
- amino acid residues are abbreviated as follows: alanine (Ala; A), asparagine (Asn; N), aspartic acid (Asp; D), arginine (Arg; R), cysteine (Cys; C), glutamic acid (Glu; E), glutamine (Gin; Q), glycine (Gly; G), histidine (His; H), isoleucine (He; I), leucine (Leu; L), lysine (Lys; K), methionine (Met; M), phenylalanine (Phe; F), proline (Pro; P), serine (Ser; S), threonine (Thr; T), tryptophan (Trp; W), tyrosine (Tyr; Y), and valine (Val; V).
- Ad refers to an adenovirus and is typically followed by a number indicating the serotype of the adenovirus.
- Ad3 refers to adenovirus serotype 3.
- the present invention provides isolated polypeptide comprising or consisting of the amino acid sequence: TLWTG(V/P)(N/K)P(-/T)(E/R)ANC(Q/I)(M/I)(M/E)(Y/A/N/D)(S/G)(S/K)(E/Q)(S/N) ( /P)D(C/S)KL(I/T)L(I/T)LVK(T/N)G(A/G)(L/I)V(T/N)(A/G)(F/Y)V(Y/T)(V/L)(I/M)G(V/ A)S(N/D)( /D/Y)(FA ⁇ )N(M/T)L(T/F)(T/K)(Y/H/ )(R/K)N( )(N/S)(F/I)(T/N)(A/V)EL(F/ Y)FD(S
- X2 is H, L, or P
- X3 is K or E
- X4 is T, F, S, or L
- X5 is V, D, or is absent
- X6 is E, G, or is absent
- X7 is Y or F
- X8 is T, K, or E
- X9 is N or S
- X2 is P
- X4 is S, or L
- X5 is D
- X6 is G
- X7 is F
- X8 is E;
- X9 is S.
- Isolated polypeptides according to this aspect of the invention comprise mutant AdB- 2/3 knob domains, which can be used, for example, to produce recombinant AdB-2/3 fiber polypeptides that provide significantly enhanced affinity for desmoglein 2 (DSG2) compared to previously known DSG2 binding polypeptides.
- DSG2 desmoglein 2
- recombinant AdB-2/3 fiber polypeptides of the invention that incorporate the mutant knob domains of this first aspect of the invention are further shown to be therapeutically more potent than previously known DSG2 binding polypeptides for treating epithelial-associated disorder, exemplified by improved efficacy in a series of cancer models.
- the isolated peptides of the invention can also be used, for example, as antigens against AdB-2/3 viruses.
- Residues that are shown within parentheses reflect options at a single residue; dashes (— ) indicate that the residue can be absent.
- the isolated polypeptides of the first aspect of the invention comprises or consists of the amino acid sequence
- the isolated polypeptides of the first aspect of the invention comprises or consists of the amino acid sequence
- the isolated polypeptides of the first aspect of the invention comprises or consists of the amino acid sequence
- TLWTGPKPEA NCIIEYGKQN PDSKLTLILV KNGG(I/L)VNGYV TLMGASDYVN TLFKNKNVSI NVELYFDATG HILPDSSSLK TDLEX2 X3YKQT AD X4 SARGFMP STTAYPFX5LP NAGTHNX6NX7 I FGQCYY X8 ASP GALFPLEVTV MLNKRLPDSR TSYVMTFLWS LX9AGLAPETT QATLITSPFT FSYIREDD (SEQ ID NO: 4).
- X2 is P
- X4 is S, or L
- X5 is D
- X6 is G
- X7 is F
- X8 is E;
- X9 is S.
- At least 2, 3, 4, 5, 6, 7, or all 8 of these statements is true.
- at least X7 is F.
- at least X3 is E and X4 is S.
- at least X9 is S.
- at least X5 is D.
- at least X4 is L.
- at least X2 is P and X8 is E.
- at least X6 is G and X8 is E.
- the isolated polypeptide comprises or consists of one of the following peptides:
- FKNKNV SINVELYFD ATGHILPD S S SLKTDLELKYKQTADF S ARGFMP STT AYPF VLP NAGTHNENFIFGQCYYKASDGALFPLEVTVMLNKRLPDSRTSYVMTFLWSLNAGLA PETTQATLITSPFTFSYIREDD (SEQ ID NO: 5); (b) TLWTGPKPEANCIIEYGKQNPDSKLTLILVKNGGIVNGYVTLMGASDYVN
- the present invention provides recombinant AdB-2/3 fiber polypeptide, comprising:
- AdB-2/3 fiber polypeptide knob domain operatively linked to and located C-terminal to the one or more AdB-2/3 fiber polypeptide shaft domains, wherein the AdB-2/3 fiber polypeptide knob domain comprises the polypeptide of any embodiment or combination of embodiments of the first aspect of the invention.
- AdB-2/3 is any adenovirus serotype that uses DSG2 as an epithelial cell receptor for viral binding.
- Ad3, Ad7, Adl 1, Adl4, and Adl4a serotypes have been identified.
- Ad serotypes those of skill in the art can readily identify those that belong to the AbD-2/3 family based on DSG2 binding assays as disclosed herein.
- SPR surface plasmon resonance
- the adenovirus virion is an icosahedron characterized by a fiber located at the base of each of the 12 vertices of the capsid.
- the fiber on the virion is a homotrimeric structure consisting of 3 individual fiber polypeptides.
- Each adenovirus fiber polypeptide is an asymmetrical structure consisting of an N-terminal tail, which interacts with the penton base protein of the capsid and contains the signals necessary for transport of the protein to the cell nucleus; a shaft, which contains a number of 15-residue repeating units; and a C-terminal knob domain that contains the determinants for receptor binding (J.S. Hong and J. A. Engler, Journal of Virology 70:7071-7078 (1996)).
- AdB- 2/3 "fiber polypeptide” refers to a full length fiber polypeptide that comprises an N-terminal tail domain, a shaft domain, and a C-terminal knob domain.
- the fiber polypeptides spontaneously assemble into homotrimers, referred to as "fibers," which are located on the outside of the adenovirus virion at the base of each of the twelve vertices of the capsid.
- the recombinant polypeptides do not include a tail domain from an Ad fiber polypeptide.
- the inventors identified critical residues, mutation of which result in fiber polypeptides with significantly enhanced affinity for DSG2, and with significantly enhanced therapeutic potency.
- the polypeptides of this aspect of the invention can thus be used, for example, to form AdB-2/3 fiber multimers for use in the various methods of the invention discussed above.
- the recombinant polypeptides can include shaft domains from any AdB-2/3 virus, or any mutants
- polypeptide is used in its broadest sense to refer to a sequence of subunit amino acids.
- the polypeptides of the invention may comprise L-amino acids, D-amino acids (which are resistant to L-amino acid- specific proteases in vivo), or a combination of D- and L-amino acids.
- the polypeptides described herein may be chemically synthesized or recombinantly expressed.
- the polypeptides may be linked to other compounds to promote an increased half-life in vivo, such as by PEGylation, HESylation, PASylation, glycosylation, or may be produced as an Fc- fusion or in deimmunized variants. Such linkage can be covalent or non-covalent as is understood by those of skill in the art.
- the term "operatively linked” refers to an arrangement of elements wherein the domains are configured so that they function as a unit for their intended purpose. The term does not require that the domains are immediately adjacent on the polypeptide, as spacer/linker sequences may be present between the domains, the lengths of which can be quite variable. In one non-limiting embodiment, the spacer length between any two domains of the recombinant AdB-2/3 fiber polypeptides can be between about 0 amino acids and about 20 amino acids.
- the spacer length can be 0-20, 0-19, 0-18, 0-17, 0-16, 0-15, 0-14, 0-13, 0-12, 0-1 1, 0-10, 0-9, 0- 8, 0-7, 0-6, 0-5, 0-4, 0-3, 0-2, 0-1, 1-20, 1-19, 1-18, 1-17, 1-16, 1-15, 1-14, 1-13, 1-12, 1-11, 1-10, 1-9, 1-8, 1-7, 1-6, 1-5, 1-4, 1-3, 1-2, 2-20, 2-19, 2-18, 2-17, 2-16, 2-15, 2-14, 2-13, 2-
- recombinant polypeptide means a non-naturally occurring protein product, wherein the domains of the recombinant polypeptide are derived from one or more other proteins or artificially derived sequences, such as the mutant knob domain polypeptides of the invention.
- each shaft domain can be derived from a different naturally occurring protein.
- the recombinant polypeptide may be constructed by a variety of mechanisms including, but not limited to, standard DNA manipulation techniques and chemical assembly via subunit parts of the recombinant polypeptide. The chemical assembly may lead to an equivalent form as the molecular genetic form or alternative associations with equivalent function.
- the recombinant polypeptide is produced by standard recombinant DNA techniques. Techniques for such recombinant production and isolation of the recombinant polypeptides of the invention are well within the level of skill in the art based on the teaching herein.
- each shaft domain is selected from the group consisting of an Ad3 shaft domain, an Ad7 shaft domain, an Adl 1 shaft domain, an Ad 14 shaft domain, an Ad 14a shaft domain, combinations thereof, and functional equivalents thereof.
- the shaft domain is required for fiber knob dimerization, which is required for binding to DSG2 and resulting transient opening of intercellular junctions.
- functional equivalents of the shaft domains of these Ad virus serotypes can be readily determined by those of skill in the art, based on the examples provided below. For example, surface plasmon resonance (SPR) studies using sensors containing immobilized recombinant DSG2 can be used to determine if recombinant polypeptides being assessed bind to DSG2, combined with DSG2 competition studies. Further exemplary studies, such as loss and gain of function analyses, are described in detail in Example 1.
- SPR surface plasmon resonance
- the recombinant polypeptides may comprise between 1 and 22 AdB-2/3 fiber polypeptide shaft domains.
- polypeptides comprise 1-22, 1- 21, 1-20, 1-19, 1-18, 1-17, 1-16, 1-15, 1-14, 1-13, 1-12, 1-1 1, 1-10, 1-9, 1-8, 1-7, 1-6, 1-5, 1- 4, 1-3, 1-2, 2-22, 2-21, 2-20, 2-19, 2-18, 2-17, 2-16, 2-15, 2-14, 2-13, 2-12, 2-11, 2-10, 2-9,
- AdB-2/3 fiber protein shaft domains where more than 1 AdB-2/3 fiber protein shaft domain is present, each shaft domain can be identical, or one or more copies of the shaft domain may differ in a single recombinant polypeptide. In a preferred embodiment, the recombinant AdB-2/3 fiber polypeptide has a single shaft domain.
- one or more (or all) shaft domains in the recombinant polypeptide comprise or consist of an amino acid sequence according to SEQ ID NO 12:
- one or more (or all) shaft domains in the recombinant polypeptide comprise or consist of an amino acid sequence according to SEQ ID NO 13 :
- one or more (or all) shaft domains in the recombinant polypeptide comprise or consist of an amino acid sequence selected from the group consisting of SEQ ID NO: 14 (Ad3), SEQ ID NO: 15 (Ad7), SEQ ID NO: 16 (Adl 1), SEQ ID NO: 17 (Adl4), and SEQ ID NO: 18 (Adl4a).
- the AdB-2/3 fiber polypeptide knob domain comprises or consists of any
- a "dimerization domain” is a peptide sequence that promotes dimerization in the recombinant polypeptide that contains it. Any suitable non-AdB-2/3- derived dimerization domain can be used in the recombinant polypeptide of the invention, so long as it permits dimerization of the recombinant polypeptide and thus binding to DSG2.
- the dimerization domain is non-AdB-2/3 -derived, in that it is not a naturally occurring domain in an AdB-2/3 fiber polypeptide.
- Non-limiting examples of the numerous dimerization domains known to those of skill in the art and suitable for use in the present invention include, but are not limited to peptide helices containing at least one helix, or a structure formed by a helix, a coil and another helix, etc., coiled coil structures, dimerization domains within, for example, many cell surface signaling receptors, Fc regions or hinge regions of an antibody, leucine zippers, the STAT protein N terminal domain, FK506 binding protein, the LexA protein C-terminal domain, nuclear receptors, the FkpA N-terminal domain, orange carotenoid protein from maxima, Ml matrix protein from influenza, neuraminidase from influenza virus, E.
- residues 325 to 410 in the bovine papillomavirus E2 protein (Dostatni, N., et al, EMBO J 7 (1988) 3807-3816; Haugen, T., et al. EMBO J 7 (1988) 4245-4253; McBride, A., et al, EMBO J 7 (1988) 533-539; McBride, A., et al, Proc Natl Acad Sci USA 86 (1989) 510-514),Type I deiodinase (Dl )i
- DFLVIYIEEAHASDGW (SEQ ID NO: 19) or ADFL-YI-EAH— DGW (SEQ ID NO: 20); HIV-1 Capsid Protein: QGPKEPFRDYVDR YKTLRA (SEQ ID NO: 21); leucine zipper dimerization motif of yeast GCN4: HMKQL D VEEL 5" NYHL N VARL K VGER (SEQ ID NO: 22); leucine zipper in Escherichia coli transcriptional antiterminator protein; and BglG: GVTQLMREMLQLIKFQFSLNYQEESLSYQRLVT (SEQ ID NO: 23).
- the dimerization domain comprises one or more copies of EVSALEK (SEQ ID NO:24) and/or KVSALKE (SEQ ID NO: 25) .
- dimerization of the recombinant AdB- 2/3 fiber polypeptides can be assessed by criteria including sedimentation in sucrose gradients, resistance to trypsin proteolysis, and electrophoretic mobility in polyacrylamide gels (Hong and Engler, Journal of Virology 70:7071-7078 (1996)).
- the recombinant polypeptides may comprise one or more non-AdB-2/3 -derived dimerization domains.
- the recombinant polypeptide comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more non-AdB-2/3 -derived dimerization domains. Where multiple domains are present in a polypeptide, it is preferred that each dimerization domain is the same.
- a spacer peptide is located between the dimerization domain and the one or more shaft domains.
- the spacer peptide is a peptide with structural flexibility. Virtually any peptide with structural flexibility can be used.
- the flexible peptide may comprise repetitions of amino acid residues, such as Gly-Gly-Gly-Ser (SEQ ID NO: 26), or any other suitable repetition of amino acid residues.
- the hinge region of an antibody can be used.
- the spacer can be any suitable length that maintains the ability of the recombinant polypeptide to dimerize and to maintain binding of the recombinant polypeptide to DSG2.
- the recombinant AdB-2/3 polypeptide comprises one or more shaft domains that each comprise or consist of an Ad3 shaft domain (SEQ ID NO: 14)
- any suitable knob domain can be used, and any suitable dimerization domain can be used, including but not limited to one or more copies of EVSALEK (SEQ ID NO:24) and/or KVSALKE (SEQ ID NO: 25).
- any suitable spacer peptides can be used between the dimerization domain and the shaft domain and/or between the shaft domain and the knob domain.
- the recombinant AdB-2/3 polypeptide comprises or consists of JO-1 (SEQ ID NO:27), or a multimer thereof (such as a dimer).
- the recombinant polypeptides may comprise further domains, such as a domain for isolation of the polypeptide and/or a detection domain.
- An isolation domain can be added to facilitate purification/isolation of the polypeptide following, for example, recombinant polypeptide production.
- Any suitable isolation domain can be used, including but not limited to HIS, CBP, CYD (covalent yet dissociable NorpD peptide), Strep II, FLAG, HPC (heavy chain of protein C) peptide tags, GST and MBP affinity tags.
- detection domain means one or more amino acid sequence that can be detected.
- Any suitable detection domain can be used, including but not limited to, inherently fluorescent proteins (e.g. Green Fluorescent Proteins and fluorescent proteins from nonbioluminescent Anthozoa species), cofactor-requiring fluorescent or luminescent proteins (e.g.
- phycobiliproteins or luciferases and epitopes recognizable by specific antibodies or other specific natural or unnatural binding probes, including, but not limited to, dyes, enzyme cofactors and engineered binding molecules, which are fluorescently or luminescently labeled.
- the recombinant AdB-2/3 fiber polypeptide comprises or consists of the amino acid sequence of one of the following
- the recombinant polypeptides are in a multimeric form, such as a dimer, trimer, etc.
- a multimer comprises a dimer formed by dimerization through the dimerization domains in each homotrimer (ie: a polypeptide is a homotrimer through trimerization of the knob domain)
- the recombinant polypeptides comprise AdB-2/3 fiber multimers, and can be used in the various methods of the invention discussed above.
- such multimers may comprise multimers of identical recombinant polypeptide of the invention, or may comprise multimers of different recombinant polypeptides of the invention.
- the dimerization domains are the same in each recombinant polypeptide forming part of the multimer. In another embodiment, the dimerization domains are different in each recombinant polypeptide forming part of the multimer. In another embodiment, the shaft and/or knob domains are the same in each recombinant polypeptide forming part of the multimer. In another embodiment, the shaft and/or knob domains are different in each recombinant polypeptide forming part of the multimer.
- AdB-2/3 fiber multimerization can be determined according to methods well known to the practitioners in the art. For example, multimerization of the recombinant AdB-2/3 fiber constructs can be assessed by criteria including sedimentation in sucrose gradients, resistance to trypsin proteolysis, and electrophoretic mobility in polyacrylamide gels (Hong and Engler, Journal of Virology 70:7071-7078 (1996)). Regarding electrophoretic mobility, the fiber multimer is a very stable complex and will run at a molecular weight consistent with that of a multimer when the sample is not boiled prior to SDS-PAGE. Upon boiling, however, the multimeric structure is disrupted and the protein subsequently runs at a size consistent with the protein monomer.
- the recombinant polypeptides, or multimeric versions thereof, may be stored in solution or frozen.
- the recombinant polypeptides of the invention are combined with (such as conjugated to) one or more therapeutics for a disorder associated with epithelial tissue.
- Such conjugates can be used, for example, in the therapeutic methods of the invention.
- Methods for conjugating the polypeptides of the invention to a therapeutic of interest, such as by covalent binding or chemical cross-linking, are well known to those of skill in the art.
- Any suitable therapeutic can be used to form a conjugate according to this embodiment of the invention, including but not limited to tumor stroma degrading compounds (such as relaxin), alkylating agents, angiogenesis inhibitors, antibodies, antimetabolites, antimitotics, antiproliferatives, aurora kinase inhibitors, apoptosis promoters (for example, Bcl-xL, Bcl-w and Bfl-1) inhibitors, activators of death receptor pathway, Bcr- Abl kinase inhibitors, BiTE (Bi-Specific T cell Engager) antibodies, biologic response modifiers, cyclin-dependent kinase inhibitors, cell cycle inhibitors, cyclooxygenase-2 inhibitors, growth factor inhibitors, heat shock protein (HSP)-90 inhibitors, demethylating agents, histone deacetylase (HDAC) inhibitors, hormonal therapies, immunologicals, inhibitors of apoptosis proteins (IAPs) intercalating antibiotics, kinase inhibitor
- Exemplary therapeutics falling within these various classes include, but are not limited to: docetaxel, doxorubicin, irinotecan, paclitaxel (Taxol®), paclitaxel albumin bound particles (Abraxane®), doxorubicin HCL liposome (Doxil®), BiTE antibodies such as adecatumumab (Micromet MT201), blinatumomab (Micromet MT103) and the like, siRNA- based therapeutics, alkylating agents including altretamine, AMD-473, AP-5280, apaziquone, bendamustine, brostallicin, busulfan, carboquone, carmustine (BCNU), chlorambucil, CLORETAZINE.® (laromustine, V P 40101M), cyclophosphamide, dacarbazine, decitabine, 5'-azacytidine, estramustine, fotemustine, glufosf
- Bcl-2 protein inhibitors including AT- 101 ((-)gossypol), GENASENSE® (G3139 or oblimersen (Bcl-2-targeting antisense oligonucleotide)), IPI-194, IPI-565, N-(4-(4-((4'-chloro(l, l'- biphenyl)-2-y
- geldanamycin IPI-504, KOS-953, MYCOGRAB® (human recombinant antibody to HSP- 90), NCS-683664, PU24FC1, PU-3, radicicol, SNX-21 12, STA-9090 VER49009 and the like; activators of death receptor pathways including TRAIL, antibodies or other agents that target TRAIL or death receptors (e.g., DR4 and DR5) such as Apomab, conatumumab, ETR2-ST01, GDC0145, (lexatumumab), HGS-1029, LBY-135, PRO-1762 and trastuzumab; platinum chemotherapeutics include cisplatin, ELOXATIN® (oxaliplatin) eptaplatin, lobaplatin, nedaplatin, PARAPLATTN® (carboplatin), satraplatin, picoplatin and the like; VEGFR inhibitors including AVASTTN® (bevaci
- NEXAVAR® (sorafenib, BAY43-9006), pazopanib (GW-786034), vatalanib (PTK-787, ZK- 222584), SUTENT® (sunitinib, SU- 11248), VEGF trap, ZACTIMAThi (vandetanib, ZD- 6474) and the like; dendritic cell therapy (sipuleucel-T, Provenge®); topoisomerase inhibitors including aclarubicin, 9-aminocamptothecin, amonafide, amsacrine, becatecarin, belotecan, BN-80915, CAMPTOSAR® (irinotecan hydrochloride), camptothecin, dexrazoxine, diflomotecan, edotecarin, ELLENCE® or PHARMORUBICI ® (epirubicin), etoposide, exatecan, abraxane,
- AVASTIN® bevacizumab
- CD40-specific antibodies chTNT-l/B, denosumab
- ERBITUX® cetuximab
- hormonal therapies including ARIMIDEX® (anastrozole), AROMASIN® (exemestane), arzoxifene, CASODEX® (bicalutamide), CETROTIDE® (cetrorelix), degarelix, deslorelin, DESOPAN® (trilostane), dexamethasone, DROGENIL® (flutamide), EVISTA®
- agents include ALFAFERONE® (IFN-alpha), BAM-002 (oxidized glutathione), BEROMUN® (tasonermin), BEXXAR® (tositumomab), CAMPATH® (alemtuzumab), CTLA4 (cytotoxic lymphocyte antigen 4), decarbazine, denileukin, epratuzumab, GRANOCYTE® (lenograstim), lentinan, leukocyte alpha interferon, imiquimod, MDX-010 (anti-CTLA-4), melanoma vaccine, mitumomab, molgramostim, MYLOTARG.TM.
- pyrimidine analogs include cytarabine (ara C or Arabinoside C), cytosine arabinoside, doxifluridine, FLUDARA® (fludarabine), 5-FU (5-fluorouracil), floxuridine, GEMZAR® (gemcitabine), TOMUDEX® (ratitrexed), TROXATYL® (triacetyluridine troxacitabine) and the like; purine analogs including LANVIS® (thioguanine) and PURI-NETHOL® (mercaptopurine).; antimitotic agents including batabulin, epothilone D (KOS-862), N-(2-((4-
- DAB(389)EGF catalytic and translocation domains of diphtheria toxin fused via a His-Ala linker to human epidermal growth factor
- TransMID-107R® diphtheria toxins
- dacarbazine dactinomycin, 5,6-dimethylxanthenone-4-acetic acid (DMXAA), eniluracil, EVIZON.TM. (squalamine lactate), DIMERICINE® (T4N5 liposome lotion),
- discodermolide DX-8951f (exatecan mesylate), enzastaurin, EPO906 (epithilone B), GARDASIL® (quadrivalent human papillomavirus (Types 6, 11, 16, 18) recombinant vaccine), GASTRIMMUNE®, GENASENSE®, GMK (ganglioside conjugate vaccine), GVAX® (prostate cancer vaccine), halofuginone, histerelin, hydroxycarbamide, ibandronic acid, IGN-101, IL-13-PE38, IL-13-PE38QQR (cintredekin besudotox), IL-13-pseudomonas exotoxin, interferon-.
- OVAREX® MAb murine monoclonal antibody
- paclitaxel PANDIMEX® (aglycone saponins from ginseng comprising 20(S)protopanaxadiol (aPPD) and 20(S)protopanaxatriol (aPPT)), panitumumab, PANVAC®-VF (investigational cancer vaccine), pegaspargase, PEG Interferon A, phenoxodiol, procarbazine, rebimastat,
- REMOVAB® catumaxomab
- REVLIMID® laenalidomide
- RSR13 efaproxiral
- SOMATULINE® LA lanreotide
- SORIATANE® acitretin
- staurosporine Streptomyces staurospores
- talabostat PT100
- TARGRETIN® bexarotene
- TAXOPREXIN® DHA- paclitaxel
- TELCYTA® canfosfamide, TLK286)
- temilifene TEMODAR®
- TNFERADE® adenovector: DNA carrier containing the gene for tumor necrosis factor-. alpha.
- TRACLEER® or ZAVESCA® bosentan
- tretinoin Retin-A
- TRISENOX® tetrandrine
- the therapeutic comprises a compound that binds to desmoglein-2; preferably a compound that binds to DSG2 and opens up tight junctions.
- the therapeutic comprises radioactive particles/radiation therapy.
- Any suitable radioactive therapy or particle can be used as deemed appropriate by an attending physician, including but not limited to cobalt-60, iodine- 131, iridium- 192, strontium-89, samarium 153, rhenium-186 and lead-212.
- the therapeutic is an anti-tumor therapeutic and comprises a chemotherapeutic or anti-tumor monoclonal antibody as described herein.
- the anti-tumor therapeutic comprises an antibody selected from the group consisting of trastuzumab, cetumiximab, petuzumab, apomab, conatumumab, lexatumumab, bevacizumab, bevacizumab, denosumab, zanolimumab, lintuzumab, edrecolomab, rituximab, ticilimumab, tositumomab, alemtuzumab, epratuzumab, mitumomab, gemtuzumab ozogamicin, oregovomab, pemtumomab daclizumab,
- panitumumab panitumumab, catumaxomab, ofatumumab, and ibritumomab.
- useful anti-tumor mAb and their specific uses are listed in Table 1, and as further described in Campoli, M., et al, Principles & Practice of Oncology 23(1&2): 1-19 (2009), incorporated herein by reference.
- the recombinant polypeptides of the invention are combined with (such as conjugated to) one or more diagnostic or imaging agents.
- the recombinant polypeptides of the invention, and multimers thereof, have broad application for delivery of any diagnostic, imaging agent, or other compound to epithelial tissue comprising intercellular junctions where access to a target of interest can be limited.
- the imaging agents can include any chemical compound that can produce a detectable signal, either directly or indirectly. Many such imaging agents are known to those of skill in the art.
- imaging agents suitable for use in the disclosed methods and compositions are radioactive isotopes, fluorescent molecules, magnetic particles (including nanoparticles), metal particles (including nanoparticles), phosphorescent molecules, enzymes, antibodies, ligands, and combinations thereof, while diagnostic agents may comprise a compound that is a diagnostic marker for a particular epithelial disorder bound to the such an imaging agent.
- diagnostic agents may comprise a compound that is a diagnostic marker for a particular epithelial disorder bound to the such an imaging agent.
- radioactive isotopes can be detected by scintillation counting or direct visualization; fluorescent molecules can be detected with fluorescent spectrophotometers; phosphorescent molecules can be detected with a spectrophotometer or directly visualized with a camera; enzymes can be detected by detection or visualization of the product of a reaction catalyzed by the enzyme; antibodies can be detected by detecting a secondary detection label coupled to the antibody.
- the imaging agent and/or diagnostic is one that can be used to detect a tumor, whether by direct tumor binding, or by coupling of the imaging or diagnostic agent with a compound that can bind the tumor.
- the imaging agent can be a fluorescent imaging agent, while diagnostic agents may comprise a compound that is a diagnostic marker for a particular epithelial disorder bound to the fluorescent imaging agent.
- a fluorescent imaging agent is any chemical moiety that has a detectable fluorescence signal. This imaging agent can be used alone or in combination with other imaging agents.
- fluorescent agents include, but are not limited to, fluorescein (FITC), 5-carboxyfluorescein-N-hydroxysuccinimide ester, 5,6-carboxymethyl fluorescein, nitrobenz-2-oxa-l,3-diazol-4-yl ( BD), fluorescamine, OP A, NDA, indocyanine green dye, the cyanine dyes (e.g., Cy3, Cy3.5, Cy5, Cy5.5 and Cy7), 4-acetamido-4'- isothiocyanatostilbene-2,2'disulfonic acid, acridine, acridine isothiocyanate, 5-(2'- aminoethyl)aminonaphthalene-l -sulfonic acid (EDANS), 4-amino-N-[3- vinylsulfonyl)phenylinaphthalimide-3 ,5 disulfonate, N-(4-anil
- isothiocyanate sulforhodamine B, sulforhodamine 101, sulfonyl chloride derivative of sulforhodamine 101 (Texas Red), N,N,N',N'-tetramethyl-6-carboxyrhodamine (TAMRA), tetramethyl rhodamine, tetramethyl rhodamine isothiocyanate (TRITC), riboflavin, rosolic acid, coumarin-6, and the like, including combinations thereof.
- TAMRA N,N,N',N'-tetramethyl-6-carboxyrhodamine
- TRITC tetramethyl rhodamine
- riboflavin rosolic acid
- coumarin-6 and the like, including combinations thereof.
- the imaging agents can comprise a Magnetic Resonance Imaging (MRI) agent
- diagnostic agents may comprise a compound that is a diagnostic marker for a particular epithelial disorder bound to the MRI agent.
- a MRI agent is any chemical moiety that has a detectable magnetic resonance signal or that can influence (e.g., increase or shift) the magnetic resonance signal of another agent. This type of imaging agent can be used alone or in combination with other imaging agent.
- a gadolinium- based MRI agent can serve as an imaging agent.
- An example of a suitable MRI agent that can be incorporated into the disclosed imaging agents is para-amino-benzyl
- diethylenetriaminepentaacetic acid p-NH 2 -Bz-DTPA, Compound 7
- DTPA conjugable form of diethylenetriaminepentaacetic acid
- Incorporation of an MRI agent on a large macromolecule such as a dendrimeric substrate as disclosed herein can allow large Tl relaxation (high contrast) and multiple copies of agent on a single molecule, which can increase signal.
- an MRI imaging agent and, for example, a fluorescent imaging agent the resulting agent can be detected, imaged, and followed in real-time via MR I.
- imaging agents include PET agents that can be prepared by incorporating an 18F or a chelator for 64Cu or 68Ga. Also, addition of a radionuclide can be used to facilitate SPECT imaging or delivery of a radiation dose, while diagnostic agents may comprise a compound that is a diagnostic marker for a particular epithelial disorder bound to the PET agent.
- the diagnostic agent is a diagnostic imaging agent, including but not limited to position emission tomography (PET) agents, computerized tomography (CT) agents, magnetic resonance imaging (MRI) agents, nuclear magnetic imaging agents (NMI), fluoroscopy agents and ultrasound contrast agents.
- PET position emission tomography
- CT computerized tomography
- MRI magnetic resonance imaging
- NMI nuclear magnetic imaging agents
- fluoroscopy agents fluoroscopy agents and ultrasound contrast agents.
- Such diagnostic agents include radioisotopes of such elements as iodine (I), including I, I, I etc., barium (Ba), gadolinium (Gd), technetium (Tc), including 99 Tc, phosphorus (P), including 31 P, iron (Fe), manganese (Mn), thallium (Tl), chromium (Cr), including 51 Cr, carbon (C), including 14 C, or the like, fluorescently labeled compounds, or their complexes, chelates, adducts and conjugates.
- PET agents including but not limited to carbon- 1 1, nitrogen-13, oxygen-15, fluorine- 18, 11 C-metomidate, and glucose analogues thereof, including but not limited to fludeoxyglucose (a glucose analog labeled with fluorine- 18.
- the diagnostic agent is a marker gene that encode proteins that are readily detectable when expressed in a cell (including, but not limited to, beta- galactosidase, green fluorescent protein, luciferase, and the like) and labeled nucleic acid probes (e.g., radiolabeled or fluorescently labeled probes).
- covalent conjugation of diagnostic or imaging agents to the AdB-2/3 multimers provided herein is achieved according to a variety of conjugation processes.
- the diagnostic agent is non-covalently associated with AdB-2/3 multimers provided.
- the present invention provides nucleic acids encoding the polypeptide or any embodiment of the invention.
- the nucleic acids may comprise RNA or DNA, and can be prepared and isolated using standard molecular biological techniques, based on the teachings herein.
- the nucleic acids may comprise additional domains useful for promoting expression and/or purification of the encoded protein, including but not limited to polyA sequences, modified Kozak sequences, and sequences encoding epitope tags, export signals, and secretory signals, nuclear localization signals, and plasma membrane localization signals.
- the present invention provides recombinant expression vectors comprising the nucleic acid of any aspect of the invention operatively linked to a promoter.
- "Recombinant expression vector” includes vectors that operatively link a nucleic acid coding region or gene to any promoter capable of effecting expression of the gene product.
- the promoter sequence used to drive expression of the disclosed nucleic acids in a mammalian system may be constitutive (driven by any of a variety of promoters, including but not limited to, CMV, SV40, RSV, actin, EF) or inducible (driven by any of a number of inducible promoters including, but not limited to, tetracycline, ecdysone, steroid-responsive).
- expression vectors for use in transfecting prokaryotic cells are also well known in the art, and thus can be accomplished via standard techniques.
- the expression vector must be replicable in the host organisms either as an episome or by integration into host chromosomal DNA, and may comprise any other components as deemed appropriate for a given use, including but not limited to selection markers such as an antibiotic-resistance gene.
- the present invention provides host cells comprising the recombinant expression vectors disclosed herein, and progeny thereof, wherein the host cells can be either prokaryotic or eukaryotic.
- the cells can be transiently or stably transfected.
- transfection of expression vectors into prokaryotic and eukaryotic cells can be accomplished via any technique known in the art, including but not limited to standard bacterial transformations, calcium phosphate co-precipitation, electroporation, or liposome mediated-, DEAE dextran mediated-, polycationic mediated-, or viral mediated transfection.
- the present invention provides pharmaceutical compositions, comprising
- the AdB-2/3 fiber multimer can be any such multimer as described herein according to any aspect, embodiment, or combination of embodiments of the invention that incorporates a mutant knob domain polypeptide of any embodiment of the first aspect of the invention (i.e.: SEQ ID NOS: l-l l).
- the pharmaceutical composition may further comprise one or more therapeutic for treating a disorder associated with epithelial tissue, including but not limited to those disclosed above.
- the therapeutic is an anti-tumor therapeutic and comprises a chemotherapeutic or anti-tumor monoclonal antibody as described herein.
- the anti-tumor therapeutic comprises an antibody selected from the group consisting of trastuzumab, cetumiximab, petuzumab, Apomab, conatumumab, lexatumumab, bevacizumab, bevacizumab, denosumab, zanolimumab, lintuzumab, edrecolomab, rituximab, ticilimumab, tositumomab, alemtuzumab, epratuzumab,
- panitumumab panitumumab, catumaxomab, ofatumumab, and ibritumomab.
- the pharmaceutically acceptable carrier is non-toxic, biocompatible and is selected so as not to detrimentally affect the biological activity of the multimers (and any other therapeutic agents combined therewith).
- Exemplary pharmaceutically acceptable carriers for peptides are described in U.S. Patent No. 5,211,657 to Yamada.
- the compositions may be formulated into preparations in solid, semi-solid, gel, liquid or gaseous forms such as tablets, capsules, powders, granules, ointments, solutions, suppositories, inhalants, and injections, allowing for oral, parenteral, or surgical administration.
- Suitable carriers for parenteral delivery via injectable, infusion, or irrigation and topical delivery include distilled water, physiological phosphate-buffered saline, normal or lactated Ringer's solutions, dextrose solution, Hank's solution, or propanediol.
- sterile, fixed oils may be employed as a solvent or suspending medium.
- any biocompatible oil may be employed including synthetic mono- or diglycerides.
- fatty acids such as oleic acid, find use in the preparation of injectables.
- the carrier and agent may be compounded as a liquid, suspension, polymerizable or non-polymerizable gel, paste or salve.
- the carrier may also comprise a delivery vehicle to sustain (i.e., extend, delay, or regulate) the delivery of the agent(s) or to enhance the delivery, uptake, stability, or pharmacokinetics of the therapeutic agent(s).
- a delivery vehicle may include, by way of non-limiting example,
- microparticles, microspheres, nanospheres, or nanoparticles composed of proteins, liposomes, carbohydrates, synthetic organic compounds, inorganic compounds, polymeric or copolymeric hydrogels, and polymeric micelles.
- Suitable hydrogel and micelle delivery systems include the PEO:PHB:PEO copolymers and copolymer/cyclodextrin complexes disclosed in International Publication No. WO 2004/009664 A2, and the PEO and
- Such hydrogels may be injected locally at the site of intended action, or subcutaneous ly or intramuscularly to form a sustained release depot.
- compositions for intrathecal (IT) or intracerebroventricular (ICV) delivery, appropriately sterile delivery systems (e.g., liquids; gels, suspensions, etc.) can be used to administer the compositions.
- the compositions may be carried in an inert filler or diluent such as sucrose, cornstarch, or cellulose.
- the compositions of the present invention may also include biocompatible excipients, such as dispersing or wetting agents, suspending agents, diluents, buffers, penetration enhancers, emulsifiers, binders, thickeners, flavoring agents (for oral administration).
- Exemplary formulations can be parenterally administered as injectable dosages of a solution or suspension of the multimer in a physiologically acceptable diluent with a pharmaceutical carrier that can be a sterile liquid such as water, oils, saline, glycerol, or ethanol.
- a pharmaceutical carrier that can be a sterile liquid such as water, oils, saline, glycerol, or ethanol.
- auxiliary substances such as wetting or emulsifying agents, surfactants, pH buffering substances and the like can be present in compositions comprising modified polypeptides.
- Additional components of pharmaceutical compositions include petroleum (such as of animal, vegetable, or synthetic origin), for example, soybean oil and mineral oil.
- glycols such as propylene glycol or polyethylene glycol are preferred liquid carriers for injectable solutions.
- the pharmaceutical composition can also be administered in the form of a depot injection or implant preparation that can be formulated in such a manner as to permit a sustained or pulsatile release of the multimers and other therapeutic (if present).
- the pharmaceutical composition may comprise in addition to t e polypeptide of the invention (a) a. lyoprotectant; (b) a surfactant; (c) a bulking agent; (d) a tonicity adjusting agent; (e) a stabilizer; (f) a preservative and/or (g) a buffer.
- the buffer in the pharmaceutical composition is a Tris buffer, a histidine buffer, a phosphate buffer, a citrate buffer or an acetate buffer.
- the pharmaceutical composition may also include a lyoprotectant, e.g. sucrose, sorbitol or trehalose.
- the pharmaceutical composition includes a preservative e.g. benzaikonium chloride, benzethonium,
- the pharmaceutical composition includes a bulking agent, like glycine.
- the pharmaceutical composition includes a surfactant e.g., polysorbate-20, polysorbate-40, polysorbate- 60, polysorbate-65, polysorbate-80 polysorbate-85, poloxarner-188, sorbitan monolaurate, sorbitan monopalmiiate, sorbitan monostearate, sorbitan monooieate, sorbitan trilaurate, sorbitan tristearate, sorbitan trioleaste, or a combination thereof.
- the pharmaceutical composition may also include a. tonicity adjusting agent, e.g., a compound that renders the formulation substantially isotonic or isoosmotic with human blood.
- Exemplary tonicity adjusting agents include sucrose, sorbitol, glycine, methionine, mannitol, dextrose, inositol, sodium chloride, arginine and arginine hydrochloride.
- the pharmaceutical composition additionally includes a stabilizer, e.g., a molecule which, when combined with a protein of interest substantially prevents or reduces chemical and/or physical instability of the protein of interest in lyophilized or liquid form.
- Exemplary stabilizers include sucrose, sorbitol, glycine, inositol, sodium chloride, methionine, arginine, and arginine hydrochloride.
- the pharmaceutical composition can be packaged in any suitable manner.
- the pharmaceutical composition is packaged as a kit containing a container (such as a vial) of the AdB-2/3 fiber multimer.
- the kit further comprises, in the same or a separate container (such as a vial), a therapeutic, diagnostic, or imaging agent to be administered to a subject, together with the AdB-2/3 fiber multimer.
- kits comprising (a) one or more recombinant polypeptides/ AdB-2/3 fiber multimers, isolated nucleic acids, recombinant expression vectors, and/or host cells of the invention; and (b) instructions for its/their use in treating a disorder associated with epithelial tissue.
- the kits may further comprise a therapeutic for use in the methods of the present invention.
- the present invention provides methods for enhancing therapeutic treatment, or diagnosis of a disorder associated with epithelial tissue, and/or imaging epithelial tissues, comprising administering to a subject in need thereof:
- the methods of this aspect of the invention can be used to enhancing therapeutic treatment, diagnosis, or imaging of a disorder associated with epithelial tissue by improving access for the therapeutic, diagnostic, and/or imaging agent to their target and dissemination in epithelial tissue. While not being bound by any mechanism, the inventors believe this occurs through complementary mechanisms: movement of the target receptor from the basolateral to the apical cell surface thus allowing better access to the epithelial tissue target by therapeutics, diagnostics, and/or imaging agents that target the receptor, such as monoclonal antibodies), and better penetration of the therapeutic through disruption of intercellular junctions.
- DSG2 is the primary high affinity receptor for AdB-2/3.
- DSG2 is a calcium-binding transmembrane glycoprotein belonging to the cadherin protein family.
- DSG2 is a component of the cell-cell adhesion structure. Its cytoplasmic tail interacts with a series of proteins that are in direct contact with regulators of cell adhesion and intercellular junctions/ cell morphology. It has been shown that DSG2 is overexpressed in a series of epithelial malignancies including gastric cancer, squamous cell carcinomas, melanoma, metastatic prostate cancer, and bladder cancer.
- AdB-2/3 fiber multimer binding to DSG2 serves to trigger transient DSG2-mediated opening of intercellular junctions, which serves to improve access of therapeutics, diagnostics, imaging agents, or any other compound of interest that binds to a target in epithelial cells that would otherwise be trapped to at least some extent in intercellular junctions.
- Detailed examples of such activity are provided herein.
- the methods of the invention can thus be carried out using any AdB-2/3 fiber multimer of the present invention to trigger transient DSG2 -mediated opening of intercellular junctions.
- Exemplary multimers comprising one or more AdB-2/3 fiber multimers of the invention that can be used in these methods include, but are not limited to, AdB-2/3 virions, AdB-2/3 capsids, AdB-2/3 dodecahedral particles (PtDd) (subviral dodecahedral particles produced by AdB-2/3 during their replication), and recombinant AdB-2/3 fiber multimers.
- AdB-2/3 virions AdB-2/3 capsids
- AdB-2/3 dodecahedral particles PtDd
- PtDd subviral dodecahedral particles produced by AdB-2/3 during their replication
- recombinant AdB-2/3 fiber multimers include, but are not limited to, AdB-2/3 virions, AdB-2/3 capsids, AdB-2/3 dodecahedral particles (PtDd) (subviral dodecahedral particles produced by AdB-2/3 during their replication), and recombinant AdB-2/3 fiber multimers.
- the methods of the invention have broad application for delivery of any therapeutic, diagnostic, imaging agent, or other compound to epithelial tissue comprising intercellular junctions where access to a target of interest can be limited, as DSG2 is widely expressed in epithelial cells.
- a "disorder associated with epithelial tissue" is any disorder wherein therapeutic, diagnostic, or imaging agent administered to/across epithelial cells/epithelial tissue provides a clinical benefit to a patient, whether in improving therapeutic, diagnostic, and/or imaging efficacy.
- Such disorders include, but are not limited to, solid tumors (i.e.: any tumor with epithelial cell junctions), gastrointestinal disorders (including but not limited to irritable bowel syndrome, inflammatory bowel disorder, Crohn's disease, ulcerative colitis, constipation, gastroesophageal reflux disease, Barrett's esophagus, etc.), skin diseases (including but not limited to psoriasis and dermatitis), lung disorders (including but not limited to chronic obstructive pulmonary disease, asthma, bronchitis, pulmonary emphysema, cystic fibrosis, interstitial lung disease, pneumonia, pancreatic duct disorders, brain disorders (ie: any brain disorder that could benefit from improved transport of drugs through the blood-brain barrier), primary pulmonary hypertension, pulmonary embolism, pulmonary sarcoidosis, tuberculosis, etc.), renal disorders,(including but not limited to glomerulonephritis), liver diseases (including but not limited to hepati
- the disorder associated with epithelial tissue comprises a solid tumor, including but not limited to breast tumors, lung tumors, colon tumors, rectal tumors, skin tumors, endocrine tumors, stomach tumors, prostate tumors, ovarian tumors, uterine tumors, cervical tumors, kidney tumors, melanomas, pancreatic tumors, liver tumors, brain tumors, head and neck tumors, nasopharyngeal tumors, gastric tumors, squamous cell carcinomas, adenocarcinomas, bladder tumors, and esophageal tumors.
- tumors include primary tumors, tumors that are locally invasive, as well as tumors that have metastasized.
- enhancing efficacy means any increase in therapeutic, diagnostic, and/or imaging efficacy over what would be seen using the therapeutic, diagnostic, and/or imaging agen alone.
- measurements of therapeutic efficacy will vary depending on the disorder being treated, but are readily identified by an attending physician.
- such increases in efficacy include, but are not limited to increasing one or more of the following relative to treatment with the therapeutic alone: (a) reducing the severity of the disorder; (b) limiting or preventing development of symptoms characteristic of the disorder(s) being treated; (c) inhibiting worsening of symptoms characteristic of the disorder(s) being treated; (d) limiting or preventing recurrence of the disorder(s) in patients that have previously had the disorder(s); and (e) limiting or preventing recurrence of symptoms in patients that were previously symptomatic for the disorder(s).
- treating a solid tumor provides an ability to induce egress of tumor receptors from the basolateral side of epithelial cells to enable improved access and killing of the tumor.
- tumor response which is determined by monitoring the change in tumor size or a serum marker of disease.
- a partial response is more than a 50% reduction in the tumor, while a complete response is defined as complete disappearance of the tumor.
- Methods used to measure tumors are well known to physicians and include physical examination, radiological testing such as CT scans, MRI, PET scans, X-rays as well as serum markers such as prostate specific antigen, which is used to monitor prostate cancer.
- Other measures of therapeutic efficacy of cancer treatment include measurements of time to progression, progression-free survival and overall survival.
- Improved diagnostic efficacy includes any improvement in efficacy compared to administration of the diagnostic alone, including but not limited to, increasing specificity and/or sensitivity of the diagnostic test.
- Improved imaging efficacy includes any
- the increase in efficacy is a 5%, 10%, 15%, 20%, 25%, 50%,
- Any suitable subject can be treated using the methods of the invention, preferably human subjects.
- the therapeutic is selected from the group consisting of antibodies, immunoconjugates, nanoparticles, nucleic acid therapeutics, and combinations thereof, chemotherapeutics, vaccines, radioactive particle/radiation therapy ("radiation"), cellular immunotherapy including adoptive T-cell therapy and dendritic cell therapy (example: intratumoral penetration of administered T-cells), inhaled therapeutics, gene therapy constructs (including but not limited to AdB-2/3 virus as a gene therapy vector, and co-administration with an Ad5-based gene therapy vector), other nucleic acid therapeutics, and combinations thereof.
- the therapeutic is selected from the group consisting of antibodies, immunoconjugates, nanoparticles, nucleic acid therapeutics, and combinations thereof, chemotherapeutics, vaccines, radioactive particle/radiation therapy ("radiation"), cellular immunotherapy including adoptive T-cell therapy and dendritic cell therapy (example: intratumoral penetration of administered T-cells), inhaled therapeutics, gene therapy constructs (including but not limited to AdB
- the therapeutic is selected from the group consisting of alkylating agents, angiogenesis inhibitors, antibodies, antimetabolites, antimitotics, antiproliferatives, aurora kinase inhibitors, apoptosis promoters (for example, Bcl-xL, Bcl-w and Bfl-1) inhibitors, activators of death receptor pathway, Bcr-Abl kinase inhibitors, BiTE (Bi-Specific T cell Engager) antibodies, biologic response modifiers, cyclin-dependent kinase inhibitors, cell cycle inhibitors, cyclooxygenase-2 inhibitors, growth factor inhibitors, heat shock protein (HSP)-90 inhibitors, demethylating agents, histone deacetylase (HDAC) inhibitors, hormonal therapies, immunologicals, inhibitors of apoptosis proteins (IAPs) intercalating antibiotics, kinase inhibitors, mammalian target of rapamycin inhibitors, microRNA's mitogen-activated extra
- Exemplary therapeutics falling within these various classes include, but are not limited to: docetaxel, doxorubicin, irinotecan, paclitaxel (Taxol®), paclitaxel albumin bound particles (Abraxane®), doxorubicin HCL liposome (Doxil®), BiTE antibodies such as adecatumumab (Micromet MT201), blinatumomab (Micromet MT103) and the like, siRNA- based therapeutics, alkylating agents including altretamine, AMD-473, AP-5280, apaziquone, bendamustine, brostallicin, busulfan, carboquone, carmustine (BCNU), chlorambucil, CLORETAZINE.® (laromustine, V P 40101M), cyclophosphamide, dacarbazine, decitabine, 5'-azacytidine, estramustine, fotemustine, glufosf
- Bcl-2 protein inhibitors including AT-101 ((-)gossypol), GENASENSE® (G3139 or oblimersen (Bcl-2-targeting antisense oligonucleotide)), IPI-194, IPI-565, N-(4-(4-((4'-chloro(l, l'- biphenyl)-2-y
- geldanamycin IPI-504, KOS-953, MYCOGRAB® (human recombinant antibody to HSP- 90), NCS-683664, PU24FC1, PU-3, radicicol, SNX-21 12, STA-9090 VER49009 and the like; activators of death receptor pathways including TRAIL, antibodies or other agents that target TRAIL or death receptors (e.g., DR4 and DR5) such as Apomab, conatumumab, ETR2-ST01, GDC0145, (lexatumumab), HGS-1029, LBY-135, PRO-1762 and trastuzumab; platinum chemotherapeutics include cisplatin, ELOXATIN® (oxaliplatin) eptaplatin, lobaplatin, nedaplatin, PARAPLATTN® (carboplatin), satraplatin, picoplatin and the like; VEGFR inhibitors including AVASTTN® (bevaci
- NEXAVAR® (sorafenib, BAY43-9006), pazopanib (GW-786034), vatalanib (PTK-787, ZK- 222584), SUTENT® (sunitinib, SU- 11248), VEGF trap, ZACTIMAThi (vandetanib, ZD- 6474) and the like; dendritic cell therapy (sipuleucel-T, Provenge®); topoisomerase inhibitors including aclarubicin, 9-aminocamptothecin, amonafide, amsacrine, becatecarin, belotecan, BN-80915, CAMPTOSAR® (irinotecan hydrochloride), camptothecin, dexrazoxine, diflomotecan, edotecarin, ELLENCE® or PHARMORUBICI ® (epirubicin), etoposide, exatecan, abraxane,
- AVASTIN® bevacizumab
- CD40-specific antibodies chTNT-l/B, denosumab
- ERBITUX® cetuximab
- hormonal therapies including ARIMIDEX® (anastrozole), AROMASIN® (exemestane), arzoxifene, CASODEX® (bicalutamide), CETROTIDE® (cetrorelix), degarelix, deslorelin, DESOPAN® (trilostane), dexamethasone, DROGENIL® (flutamide), EVISTA®
- alemtuzumab CTLA4 (cytotoxic lymphocyte antigen 4), decarbazine, denileukin, epratuzumab, GRANOCYTE® (lenograstim), lentinan, leukocyte alpha interferon, imiquimod, MDX-010 (anti-CTLA-4), melanoma vaccine, mitumomab, molgramostim, MYLOTARG.TM.
- pyrimidine analogs include cytarabine (ara C or Arabinoside C), cytosine arabinoside, doxifluridine, FLUDARA® (fludarabine), 5-FU (5-fluorouracil), floxuridine, GEMZAR® (gemcitabine), TOMUDEX® (ratitrexed), TROXATYL® (triacetyluridine troxacitabine) and the like;
- purine analogs including LANVIS® (thioguanine) and PURI-NETHOL® (mercaptopurine).
- antimitotic agents including batabulin, epothilone D (KOS-862), N-(2-((4- hydroxyphenyl)amino)pyridin-3-yl)-4-methoxybenzenesulfonamide, ixabepilone (BMS 247550), paclitaxel, TAXOTERE® (docetaxel), PNU100940 (109881), patupilone, XRP- 9881 (larotaxel), vinflunine, ZK-EPO (synthetic epothilone) and the like; and other chemotherapeutic agents such as ABRAXANE® (ABI-007), ABT-100 (farnesyl transferase inhibitor), ADVEXIN® (Ad5CMV-p53 vaccine), ALTOCOR® or MEVACOR®
- DAB(389)EGF catalytic and translocation domains of diphtheria toxin fused via a His-Ala linker to human epidermal growth factor
- TransMID-107R® diphtheria toxins
- dacarbazine dactinomycin, 5,6-dimethylxanthenone-4-acetic acid (DMXAA), eniluracil, EVIZON.TM. (squalamine lactate), DIMERICINE® (T4N5 liposome lotion),
- discodermolide DX-8951f (exatecan mesylate), enzastaurin, EPO906 (epithilone B), GARDASIL® (quadrivalent human papillomavirus (Types 6, 11, 16, 18) recombinant vaccine), GASTRIMMUNE®, GENASENSE®, GMK (ganglioside conjugate vaccine), GVAX® (prostate cancer vaccine), halofuginone, histerelin, hydroxycarbamide, ibandronic acid, IGN-101, IL-13-PE38, IL-13-PE38QQR (cintredekin besudotox), IL-13-pseudomonas exotoxin, interferon-.
- OVAREX® MAb murine monoclonal antibody
- paclitaxel PANDIMEX® (aglycone saponins from ginseng comprising 20(S)protopanaxadiol (aPPD) and 20(S)protopanaxatriol (aPPT)), panitumumab, PANVAC®-VF (investigational cancer vaccine), pegaspargase, PEG Interferon A, phenoxodiol, procarbazine, rebimastat,
- REMOVAB® catumaxomab
- REVLIMID® laenalidomide
- RSR13 efaproxiral
- SOMATULINE® LA lanreotide
- SORIATANE® acitretin
- staurosporine Streptomyces staurospores
- talabostat PT100
- TARGRETIN® bexarotene
- TAXOPREXI ® DHA- paclitaxel
- TELCYTA® canfosfamide, TLK286), temilifene, TEMODAR®
- TNFERADE® adenovector: DNA carrier containing the gene for tumor necrosis factor-. alpha.
- TRACLEER® or ZAVESCA® (bosentan), tretinoin (Retin-A), tetrandrine, TRISENOX®. (arsenic trioxide), VIRULIZIN®, ukrain (derivative of alkaloids from the greater celandine plant), vitaxin (anti-alphavbeta3 antibody), XCYTRIN® (motexafin gadolinium), XTNLAY® (atrasentan), XYOTAX® (paclitaxel poliglumex), YONDELIS® (trabectedin), ZD-6126, ZINECARD® (dexrazoxane), ZOMETA® (zolendronic acid), crizotmifo, zorubicin and the like.
- the therapeutic comprises a compound that binds to desmoglein-2; preferably a compound that binds to DSG2 and opens up tight junctions.
- the therapeutic comprises radioactive particles/radiation therapy.
- Any suitable radioactive therapy or particle can be used as deemed appropriate by an attending physician, including but not limited to cobalt-60, iodine- 131, iridium- 192, strontium-89, samarium 153, rhenium-186 and lead-212.
- the therapeutic is an anti-tumor therapeutic and comprises a chemotherapeutic or anti-tumor monoclonal antibody as described herein.
- the anti-tumor therapeutic comprises an antibody selected from the group consisting of trastuzumab, cetumiximab, petuzumab, apomab, conatumumab, lexatumumab, bevacizumab, bevacizumab, denosumab, zanolimumab, lintuzumab, edrecolomab, rituximab, ticilimumab, tositumomab, alemtuzumab, epratuzumab, mitumomab, gemtuzumab ozogamicin, oregovomab, pemtumomab daclizumab,
- panitumumab panitumumab, catumaxomab, ofatumumab, and ibritumomab.
- useful anti-tumor mAb and their specific uses are listed in Table 1 above, and as further described in Campoli, M., et al, Principles & Practice of Oncology 23(1&2): 1-19 (2009), incorporated herein by reference.
- the monoclonal antibody therapeutics can be any type of monoclonal antibody, including but not limited to standard monoclonal antibodies, humanized monoclonals, fully human antibodies generated from mice or other sources,chimeric monoclonals, and fragments thereof.
- “Humanized monoclonal antibodies” refers to monoclonal antibodies derived from a non-human monoclonal antibody, such as a mouse monoclonal antibody.
- humanized monoclonal antibodies can be derived from chimeric antibodies that retain, or substantially retain, the antigen-binding properties of the parental, non-human, monoclonal antibodies but which exhibit diminished immunogenicity as compared to the parental monoclonal antibody when administered to humans.
- chimeric monoclonal antibodies can comprise human and murine antibody fragments, generally human constant and mouse variable regions.
- Humanized monoclonal antibodies can be prepared using a variety of methods known in the art, including but not limited to (1) grafting complementarity determining regions from a non-human monoclonal antibody onto a human framework and constant region ("humanizing"), and (2) transplanting the non-human monoclonal antibody variable domains, but "cloaking" them with a human-like surface by replacement of surface residues ("veneering"). These methods are disclosed, for example, in, e.g., Jones et al, Nature 321 :522-525 (1986); Morrison et al, Proc. Natl. Acad.
- Monoclonal antibodies can be fragmented using conventional techniques, and the fragments screened for utility in the same manner as for whole antibodies. For example, F(ab3 ⁇ 4 fragments can be generated by treating antibody with pepsin.
- the resulting F(ab3 ⁇ 4 fragment can be treated to reduce disulfide bridges to produce Fab' fragments.
- Fab fragments can be obtained by treating an IgG antibody with papain; F(ab') fragments can be obtained with pepsin digestion of IgG antibody.
- a F(ab') fragment also can be produced by binding Fab' described below via a thioether bond or a disulfide bond.
- a Fab' fragment is an antibody fragment obtained by cutting a disulfide bond of the hinge region of the F(ab')2.
- a Fab' fragment can be obtained by treating a F(ab')2 fragment with a reducing agent, such as dithiothreitol.
- Antibody fragment peptides can also be generated by expression of nucleic acids encoding such peptides in recombinant cells (see, e.g., Evans et al, J. Immunol. Meth. 184: 123-38 (1995)).
- a chimeric gene encoding a portion of a F(ab')2 fragment can include DNA sequences encoding the CHI domain and hinge region of the H chain, followed by a translational stop codon to yield such a truncated antibody fragment molecule.
- Non-limiting examples of monoclonal antibody fragments include (i) a Fab fragment, a monovalent fragment consisting essentially of the VL, VH, CL and CH I domains; (ii) F(ab)2 and F(ab')2 fragments, bivalent fragments comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting essentially of the VH and CHI domains; (iv) a Fv fragment consisting essentially of the VL and VH domains of a single arm of an antibody, (v) a dAb fragment (Ward et al, (1989) Nature 341 :544-546), which consists essentially of a VH domain; and (vi) one or more isolated CDRs or a functional paratope.
- a Fab fragment a monovalent fragment consisting essentially of the VL, VH, CL and CH I domains
- the disorder comprises a Her-2 positive tumor
- the method comprises co-administering the AdB-2/3 fiber multimer of the invention together with suitable monoclonal antibody therapy, alone or in combination with a chemotherapeutic, radiation, or combinations thereof.
- the monoclonal antibody is trastuzumab.
- the Her-2 positive tumor is selected from the group consisting of a breast tumor, a gastric tumor, a colon tumor, and an ovarian tumor.
- the method is carried out on patients who have not responded adequately to trastuzumab, such as by lack of tumor remission, by tumor relapse, or by development of resistance to trastuzumab.
- the methods of these embodiments can also be used to help reduce the dosage of trastuzumab required to obtain therapeutic efficacy, and can thus serve to limit side effects (such as trastuzumab-associated cardiotoxicity).
- the disorder comprises an EGFR-positive tumor
- the method comprises co-administering the AdB-2/3 fiber multimer together with suitable monoclonal antibody therapy, alone or in combination with a chemotherapeutic, radiation, or combinations thereof.
- the monoclonal antibody is cetuximab.
- the EGFR-positive tumor is selected from the group consisting of a lung tumor, a colon tumor, a breast tumor, a rectal tumor, a head and neck tumor, and a pancreatic tumor.
- the method is carried out on patients who have not responded adequately to cetuximab, such as by lack of tumor remission, by tumor relapse, or by development of resistance to cetuximab.
- the methods of these embodiments can also be used to help reduce the dosage of cetuximab required to obtain therapeutic efficacy, and can thus serve to limit side effects (such as acne-like rashes that often occur during cetuximab therapy).
- the disorder comprises an epithelial tumor
- the method comprises co-administering the AdB-2/3 fiber multimer together with a vascular endothelial growth factor (VEGF) inhibitor, alone or in combination with other chemotherapeutic, radiation, or combinations thereof.
- VEGF vascular endothelial growth factor
- Any suitable VEGF inhibitor can be used, including but not limited to bevacizumab.
- the methods involving solid tumors further comprise administering a compound capable of degrading tumor stroma proteins.
- a compound capable of degrading tumor stroma proteins can be used, including but not limited to relaxin, collagenase, trypsin, dispase, MMP(metalloproteinase)-l, and MMP8. Delivery of such compounds can be by any suitable mechanism, including gene therapy, separate
- the methods further comprise administering the AdB-2/3 multimer in combination with other junction openers.
- a "junction opener” is a compound capable of transiently opening intercellular junctions. Any suitable junction openers can be used.
- the junction opener comprises Zona occludens toxin (Zot), a Vibrio cholerae (V. cholerae)-produced toxin that possess the ability to reversibly alter intestinal epithelial junctions, allowing the passage of macromolecules through mucosal barriers (Fasano et al. (1991) Proc Natl Acad Sci U S A 88: 5242-5246)].
- a Zot-derived hexapeptide (AT- 1001) has been developed.
- Clostridium perfringens enterotoxin removes claudins-3 and -4 from the tight junctions to facilitate bacterial invasion (Sonoda , et al. (1999) J Cell Biol 147: 195-204.].
- oncoproteins encoded by human Ad, HPV, HTLV-1 can transiently open epithelial junctions by mislocalizing the junction protein ZO-1 ( Latorre IJ, et al. (2005) J Cell Sci 1 18: 4283-4293) .
- several human viruses engage tight junction or other cell junction molecules to achieve entry into epithelial cells.
- viruses are hepatitis C virus (Evans MJ, et al. (2007) Nature 446: 801-805) , reovirus (Barton ES, et al. (2001) Cell 104: 441-451) , and herpes simplex virus (
- the therapeutic is an inhaled therapeutic.
- Any suitable inhaled therapeutic can be used in the methods of the invention.
- the inhaled therapeutic is selected from the group consisting of corticosteroids, bronchodilators, beta agonists, anticholinergics, albuterol (PROVENTIL®; VENOLIN®; ACCUNEB®; PROAIR®), levalbuterol (XOPENEX®), pirbutrol (MAXAIR®), ipratropium bromide (ATROVENT®), beclomethasone, budesonide, flunisolide (AEROBID®), fluticasone, triamcinolone acetonide, fluticasone (a corticosteroid) and salmeterol
- ADVAIR ⁇ formotorol (a long-acting, beta-agonist broncliodi later) and budesonide (a corticosteroid) (SYMJCORT®).
- albuterol a beta agonist
- ipratropium COMBIVENT®; an anticholinergic
- budesonide PULMICORT RESPULES ⁇
- tiopropiiim a corticosteroid
- the compound comprises a diagnostic or imaging agent.
- the methods of the invention have broad application for delivery of any diagnostic, imaging agent, or other compound to epithelial tissue comprising intercellular junctions where access to a target of interest can be limited.
- the imaging agents can include any chemical compound that can produce a detectable signal, either directly or indirectly. Many such imaging agents are known to those of skill in the art.
- imaging agents suitable for use in the disclosed methods and compositions are radioactive isotopes, fluorescent molecules, magnetic particles (including nanoparticles), metal particles (including nanoparticles), phosphorescent molecules, enzymes, antibodies, ligands, and combinations thereof, while diagnostic agents may comprise a compound that is a diagnostic marker for a particular epithelial disorder bound to the such an imaging agent.
- diagnostic agents may comprise a compound that is a diagnostic marker for a particular epithelial disorder bound to the such an imaging agent.
- radioactive isotopes can be detected by scintillation counting or direct visualization; fluorescent molecules can be detected with fluorescent spectrophotometers; phosphorescent molecules can be detected with a spectrophotometer or directly visualized with a camera; enzymes can be detected by detection or visualization of the product of a reaction catalyzed by the enzyme; antibodies can be detected by detecting a secondary detection label coupled to the antibody.
- the imaging agent and/or diagnostic is one that can be used to detect a tumor, whether by direct tumor binding, or by coupling of the imaging or diagnostic agent with a compound that can bind the tumor.
- the imaging agents can comprise a fluorescent imaging agent
- diagnostic agents may comprise a compound that is a diagnostic marker for a particular epithelial disorder bound to the fluorescent imaging agent.
- a fluorescent imaging agent is any chemical moiety that has a detectable fluorescence signal. This imaging agent can be used alone or in combination with other imaging agents.
- fluorescent agents include, but are not limited to, fluorescein (FITC), 5-carboxyfluorescein-N-hydroxysuccinimide ester, 5,6-carboxymethyl fluorescein, nitrobenz-2-oxa-l,3-diazol-4-yl ( BD), fluorescamine, OP A, NDA, indocyanine green dye, the cyanine dyes (e.g., Cy3, Cy3.5, Cy5, Cy5.5 and Cy7), 4-acetamido-4'- isothiocyanatostilbene-2,2'disulfonic acid, acridine, acridine isothiocyanate, 5-(2'- aminoethyl)aminonaphthalene-l -sulfonic acid (EDANS), 4-amino-N-[3- vinylsulfonyl)phenylinaphthalimide-3 ,5 disulfonate, N-(4-anil
- isothiocyanate sulforhodamine B, sulforhodamine 101, sulfonyl chloride derivative of sulforhodamine 101 (Texas Red), N,N,N',N'-tetramethyl-6-carboxyrhodamine (TAMRA), tetramethyl rhodamine, tetramethyl rhodamine isothiocyanate (TRITC), riboflavin, rosolic acid, coumarin-6, and the like, including combinations thereof.
- TAMRA N,N,N',N'-tetramethyl-6-carboxyrhodamine
- TRITC tetramethyl rhodamine
- riboflavin rosolic acid
- coumarin-6 and the like, including combinations thereof.
- the imaging agents can comprise a Magnetic Resonance Imaging (MRI) agent
- diagnostic agents may comprise a compound that is a diagnostic marker for a particular epithelial disorder bound to the MRI agent.
- a MRI agent is any chemical moiety that has a detectable magnetic resonance signal or that can influence (e.g., increase or shift) the magnetic resonance signal of another agent. This type of imaging agent can be used alone or in combination with other imaging agent.
- a gadolinium- based MRI agent can serve as an imaging agent.
- An example of a suitable MRI agent that can be incorporated into the disclosed imaging agents is para-amino-benzyl
- diethylenetriaminepentaacetic acid p-NH2-Bz-DTPA, Compound 7
- DTPA conjugable form of diethylenetriaminepentaacetic acid
- Incorporation of an MRI agent on a large macromolecule such as a dendrimeric substrate as disclosed herein can allow large Tl relaxation (high contrast) and multiple copies of agent on a single molecule, which can increase signal.
- an MRI imaging agent and, for example, a fluorescent imaging agent the resulting agent can be detected, imaged, and followed in real-time via MR I.
- imaging agents include PET agents that can be prepared by incorporating an 18F or a chelator for 64Cu or 68Ga. Also, addition of a radionuclide can be used to facilitate SPECT imaging or delivery of a radiation dose, while diagnostic agents may comprise a compound that is a diagnostic marker for a particular epithelial disorder bound to the PET agent.
- the diagnostic agent is a diagnostic imaging agent, including but not limited to position emission tomography (PET) agents, computerized tomography (CT) agents, magnetic resonance imaging (MRI) agents, nuclear magnetic imaging agents (NMI), fluoroscopy agents and ultrasound contrast agents.
- PET position emission tomography
- CT computerized tomography
- MRI magnetic resonance imaging
- NMI nuclear magnetic imaging agents
- fluoroscopy agents fluoroscopy agents and ultrasound contrast agents.
- Such diagnostic agents include radioisotopes of such elements as iodine (I), including I, I, I etc., barium (Ba), gadolinium (Gd), technetium (Tc), including 99 Tc, phosphorus (P), including 31 P, iron (Fe), manganese (Mn), thallium (Tl), chromium (Cr), including 51 Cr, carbon (C), including 14 C, or the like, fluorescently labeled compounds, or their complexes, chelates, adducts and conjugates.
- PET agents including but not limited to carbon- 1 1, nitrogen-13, oxygen-15, fluorine- 18, 11 C-metomidate, and glucose analogues thereof, including but not limited to fludeoxyglucose (a glucose analog labeled with fluorine- 18.
- the diagnostic agent is a marker gene that encode proteins that are readily detectable when expressed in a cell (including, but not limited to, beta- galactosidase, green fluorescent protein, luciferase, and the like) and labeled nucleic acid probes (e.g., radiolabeled or fluorescently labeled probes).
- covalent conjugation of diagnostics agents to the AdB-2/3 multimers provided herein is achieved according to a variety of conjugation processes.
- the diagnostic agent is non-covalently associated with AdB-2/3 multimers provided
- the present invention provides methods for improving delivery of a substance to an epithelial tissue, comprising contacting the epithelial tissue with (a) one or more compound to be delivered to the epithelial tissue; and (b) an amount of an AdB-2/3 fiber multimer of the invention sufficient to enhance delivery of the one or more compounds to the epithelial tissue.
- the compounds may be any suitable compound such as those described in detail above.
- the one or more compounds comprise an imaging agent.
- the epithelial tissue comprises a solid tumor, including any of those disclosed in the present application.
- the solid tumor is selected from the group consisting of breast tumors, lung tumors, colon tumors, rectal tumors, stomach tumors, prostate tumors, ovarian tumors, uterine tumors, skin tumors, endocrine tumors, cervical tumors, kidney tumors, melanomas, pancreatic tumors, liver tumors, brain tumors, head and neck tumors, nasopharyngeal tumors, gastric tumors, squamous cell carcinomas, adenocarcinomas, bladder tumors, and esophageal tumors.
- Exemplary multimers comprising one or more AdB-2/3 fiber multimers of the invention that can be used in these methods include, but are not limited to, AdB-2/3 virions, AdB-2/3 capsids, AdB-2/3 dodecahedral particles (PtDd) (subviral dodecahedral particles produced by AdB-2/3 during their replication), and recombinant AdB-2/3 fiber multimers.
- AdB-2/3 virions AdB-2/3 capsids
- AdB-2/3 dodecahedral particles PtDd
- PtDd subviral dodecahedral particles produced by AdB-2/3 during their replication
- recombinant AdB-2/3 fiber multimers include, but are not limited to, AdB-2/3 virions, AdB-2/3 capsids, AdB-2/3 dodecahedral particles (PtDd) (subviral dodecahedral particles produced by AdB-2/3 during their replication), and recombinant AdB-2/3 fiber multimers.
- the present invention provides methods for improving delivery of a substance cell or tissue expressing desmoglein 2 (DSG2), comprising contacting the cell or tissue expressing DSG2 with (a) one or more compound to be delivered to the cell or tissue; and (b) an amount of an AdB-2/3 fiber multimer of the invention sufficient to enhance delivery of the one or more compounds to the tissue.
- tissue types expressing DSG2 include, but are not limited to epithelial cells/tissue (such as those disclosed herein), human platelets and granulocytes. As shown in the examples that follow, DSG2 also acts as receptor in non-polarized cells.
- AdB-2/3 pathogenesis find application not only in epithelial cells and tissue, but also are relevant, for example, in AdB-2/3 pathogenesis and the intravascular application of AdB-2/3 vectors for gene therapy purposes.
- exemplary multimers comprising one or more AdB-2/3 fiber multimers of the invention that can be used in these methods include, but are not limited to, AdB-2/3 virions, AdB-2/3 capsids, AdB-2/3 dodecahedral particles (PtDd) (subviral dodecahedral particles produced by AdB-2/3 during their replication), and recombinant AdB-2/3 fiber multimers.
- the present invention provides methods for inducing an epithelial to mesenchymal transition (EMT) in a tissue, comprising contacting the epithelial tissue with an amount of an AdB-2/3 fiber multimer of the invention sufficient to induce EMT.
- EMT is a cellular transdifferentiation program where epithelial cells lose
- AdB-2/3 fiber multimers of the invention that can be used in these methods include, but are not limited to, AdB-2/3 virions, AdB-2/3 capsids, AdB-2/3 dodecahedral particles (PtDd) (subviral dodecahedral particles produced by AdB-2/3 during their replication), and recombinant AdB-2/3 fiber multimers.
- the therapeutic, diagnostic, and/or imaging agent can be administered together with the AdB-2/3 multimer (such as via the compositions of the invention disclosed above) or may be administered separately.
- the therapeutic and AdB-2/3 multimer are attached, via any suitable covalent or non-covalent binding.
- an AbB-2/3 multimer can attached to a toxin or other drug to kill solid tumor cells.
- the AdB-2/3 fiber multimer and/or therapeutic can be administered in any way deemed suitable by an attending physician, depending on whether a local or systemic mode of administration is most appropriate for the condition being treated.
- systemic delivery and “systemic administration” are intended to include, but are not limited to, oral and parenteral routes including intramuscular (IM), subcutaneous, intravenous (IV), intra-arterial, inhalational, sublingual, buccal, topical, transdermal, nasal, rectal, vaginal, and other routes of administration that effectively result in dispersement of the delivered agent to a single or multiple sites of intended therapeutic action.
- Preferred routes of systemic delivery for the present compositions include intravenous, intramuscular, subcutaneous, and inhalational.
- intravenous administration is used, such as for treatment of disseminated tumors (and for monoclonal antibody delivery).
- oral delivery may be preferred, for example, for treating
- GI gastrointestinal epithelial disorders
- nasal or aerosol delivery may be preferred for delivery to the lungs, such as for lung epithelial disorders.
- the AdB-2/3 fiber multimer may be introduced in association with another molecule, such as a lipid or liposome to protect the polypeptides from enzymatic degradation.
- a lipid or liposome to protect the polypeptides from enzymatic degradation.
- polymers especially polyethylene glycol (PEG)
- PEG polyethylene glycol
- the AdB-2/3 fiber multimer and/or therapeutic may be systemically administered on a periodic basis at intervals determined to maintain a desired level of therapeutic effect. For example, administration by intravenous injection may be once per day, once per week, every two to four weeks or at less frequent intervals.
- the dosage regimen will be determined by the physician considering various factors that may influence the action of the combination of agents. These factors will include the extent of progress of the condition being treated, the patient's age, sex and weight, and other clinical factors.
- the dosage for AdB-2/3 fiber multimer and/or therapeutic will vary as a function of the multimer and/or therapeutic being administered, as well as the presence and nature of any drug delivery vehicle (e.g., a sustained release delivery vehicle).
- the dosage quantity may be adjusted to account for variation in the frequency of administration and the pharmacokinetic behavior of the delivered agent(s).
- Dosage ranges of AdB-2/3 fiber multimers will generally range between 0.01 and 250 mg/kg, preferably between 0.1 and 10 mg/kg, and more preferably between 0.10 to 0.5 mg/kg. Dosages of approved therapeutics are readily identifiable by medical practitioners. The therapeutic may also be able to be administered at a reduced dose due to enhanced penetration into epithelial tissues, such as cancers.
- the AdB-2/3 fiber multimer may be administered to the subject before,
- administration of the therapeutic and the AdB-2/3 fiber multimer are carried out at the same time.
- the timing of administrations of the therapeutic relative to the AdB-2/3 fiber multimer can be varied to achieve the greatest therapeutic effect.
- the therapeutic is administered at a time to ensure its contact with the transient opening of the intercellular junction caused by AdB-2/3 fiber multimer binding to DSG2.
- the therapeutic can be administered prior to, simultaneously with, after each administration of the AdB-2/3 fiber multimer.
- the therapeutic can be administered after the administration of the AdB-2/3 fiber multimer, for example up to 5 minutes, 10 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 8 hours, 10 hours, 12 hours, 18 hours, 24 hours, 30 hours, 36 hours, 40 hours, 42 hours, 48 hours, 54 hours, 60 hours, 66 hours, 72 hours, 78 hours, 84 hours, 90 hours, or even up to 96 hours after the administration of the AdB-2/3 fiber multimer.
- the present invention provides methods for treating a disorder associated with epithelial tissue, comprising administering to a subject in need thereof an amount of an AdB-2/3 fiber multimer of the invention sufficient to treat the disorder. In this embodiment, no other therapeutic is delivered.
- the present invention provides methods for treating a disorder associated with epithelial tissue, comprising administering to a subject in need thereof an amount of an AdB-2/3 fiber multimer of the invention sufficient to treat the disorder. In this embodiment, no other therapeutic is delivered.
- the present invention provides methods for treating a disorder associated with epithelial tissue, comprising administering to a subject in need thereof an amount of an AdB-2/3 fiber multimer of the invention sufficient to treat the disorder. In this embodiment, no other therapeutic is delivered.
- the present invention provides methods for treating a disorder associated with epithelial tissue, comprising administering to a subject in need thereof an amount of an AdB-2/3 fiber multimer of the invention sufficient to treat the disorder. In this embodiment, no other therapeutic is delivered.
- the present invention provides methods for treating a disorder
- the method comprises improving access of immune system cells to the site of the disorder, such as by penetration (such as intratumoral penetration of pre-existing natural killer cells, T-cells or dendritic cells).
- the method can also be used to treat any of the disorders associated with epithelial cells discussed above that can benefit from improved access of cells of the immune system to the target epithelial cells.
- the disorder is a solid tumor, and the method comprises improving immune system attack of the tumor. The method can be used with any of the solid tumors discussed above.
- AdB-2/3 fiber multimers of the invention that can be used in these methods include, but are not limited to, AdB-2/3 virions, AdB-2/3 capsids, AdB-2/3 dodecahedral particles (PtDd) (subviral dodecahedral particles produced by AdB-2/3 during their replication), and recombinant AdB- 2/3 fiber multimers.
- the present invention provides method for identifying candidate compounds for one or more of treating a disorder associated with epithelial tissue, improving delivery of a substance to an epithelial tissue, for improving delivery of a substance tissue expressing DSG2, inducing an EMT in a tissue, and/or treating an AdB-2/3 infection
- DSG2 are candidate compounds for transiently opening intracellular junctions through their interaction with DSG2.
- Follow-up assays to verify the ability of the compounds to transiently open intracellular junctions through their interaction with DSG2 can be carried out by any suitable methods, including but not limited to studies disclosed in the examples that follow.
- Compounds so identified for treating a disorder associated with epithelial tissue, improving delivery of a substance to an epithelial tissue, improving delivery of a substance tissue expressing DSG2, or inducing an EMT in a tissue can be used as substitutes for the AdB-2/3 multimer in any of the methods of the present invention.
- AdB-2/3 represent important human pathogens causing respiratory tract infections (some sever) and pharyngoconjunctival fever.
- DSG2 as the primary high-affinity receptor used by AdB-2/3, and thus compounds that can diminish AdB-2/3 binding to DSG2 are candidate compounds for treating or limiting development of AdB-2/3 infection.
- Exemplary multimers comprising one or more AdB-2/3 fiber multimers of the invention that can be used in these methods include, but are not limited to, AdB-2/3 virions, AdB-2/3 capsids, AdB-2/3 dodecahedral particles (PtDd) (subviral dodecahedral particles produced by AdB-2/3 during their replication), and recombinant AdB-2/3 fiber multimers.
- AdB-2/3 virions AdB-2/3 capsids
- AdB-2/3 dodecahedral particles PtDd
- Any suitable control can be used, including but not limited to an AdB-2/3 multimer binding to DSG2 in the absence of test compounds,
- the DSG comprises recombinant DSG2.
- the methods use cells expressing DSG2 (endogenously or recombinantly) on the cell surface.
- surface plasmon resonance (SPR) studies using sensors containing immobilized recombinant DSG2 can be used to identify candidate compounds that AdB-2/3 fiber multimer binding to DSG2, combined with DSG2 competition studies.
- the identifying comprises transduction studies, where the ability of test compounds to diminish binding is detected as a decrease in the ability of functional AdB-2/3 virions to transduce DSG2-expressing epithelial cells.
- DSG2-expressing cell extract is electrophoretically separated and Western blotted, and labeled AdB-2/3 fiber multimer is used to probe the Western blot in the presence of the test compounds.
- dot-blot assays can be used, such as those described in Wang et al, J. Virology (2007) 81 : 12785-12792; and Wang et al. (2008) 82: 10567-10579.
- test compounds comprise polypeptide sequences
- polypeptides may be chemically synthesized or recombinantly expressed.
- Recombinant expression can be accomplished using standard methods in the art, as disclosed above.
- Such expression vectors can comprise bacterial or viral expression vectors, and such host cells can be prokaryotic or eukaryotic.
- Synthetic polypeptides prepared using the well-known techniques of solid phase, liquid phase, or peptide condensation techniques, or any combination thereof, can include natural and unnatural amino acids.
- Amino acids used for peptide synthesis may be standard Boc (Na-amino protected Na-t-butyloxycarbonyl) amino acid resin with standard
- Fmoc 9-fluorenylmethoxycarbonyl
- Both Fmoc and Boc Na-amino protected amino acids can be obtained from Sigma, Cambridge Research Biochemical, or other chemical companies familiar to those skilled in the art.
- the polypeptides can be synthesized with other Na-protecting groups that are familiar to those skilled in this art. Solid phase peptide synthesis may be accomplished by techniques familiar to those in the art and provided, such as by using automated synthesizers.
- test compounds comprise antibodies
- such antibodies can be polyclonal or monoclonal.
- the antibodies can be humanized, fully human, or murine forms of the antibodies.
- Such antibodies can be made by well-known methods, such as described in Harlow and Lane, Antibodies; A Laboratory Manual, Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y., (1988).
- nucleic acids may be chemically synthesized or recombinantly expressed as well. Recombinant expression techniques are well known to those in the art (See, for example, Sambrook, et al, 1989, supra).
- the nucleic acids may be DNA or R A, and may be single stranded or double.
- nucleic acids can be chemically or enzymatically synthesized by manual or automated reactions, using standard techniques in the art. If synthesized chemically or by in vitro enzymatic synthesis, the nucleic acid may be purified prior to introduction into the cell.
- the nucleic acids can be purified from a mixture by extraction with a solvent or resin, precipitation, electrophoresis, chromatography, or a combination thereof.
- the nucleic acids may be used with no or a minimum of purification to avoid losses due to sample processing.
- test compounds comprise compounds other than polypeptides, antibodies, or nucleic acids
- such compounds can be made by any of the variety of methods in the art for conducting organic chemical synthesis. Examples. Structural and functional studies on the interaction of adenovirus fiber knob domains and desmoglein 2.
- Ad Human adenovirus serotypes Ad3, Ad7, Adl 1, Adl4, and a recently emerged new strain of Adl4 (Adl4pl) use the epithelial junction protein desmoglein 2 (DSG2) as a receptor for infection. Unlike Ad interaction with CAR and CD46, structural details for Ad binding to DSG2 are still elusive.
- DSG2 epithelial junction protein desmoglein 2
- Using an approach based on E.coli expression libraries of random Ad3 and Adl4pl fiber knob mutants we identified amino acid residues that, when mutated individually, ablated or reduced Ad knob binding to DSG2. These residues formed three clusters inside one groove at the extreme distal end of the fiber knob. The Ad3 fiber knob mutant library was also used to identify variants with increased affinity to DSG2.
- DSG2 as the main receptor for a group of species B adenoviruses, including adenovirus serotype 3 (Ad3), a serotype which is widely distributed in the human population (42).
- Ad3 adenovirus serotype 3
- Ad3 adenovirus serotype 3
- Ad3 adenovirus serotype 3
- This specific mode of Ad3 -fiber knob-DSG2 interaction provides a high avidity and is functionally relevant for opening of epithelial junctions (41, 42).
- the latter involves clustering of DSG2 and activation of pathways that are reminiscent of an epithelial-to-mesenchymal transition, including the phosphorylation of MAP kinase and the downregulation of junction protein expression (6, 40, 42).
- the first goal of the present study was to further delineate structural features of the
- Ad3 fiber knob-DSG2 interaction This included identifying the amino acid residues within the Ad3 fiber knob that are involved in binding to DSG2 and creating JO-1 mutants with reduced and ablated binding to DSG2.
- the second goal of this study which has translational relevance, was to further improve JO-1 by enhancing its affinity to DSG2 thereby increasing its therapeutic effect. This was done by identifying mutants with increased binding to DSG2.
- the third goal of this study was to delineate the DSG2 interacting fiber knob residues of another DSG2 -targeting Ad serotype; the newly emerged strain Adl4pl (44), which is considered more pathogenic/virulent than the parental strain (Adl4-deWit) (10, 16, 22).
- Adl4pl the newly emerged strain
- Adl4-deWit the parental strain
- the beta sheet distribution of Adl4pl differs from that of Ad3, which could potentially result in differences in the mode of DSG2 binding.
- Recombinant human DSG2 protein was from Leinco Technologies, Inc. (St. Louis, MO).
- the Ad3 fiber knob was derived from Ad3 virus, GB strain, obtained from the ATCC.
- the Adl4pl fiber knob is derived from Adl4pl virus, strain Portland 2971/2007, provided by the Center for Disease Control and Prevention (Atlanta, GA) (44).
- the fiber knobs were produced in E. coli with N-terminal 6-His tags, using the pQE30 expression vector (Qiagen, Valencia, CA) and purified by Ni-NTA agarose chromatography as described elsewhere (43).
- Colon cancer T84 cells (ATCC CCL-248) were cultured in a 1 : 1 mixture of Ham's F12 medium and DMEM, 10% FBS, Glu and P/S.
- Ovc316 cells are Her2/neu positive epithelial tumor cells derived from an ovarian cancer biopsy (32).
- Ovc316 cells were cultured in MEGM (Lonza, Mapleton, IL) ⁇ containing 3 ⁇ hEGF, 5 ⁇ g/L insulin, 5mg/L hydrocortisone, 26mg/L bovine pituitary extract, 25mg/L amphotericin B) (Lonza), supplemented with 1% FBS, 100 I.U. penicillin, 100 ⁇ g/L streptomycin, lOmg/L ciprofloxacin.
- MDA-MB-231 cells, a triple-negative breast cancer cell line (ATCC-HTB-26) were cultured in Leibovitz's L-15 medium supplemented with 10% FBS, 100 I.U. penicillin, 100 ⁇ g/L streptomycin.
- TC1-DSG2 were derived from TCI cells, a C57B1/6 lung cancer cell line that expresses HPV16 E6 and E7 (36). TCI cells were transduced with a VSVG-pseudotyped lentivirus vector expressing human DSG2 (42). A clone that expressed human DSG2 at a level seen in human tumors was selected for in vivo studies.
- Ad3-GFP is a wild-type Ad3- based vector containing a CMV-GFP expression cassette inserted into the E3 region (42).
- Viral particle (VP) concentrations were determined spectrophotometrically by measuring the optical density at 260 nm (OD 2 6o). Titers of plaque forming units (pfu) were performed using 293 cells as described elsewhere (29). The VP to pfu ratio was 20: 1 for all virus preparations.
- Ad3 knob library The coding sequence of the Ad3 knob (aa 108-319) containing the last two shaft repeats was obtained by PCR from Ad3 DNA using primers PI : 5'
- the mutant PCR products (615bp in length containing mutations only in the reading frame of fiber knob head) were purified, digested with appropriate enzymes, and cloned into the plasmid pQE-Ad3knob.
- the ligation product was transformed into E.coti Ml 5 (Qiagen, Valencia, CA), plated on kanamycin and ampicillin plates, and 50 colonies were randomly picked for sequencing.
- Adl4 library The coding sequence of the Adl4pl knob (aa 108-323) containing the last two shaft repeats was obtained by PCR from Adl4pl DNA using primers PI : 5'
- the resulting plasmid was called pQE-Adl4plknob.
- Random mutagenic PCR was performed by using PCR primers (Pmutl : 5'- AACACCCTGTGGACAGGAGTTAACCC -3' and Pmut2: 5'- CTCAGCTAATTAAGCTTAGTCGTC -3').
- the mutant PCR products (594bp in length containing mutations only in the reading frame of fiber knob head) were purified, digested with appropriate enzymes, and cloned into the plasmid pQE-Adl4plknob.
- the ligation product was transformed into E.coli Ml 5 (Qiagen, Valencia, CA), plated on kanamycin and ampicillin plates, and 50 colonies were randomly picked for sequencing.
- the Ad3 or Adl4pl knob mutant plasmid library were transformed into XL1 Blue or M15 E.coli host strains and plated on LB plates with appropriate antibiotics, i.e, Amp or Amp+Kan, respectively. After overnight growth, a 0.45 ⁇ Durapore filter membrane (Millipore, Billerica, MA) was placed on top of the colonies. The membrane was peeled off and placed carefully, with the colonies facing upwards, on two sheets of 3MM paper soaked in LB medium supplemented with antibiotics and ImM IPTG.
- Protein expression of the colonies was induced for 6 hours at 30°C, after which the filter with the colonies was placed on top of a nitrocellulose filter and a Whatman 3MM paper soaked in native lysis buffer ⁇ 20 mM Tris-Cl (pH8), 300 mM NaCl, 50 mM MgCl 2 , 0.1 mg/ml lysozyme, 0.75 mg/ml DNAse I, 1 ⁇ 2 complete EDTA-free protease inhibitor cocktail tablet/10ml (Roche, Palo Alto, CA) ⁇ .
- the "filter sandwich” was incubated at room temperature for 10 min and then freeze-thawed 4 times for 10 min at -80 °C and 10 min at 30 °C.
- nitrocellulose membrane was removed from the sandwich and blocked with 3% BSA in TBST at 4°C overnight.
- the blot was then incubated with 0.1 ng/ml of recombinant DSG2 protein (Leinco, St.Louis, MO) in TBST/BSA, followed by mouse monoclonal anti-DSG2 antibodies (Clone 6D8; SeroTec Ltd., Oxford, UK) and anti-mouse IgG horseradish peroxidase conjugate. Colonies without DSG2 binding were picked and cultured in 3 ml LB medium overnight. Protein expression was induced with 1 mM IPTG for 5 hours, the bacteria were then pelleted, resuspended in SDS loading buffer and freeze/thawed 3 times.
- the Western blots were scanned and quantified using the ImageJ 1.32 software (National Institutes of Health, Bethesda, MD). JO-1 band intensity was set as 100%.
- MAP kinase activity polarized T84 cultures were lysed in 20mM Hepes (pH 7.5), 2mM EGTA, 10% glycerol, 1% Triton lOO, lmM PMSF, 200 ⁇ Na 3 V0 4 and protease inhibitors) on ice. After sonication, samples were pelleted and protein containing supernatant stored at -80°C.
- HeLa cells were detached from culture dishes by incubation with Versene and washed with PBS. A total of 10 5 cells per tube were resuspended in 50 ⁇ of ice- cold adhesion buffer (DMEM supplemented with 2 mM MgCl 2 , 1% FBS, and 20 mM
- HEPES HEPES containing different concentrations of Ad3 fiber knob protein, and incubated on ice for 1 hour. Then, 3 H-labeled wild-type Ad3 virus was added in adhesion buffer at a multiplicity of infection (MOI) of 8,000 viral particles (vp) per cell to a final volume of 100 ⁇ . After lh of incubation on ice, cells were pelleted and washed twice with 0.5 ml of ice-cold PBS. After the last wash, the supernatant was removed and the cell-associated radioactivity was determined by a scintillation counter. The number of VP bound per cell was calculated by using the virion specific radioactivity and the number of cells.
- MOI multiplicity of infection
- vp viral particles
- Ad3 fiber knob proteins Different concentrations of Ad3 fiber knob proteins were injected for 3 minutes association followed by 2.5 minutes dissociation time, and the signal was automatically subtracted from the background of the ethanolamine deactivated EDC-NHS flow cell. Kinetic and affinity constants were calculated using the BIAeval software.
- Crystallography Crystallization conditions for wtAd3 and K217E/F224S knob mutants were using the service of the High Throughput Screening Lab at Hauptman
- 3D structure Pymol software was used to analyze structure. Mutations in the Ad3 knob domain (pdb 1H7Z) were stained using different colors on the purple isosurface.
- Negative-stain electron microscopy Recombinant JO-2 protein was visualized by negative-stain EM to assess its assembly status. The standard mica-carbon preparation was used with protein at 0.1 mg/ml. Sample was stained using 1% (wt/vol) sodium silicotungstate (pH 7.0) and visualized on a JEOL-1200 electron microscope at 100 kV.
- TEER trans epithelial electrical resistance
- mice All experiments involving animals were conducted in accordance with the institutional guidelines set forth by the University of Washington. Mice were housed in specific -pathogen- free facilities. Immunodeflcient (CB17) mice /strain name: NOD.CB17- Prkdc scl /J] were obtained from the Jackson Laboratory. Human DSG2 transgenic mice contain 90kb of the human DSG2 locus and express hDSG2 at a level and in a pattern similar to humans (40).
- A549, MDA-MB-231, and ovc316 xenograft tumors were established by injection of the corresponding tumor cells into the mammary fat pad (1 : 1 with Matrigel) of CB 17 mice.
- TC 1 - DSG2 tumors were established by subcutaneous injection of TC1-DSG2 cells into DSG2 transgenic mice.
- JO-0, JO-1, JO-2, or JO-4 were intravenously injected one hour before the application of chemotherapeutic drugs: Irinotecan/CamptosarTM (Pfizer Inc., Groton, CT), PEGylated liposomal doxorubicin/LipodoxTM (Sun Pharmaceuticals IN, India),
- cetuximab/ErbituxTM (ImClone, Somerville, NJ), nanoparticle albumin conjugated paclitaxel/Abraxane iIvi (Abraxis Biosciences, Summit, NJ). Tumor volumes were measured three times a week. Each treatment group consisted of a minimum of 5 mice. Animals were sacrificed and the experiment terminated when tumors in one of the groups reached a volume of 800 mm 3 or tumors displayed ulceration.
- Anti-J04 antibodies anti-JO-4 antibody concentrations in human serum samples were measured by ELISA. Plates will be coated with rabbit polyclonal anti-Ad3 fiber antibodies (42), followed by recombinant JO-4, human serum samples (1 :2 to 1 : 1000 dilution), and anti-human IgG-HRP. Serum samples from ovarian cancer patients were provided by the Pacific Ovarian Cancer Research Consortium.
- 3D structure Pymol software was used to visualize the 3D structure of the Ad3 fiber knob (MMDB ID: 16945, PDB ID: 1H7Z (13))
- Ad3 knob monomer Recombinant (trimeric) fiber knob with two shaft motifs, but without the dimerization domain
- Ad3 knob monomer binds to DSG2 with an affinity that is orders of magnitude less than JO- 1 , is not able to block Ad3 infection, and does not trigger junction opening (37, 41, 42).
- the affinity of "Ad3 knob monomer” is high enough to detect binding in Western blots in which soluble DSG2 is used as a probe.
- an Ad3 virus with maximum ablation of DSG2 binding we introduced multiple mutations in the three identified areas, specifically a combination of N186D and D261N, a combination of D261N and L296R, and a combination of all three N186D, D261N, and L296R.
- the combination of mutations in all three critical regions conferred the highest level of ablation (Table 2,"Western Blot), Fig. IF).
- Table 2 Analysis of Ad3 fiber mutants.
- the second column shows the quantitative analysis of Western blot bands corresponding to Ad3 knob trimers. The intensity of the wt Ad3 fiber knob was taken as 100%.
- the data in the third column reflect the ability of dimeric Ad3 fiber knob mutants to inhibit Ad3-GFP infection (see Fig.3B). The higher the percentage, the stronger the inhibition. Inhibition by JO-1 (dimeric wtAd3 knob) is taken as 100%.
- Adl4pl fiber knob mutants Because of its relevance as a recently emerged pathogen, we also generated a library of ("monomeric") Adl4pl fiber knob mutants. A first screening revealed -300 candidate colonies for variants that did not bind to DSG2. When analyzed by Western blot for the 6xHis tag, 45 of the 300 colonies showed expression of trimeric fiber knob. Sequencing of these variants revealed 15 independent mutants with reduced binding to DSG2 (Fig. lA). Interestingly, in spite of a different beta sheet distribution, the amino-acid residues that were critical for Adl4pl knob binding were in the same three regions that were indentified for the Ad3 fiber knob. Because of these similarities, we performed the further studies only with selected Ad3 fiber knob mutants. Functional validation.
- Ad3-GFP infection was least reduced by pre-incubation with mutants D261N and F265L, followed by mutants N186D, S190P, L296R, and V189G. Taking the DSG2 binding (Western blot), attachment, and infection competition data together, we concluded that the area containing residues 261 to 265 is the most critical area in DSG2 binding. The region around residues 186-190 also contributes to binding, while the region containing residue 299 appears to be only marginally involved in binding.
- Dimeric Ad3 knob mutants with combined mutations were also analyzed for their ability to compete with Ad3 virus for attachment (Fig.3C) and infection (Fig.3D).
- the mutant with mutations in all three areas did not block Ad3 binding or infection even at concentrations of 200ug/ml indicating that is nearly ablated for DSG2 binding.
- sCD46 as a probe in the Western blot of wild-type Ad3 fibers, no specific binding was observed (Fig.4). This indicates that Ad3 only inefficiently binds to CD46. Correlation of reduced DSG2 binding and weaker ability to open epithelial junctions.
- a straightforward assay for the junction opening function of dimeric Ad3 knob mutants is based on measuring the transepithelial electrical resistance (TEER) in transwell cell cultures. Epithelial cancer cells are cultured until the TEER is constant, when major intercellular junctions are formed. Addition of JO-1 for 1 hour to the apical side of the transwell cultures resulted in a rapid decrease in the TEER indicating opening of junctions (Fig.5A). Incubation with mutant D261N had no effect on the TEER. N186D and E299V had intermediate effects that correlated with the residual binding of the corresponding fiber knobs to DSG2.
- TEER transepithelial electrical resistance
- Affinity enhanced dimeric Adi fiber knobs As outlined above, JO-1 is relevant for cancer therapy. It is therefore important to better understand structural details of its interaction with DSG2 and create JO-1 mutants with increased affinity to DSG2. Affinity enhancement of biologies is used to: i) decrease their effective dose, ii) increase their half- lives, Hi) potentially increase their therapeutic effects, and iv) circumvent the adverse effects of antibodies generated by patients against the biologic (e.g. neutralization or changes to the pharmokinetics). To make JO-1 analogues with increased affinity, we screened the E.coli expression library with random mutations within JO-1 for variants with increased binding to DSG2.
- wt Ad3 knob (noDD) binding to DSG2 is mostly limited by a slow association rate that can be improved by a panel of mutations. These mutations do not appear to modify the stability of this interaction but the balance of association versus dissociation, resulting in higher affinities of ligands to the receptor.
- the K217E/F224S mutant formed a monotrimer of fiber knobs (Fig.8E).
- the 3D structure of the mutant was overlaid with that of the wild-type Ad3 fiber knob (Fig.8F-H). This revealed that the EF loop in the K217E/F224S mutant was completely disordered. This loop is at the base of the knob domain at the junction with the fiber shaft.
- the K217E/F224S mutations may therefore allow for easier binding by increasing the flexibility of this loop region.
- ovc316 cells that is positive for Nanog, CD133, and E- cadherin is enriched for cancer stem cells, i.e. self-renewing cells with pluripotent potential and tumor forming ability (30). Ovc316 cells therefore closely model the heterogeneity and plasticity seen in tumors in situ.
- PLD PEGylated liposomal doxorubicin
- TNBC triple-negative breast cancer
- mice were subcutaneously implanted with syngeneic TCl-hDSG tumors. When tumors reached a volume of ⁇ 600mm 3 , JO-1 or JO-4 was intravenously injected for safety and efficacy studies. Both JO-1 and JO-4 serum
- Lymphocyte and platelet counts reached a nadir at 24 hours p.i. with significantly lower numbers for JO-4 (p ⁇ 0.01). Interestingly lymphocyte and platelet counts returned to normal levels faster in JO-4 injected mice than in JO-1 treated animals.
- JO-1 and JO-4 are virus-derived proteins and immunogenic. In immunocompetent mice, serum IgG antibodies against these proteins can be detected by ELISA two weeks after injection (5). One of theoretical premises for affinity enhancement of therapeutic proteins is that it circumvents neutralizing serum antibodies.
- DSG2 Mutagenic analysis of DSG2 was not possible because, when expressed in E.coli, the protein did not bind to Ad3, indicating that post-translational processing is required to create active Ad3 binding sites within DSG2 (data not shown).
- the identified residues, critical for Ad3 knob binding to DSG2 were in three different areas of the Ad3 fiber knob and formed a potential binding pocket localized in a groove at the distal end of the fiber knob, facing the receptor.
- binding of other Ad serotypes to CAR or CD46 primarily involves regions at the lateral or basal side of the corresponding fiber knobs (27, 43).
- Our data indicate that Ad3 uses a different binding strategy. We are currently performing crystallography studies with dimeric Ad3 fiber knobs and DSG2.
- Adl4 is an important research object because of the recent appearance of a new strain (Adl4pl). None previously documented in the United States, Adl4pl was first reported in March and April 2006 during routine surveillance at several U.S. military-recruit training centers (26). During March - June of the following year, a total of 140 additional cases of confirmed HAdV-B14pl respiratory illness were reported in patients in Oregon, Washington and Texas (3). Thirty eight percent of these patients were hospitalized, including 17% who were admitted to intensive care units; 5% of patients died.
- Adl4pl fiber knob mutant library did not support this hypothesis.
- the areas involved in DSG2 binding were essentially the same for Ad3 and Adl4pl fiber knobs. Nevertheless, our finding are relevant for the treatment of Adl4pl viremia, specifally for the production of Adl4pl inhibitors or high affinity decoys that can trigger the opsonization of virus present in the blood circulation or airway.
- Ad3 can use CD46 as a receptor to infect cells if DSG2 is absent (35).
- DSG2 is trapped in tight junctions and not accessible from the apical side, while CD46 is present on both membrane sides (42).
- CD46 can serve as a relatively inefficient entry receptor for Ad3, while de novo produced Ad3 and Ad3 penton- dodecahedra interact with DSG2, open epithelial junctions and allow for efficient lateral spread of Ad3 or penetration into deeper tissue layers and blood circulation.
- the ability to individually ablate the Ad3 knob residues that are critical for DSG2 and CD46 binding, respectively, should make it possible to prove this hypothesis.
- Ad3 knobs with higher affinity than the wt Ad3 knob has implications for Ad3-mediated gene therapy.
- gene transfer vectors based on Ad3 have shown promise for cancer therapy in clinical trials (18).
- affinity enhanced Ad3 vectors could be used at lower doses and outcompete neutralizing antibodies.
- affinity-enhanced versions of JO-1 have translational relevance.
- Most solid tumors are of epithelial origin and, although malignant cells are dedifferentiated, they maintain intercellular junctions, a key feature of epithelial cells, both in the primary tumor as well as in metastatic lesions (5, 31). These intercellular junctions represent a protection mechanism against attacks by the host immune system and pose physical barriers that prevent intratumoral penetration and dissemination of cancer therapeutics, including monoclonal antibodies and chemotherapy drugs (5, 31).
- JO-1 When injected intravenously into mice with xenograft or syngeneic DSG2 transgenic tumors, JO-1 markedly enhanced therapeutic effects with a variety of chemotherapy drugs as well as monoclonal antibodies (5, 6).
- Ad3-hTERT-ElA a Fully Serotype 3 Oncolytic Adenovirus, in Patients With Chemotherapy Refractory Cancer. Mol Ther 20: 1821-1830.
- Adenovirus type 1 1 binding alters the conformation of its receptor CD46. Nat Struct Mol Biol 14: 164-166.
- Desmoglein 2 is a receptor for adenovirus serotypes 3, 7, 1 1 and 14. Nat Med 17:96-104.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Epidemiology (AREA)
- Virology (AREA)
- Biochemistry (AREA)
- Gastroenterology & Hepatology (AREA)
- Diabetes (AREA)
- Pulmonology (AREA)
- Biophysics (AREA)
- Zoology (AREA)
- Microbiology (AREA)
- Immunology (AREA)
- Biomedical Technology (AREA)
- Wood Science & Technology (AREA)
- Endocrinology (AREA)
- Dermatology (AREA)
- Mycology (AREA)
- Oncology (AREA)
- Communicable Diseases (AREA)
- General Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- Toxicology (AREA)
- Peptides Or Proteins (AREA)
- Urology & Nephrology (AREA)
Priority Applications (28)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP13771350.9A EP2900818B1 (en) | 2012-09-25 | 2013-09-24 | Desmoglein 2 (dsg2) binding proteins and uses therefor |
| US14/429,705 US20150246949A1 (en) | 2012-09-25 | 2013-09-24 | Desmoglein 2 (DSG2) Binding Proteins and Uses Therefor |
| KR1020157010265A KR102175034B1 (ko) | 2012-09-25 | 2013-09-24 | 데스모글레인 2 (dsg2) 결합 단백질 및 그의 용도 |
| CN201380060698.XA CN105008535B (zh) | 2012-09-25 | 2013-09-24 | 桥粒芯糖蛋白2(dsg2)结合蛋白质及其用途 |
| AU2013323775A AU2013323775B2 (en) | 2012-09-25 | 2013-09-24 | Desmoglein 2 (DSG2) binding proteins and uses therefor |
| JP2015533277A JP6290221B2 (ja) | 2012-09-25 | 2013-09-24 | デスモグレイン2(dsg2)結合タンパク質およびその使用 |
| ES14783729.8T ES2638320T3 (es) | 2013-09-24 | 2014-09-24 | Proteínas de unión a desmogleina 2 (DSG2) y sus usos |
| MX2016003942A MX376324B (es) | 2013-09-24 | 2014-09-24 | Proteinas de union a desmogelina 2 (dsg2) y usos de los mismos. |
| KR1020167010310A KR20160056938A (ko) | 2013-09-24 | 2014-09-24 | 데스모글레인 2 (dsg2) 결합 단백질 및 그의 용도 |
| US14/429,803 US9688727B2 (en) | 2013-09-24 | 2014-09-24 | Desmoglein 2 (DSG2) binding proteins and uses therefor |
| AU2014326972A AU2014326972B2 (en) | 2013-09-24 | 2014-09-24 | Desmoglein 2 (DSG2) binding proteins and uses therefor |
| DK14783729.8T DK3049520T3 (en) | 2013-09-24 | 2014-09-24 | DESMOGLEIN 2 (DSG2) BINDING PROTEINS AND USES THEREOF |
| PCT/US2014/057139 WO2015048081A1 (en) | 2013-09-24 | 2014-09-24 | Desmoglein 2 (dsg2) binding proteins and uses therefor |
| KR1020217033840A KR20210129274A (ko) | 2013-09-24 | 2014-09-24 | 데스모글레인 2 (dsg2) 결합 단백질 및 그의 용도 |
| BR112016006564-6A BR112016006564B1 (pt) | 2013-09-24 | 2014-09-24 | Polipeptídeo de fibra adb-2/3 recombinante e composição farmacêutica |
| CN201480052830.7A CN107041146A (zh) | 2013-09-24 | 2014-09-24 | 桥粒芯糖蛋白2(dsg2)结合蛋白质及其用途 |
| EP14783729.8A EP3049520B1 (en) | 2013-09-24 | 2014-09-24 | Desmoglein 2 (dsg2) binding proteins and uses therefor |
| TW103133095A TWI647307B (zh) | 2013-09-24 | 2014-09-24 | 橋粒黏蛋白2(dsg2)之結合蛋白及其用途 |
| JP2016544353A JP2016538327A (ja) | 2013-09-24 | 2014-09-24 | デスモグレイン2(dsg2)結合タンパク質およびその使用 |
| RU2016110826A RU2685876C2 (ru) | 2013-09-24 | 2014-09-24 | Белки, связывающие десмоглеин 2 (dsg2), и их применение |
| HK16109477.5A HK1221262B (en) | 2013-09-24 | 2014-09-24 | Desmoglein 2 (dsg2) binding proteins and uses therefor |
| CA2925487A CA2925487C (en) | 2013-09-24 | 2014-09-24 | Desmoglein 2 (dsg2) binding proteins and uses therefore in treating disorders associated with epithelial tissues |
| IL244685A IL244685B (en) | 2013-09-24 | 2016-03-21 | Proteins that bind desmoglein 2 and their uses |
| US15/593,578 US10150798B2 (en) | 2013-09-24 | 2017-05-12 | Desmoglein 2 (DSG2) binding proteins and uses therefor |
| US16/206,448 US10611803B2 (en) | 2013-09-24 | 2018-11-30 | Desmoglein 2 (DSG2) binding proteins and uses therefor |
| US16/806,617 US11248028B2 (en) | 2013-09-24 | 2020-03-02 | Desmoglein 2 (DSG2) binding proteins and uses therefor |
| US17/559,391 US11820795B2 (en) | 2013-09-24 | 2021-12-22 | Desmoglein 2 (DSG2) binding proteins and uses therefor |
| US18/475,950 US12466859B2 (en) | 2013-09-24 | 2023-09-27 | Desmoglein 2 (DSG2) binding proteins and uses therefor |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201261705523P | 2012-09-25 | 2012-09-25 | |
| US61/705,523 | 2012-09-25 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US14/429,803 Continuation-In-Part US9688727B2 (en) | 2013-09-24 | 2014-09-24 | Desmoglein 2 (DSG2) binding proteins and uses therefor |
| PCT/US2014/057139 Continuation-In-Part WO2015048081A1 (en) | 2013-09-24 | 2014-09-24 | Desmoglein 2 (dsg2) binding proteins and uses therefor |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2014052322A1 true WO2014052322A1 (en) | 2014-04-03 |
Family
ID=49293927
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2013/061431 Ceased WO2014052322A1 (en) | 2012-09-25 | 2013-09-24 | Desmoglein 2 (dsg2) binding proteins and uses therefor |
Country Status (7)
| Country | Link |
|---|---|
| US (1) | US20150246949A1 (https=) |
| EP (1) | EP2900818B1 (https=) |
| JP (1) | JP6290221B2 (https=) |
| KR (1) | KR102175034B1 (https=) |
| CN (2) | CN105008535B (https=) |
| AU (1) | AU2013323775B2 (https=) |
| WO (1) | WO2014052322A1 (https=) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3464355A4 (en) * | 2016-06-06 | 2020-01-22 | Asclepiumm Taiwan Co., Ltd. | Dsg2 monoclonal antibody and use thereof |
Families Citing this family (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| SG11201507393TA (en) | 2013-03-14 | 2015-10-29 | Salk Inst For Biological Studi | Oncolytic adenovirus compositions |
| KR102608590B1 (ko) | 2014-09-24 | 2023-12-01 | 솔크 인스티튜트 포 바이올로지칼 스터디즈 | 종양 살상 바이러스 및 이의 사용방법 |
| WO2017147269A1 (en) | 2016-02-23 | 2017-08-31 | Salk Institute For Biological Studies | Exogenous gene expression in therapeutic adenovirus for minimal impact on viral kinetics |
| WO2017147265A1 (en) | 2016-02-23 | 2017-08-31 | Salk Institute For Biological Studies | High throughput assay for measuring adenovirus replication kinetics |
| JP7112753B2 (ja) * | 2016-06-06 | 2022-08-04 | アスクリピウム タイワン シーオー., エルティーディー. | Dsg2由来ペプチド |
| EP3532082A4 (en) | 2016-12-12 | 2020-08-26 | Salk Institute for Biological Studies | SYNTHETIC ADENOVIRUS TUMOR TARGETING AND THEIR USES |
| EP3743090A4 (en) * | 2018-01-25 | 2022-02-09 | Pai Life Sciences, Inc. | CONJUGABLE DESMOGLEIN 2 (DSG2)-BINDING PROTEINS AND USES THEREOF |
| CN112292449A (zh) | 2018-04-09 | 2021-01-29 | 萨克生物研究学院 | 具有增强的复制特性的溶瘤腺病毒组合物 |
| CN111879940B (zh) * | 2020-04-28 | 2022-02-01 | 中国科学院微生物研究所 | 肺结核标志物及应用 |
Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5211657A (en) | 1988-11-07 | 1993-05-18 | The United States Government As Represented By The Secretary Of The Department Of Health And Human Services | Laminin a chain deduced amino acid sequence, expression vectors and active synthetic peptides |
| US20020019369A1 (en) | 2000-05-19 | 2002-02-14 | Jun Li | Injectable drug delivery systems with cyclodextrin-polymer based hydrogels |
| WO2004009664A2 (en) | 2002-07-19 | 2004-01-29 | Omeros Corporation | Biodegradable triblock copolymers, synthesis methods therefor, and hydrogels and biomaterials made there from |
| US20040038924A1 (en) * | 2001-01-09 | 2004-02-26 | University Of Iowa Research Foundation | Adenovirus serotype 30 (Ad30) |
| WO2011156761A1 (en) | 2010-06-10 | 2011-12-15 | University Of Washington Through Its Center For Commercialization | Methods and systems for adenovirus interaction with desmoglein 2 (dsg2) |
Family Cites Families (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6455314B1 (en) * | 1998-09-11 | 2002-09-24 | Genvec, Inc. | Alternatively targeted adenovirus |
| AU783879B2 (en) * | 1999-11-25 | 2005-12-15 | Transgene S.A. | Modified adenovirus fibre and uses |
| WO2004063355A2 (en) * | 2003-01-10 | 2004-07-29 | Protein Design Labs, Inc. | Novel methods of diagnosis of metastatic cancer, compositions and methods of screening for modulators of matastatic cancer |
| CN101068933A (zh) * | 2004-08-25 | 2007-11-07 | 细胞基因系统有限公司 | 用于肿瘤细胞增强转导的纤维修饰的腺病毒载体 |
-
2013
- 2013-09-24 EP EP13771350.9A patent/EP2900818B1/en active Active
- 2013-09-24 AU AU2013323775A patent/AU2013323775B2/en active Active
- 2013-09-24 CN CN201380060698.XA patent/CN105008535B/zh active Active
- 2013-09-24 KR KR1020157010265A patent/KR102175034B1/ko active Active
- 2013-09-24 WO PCT/US2013/061431 patent/WO2014052322A1/en not_active Ceased
- 2013-09-24 US US14/429,705 patent/US20150246949A1/en not_active Abandoned
- 2013-09-24 CN CN201811167962.0A patent/CN109796524A/zh active Pending
- 2013-09-24 JP JP2015533277A patent/JP6290221B2/ja active Active
Patent Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5211657A (en) | 1988-11-07 | 1993-05-18 | The United States Government As Represented By The Secretary Of The Department Of Health And Human Services | Laminin a chain deduced amino acid sequence, expression vectors and active synthetic peptides |
| US20020019369A1 (en) | 2000-05-19 | 2002-02-14 | Jun Li | Injectable drug delivery systems with cyclodextrin-polymer based hydrogels |
| US20040038924A1 (en) * | 2001-01-09 | 2004-02-26 | University Of Iowa Research Foundation | Adenovirus serotype 30 (Ad30) |
| WO2004009664A2 (en) | 2002-07-19 | 2004-01-29 | Omeros Corporation | Biodegradable triblock copolymers, synthesis methods therefor, and hydrogels and biomaterials made there from |
| WO2011156761A1 (en) | 2010-06-10 | 2011-12-15 | University Of Washington Through Its Center For Commercialization | Methods and systems for adenovirus interaction with desmoglein 2 (dsg2) |
Non-Patent Citations (86)
| Title |
|---|
| "Acute respiratory disease associated with adenovirus serotype 14--four states, 2006-2007", MMWR MORB MORTAL WKLY REP, vol. 56, 2007, pages 1181 - 1184 |
| "Ambion 1998 Catalog", 1998, AMBION |
| "Gene Transfer and Expression Protocols", THE HUMANA PRESS INC., pages: 109 - 128 |
| "Methods in Enzymology", 1990, ACADEMIC PRESS, INC., article "Guide to Protein Purification" |
| "Methods in Enzymology", vol. 185, 1991, ACADEMIC PRESS, article "Gene Expression Technology" |
| "PCR Protocols: A Guide to Methods and Applications", 1990, ACADEMIC PRESS |
| ; MCBRIDE, A. ET AL., EMBO J, vol. 7, 1988, pages 533 - 539 |
| ADAMS, P. D.; P. V. AFONINE; G. BUNKOCZI; V. B. CHEN; I. W. DAVIS; N. ECHOLS; J. J. HEADD; L. W. HUNG; G. J. KAPRAL; R. W. GROSSE-: "PHENIX: a comprehensive Python-based system for macromolecular structure solution", ACTA CRYSTALLOGR D BIOL CRYSTALLOGR, vol. 66, 2010, pages 213 - 221 |
| BARAHMAND-POUR ET AL., CURR. TOP. MICROBIOL. IMMUNOL., vol. 211, 1996, pages 121 - 128 |
| BARTON ES ET AL., CELL, vol. 104, 2001, pages 441 - 451 |
| BELOUSOVA, N.; G. MIKHEEVA; J. GELOVANI; V. KRASNYKH: "Modification of adenovirus capsid with a designed protein ligand yields a gene vector targeted to a major molecular marker of cancer", JOURNAL OF VIROLOGY, vol. 82, 2008, pages 630 - 637 |
| BEWLEY, M. C.; K. SPRINGER; Y. B. ZHANG; P. FREIMUTH; J. M. FLANAGAN: "Structural analysis of the mechanism of adenovirus binding to its human cellular receptor, CAR", SCIENCE, vol. 286, 1999, pages 1579 - 1583 |
| BEYER, I.; H. CAO; J. PERSSON; H. SONG; M. RICHTER; Q. FENG; R. YUMUL; R. VAN RENSBURG; Z. LI; R. BERENSON: "Coadministration of epithelial junction opener JO-1 improves the efficacy and safety of chemotherapeutic drugs", CLIN CANCER RES, vol. 18, 2012, pages 3340 - 3351 |
| BEYER, I.; R. VAN RENSBURG; R. STRAUSS; Z. LI; H. WANG; J. PERSSON; R. YUMUL; Q. FENG; H. SONG; J. BARTEK: "Epithelial junction opener JO-1 improves monoclonal antibody therapy of cancer", CANCER RES, vol. 71, 2011, pages 7080 - 7090 |
| CADWELL, R. C.; G. F. JOYCE: "Mutagenic PCR", PCR METHODS APPL, vol. 3, 1994, pages 136 - 140 |
| CADWELL, R. C.; G. F. JOYCE: "Randomization of genes by PCR mutagenesis", PCR METHODS APPL, vol. 2, 1992, pages 28 - 33 |
| CAMPOLI, M. ET AL., PRINCIPLES & PRACTICE OF ONCOLOGY, vol. 23, no. 1&2, 2009, pages 1 - 19 |
| CAMPOS, S. K.; M. B. PARROTT; M. A. BARRY: "Avidin-based targeting and purification of a protein IX-modified, metabolically biotinylated adenoviral vector", MOL THER, vol. 9, 2004, pages 942 - 954 |
| CARR, M. J.; A. E. KAJON; X. LU; L. DUNFORD; P. O'REILLY; P. HOLDER; C. F. DE GASCUN; S. COUGHLAN; J. CONNELL; D. D. ERDMAN: "Deaths associated with human adenovirus- 14pl infections, Europe, 2009-2010", EMERG INFECT DIS, vol. 17, 2011, pages 1402 - 1408 |
| CUPELLI, K.; S. MULLER; B. D. PERSSON; M. JOST; N. ARNBERG; T. STEHLE: "Structure of adenovirus type 21 knob in complex with CD46 reveals key differences in receptor contacts among species B adenoviruses", J VIROL, vol. 84, 2010, pages 3189 - 3200 |
| CUPELLI, K.; T. STEHLE: "Viral attachment strategies: the many faces of adenoviruses.", CURR OPIN VIROL, vol. 1, 2011, pages 84 - 91 |
| DOSTATNI, N. ET AL., EMBO J, vol. 7, 1988, pages 3807 - 3816 |
| DURMORT, C.; C. STEHLIN; G. SCHOEHN; A. MITRAKI; E. DROUET; S. CUSACK; W. P. BURMEISTER: "Structure of the fiber head of Ad3, a non-CAR-binding serotype of adenovirus", VIROLOGY, vol. 285, 2001, pages 302 - 312, XP002395097, DOI: doi:10.1006/viro.2001.0967 |
| EMSLEY, P.; B. LOHKAMP; W. G. SCOTT; K. COWTAN: "Features and development of Coot", ACTA CRYSTALLOGR D BIOL CRYSTALLOGR, vol. 66, 2010, pages 486 - 501 |
| ESPOSITO, D. H.; T. J. GARDNER; E. SCHNEIDER; L. J. STOCKMAN; J. E. TATE; C. A. PANOZZO; C. L. ROBBINS; S. A. JENKERSON; L. THOMAS: "Outbreak of pneumonia associated with emergent human adenovirus serotype 14-- Southeast Alaska, 2008", J INFECT DIS, vol. 202, 2010, pages 214 - 222 |
| EVANS ET AL., J. IMMUNOL. METH., vol. 184, 1995, pages 123 - 38 |
| EVANS MJ ET AL., NATURE, vol. 446, 2007, pages 801 - 805 |
| FASANO ET AL., PROC NATL ACAD SCI USA, vol. 88, 1991, pages 5242 - 5246 |
| GERAGHTY RJ ET AL., SCIENCE, vol. 280, 1998, pages 1618 - 1620 |
| GIROUARD, G.; R. GARCEAU; L. THIBAULT; Y. OUSSEDIK; N. BASTIEN; Y. LI.: "denovirus serotype 14 infection, New Brunswick, Canada, 2011", EMERG INFECT DIS, vol. 19, 2013, pages 119 - 122 |
| HARLOW; LANE: "Antibodies; A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY |
| HASEGAWA, K.; C. HU; T. NAKAMURA; J. D. MARKS; S. J. RUSSELL; K. W. PENG: "Affinity thresholds for membrane fusion triggering by viral glycoproteins", JOURNAL OF VIROLOGY, vol. 81, 2007, pages 13149 - 13157, XP055000678, DOI: doi:10.1128/JVI.01415-07 |
| HAUGEN, T. ET AL., EMBO J, vol. 7, 1988, pages 4245 - 4253 |
| HEMMINKI, 0.; I. DIACONU; V. CERULLO; S. K. PESONEN; A. KANERVA; T. JOENSUU; K. KAIREMO; L. LAASONEN; K. PARTANEN; L. KANGASNIEMI: "Ad3-hTERT-EIA, a Fully Serotype 3 Oncolytic Adenovirus, in Patients With Chemotherapy Refractory Cancer", MOL THER, vol. 20, 2012, pages 1821 - 1830 |
| HO ET AL., NATURE, vol. 382, 1996, pages 822 - 826 |
| HONG; ENGLER, JOURNAL OF VIROLOGY, vol. 70, 1996, pages 7071 - 7078 |
| INCARDONA, M. F.; G. P. BOURENKOV; K. LEVIK; R. A. PIERITZ; A. N. POPOV; O. SVENSSON: "EDNA: a framework for plugin-based applications applied to X-ray experiment online data analysis", J SYNCHROTRON RADIAT, vol. 16, 2009, pages 872 - 879 |
| J.S. HONG; J.A. ENGLER, JOURNAL OF VIROLOGY, vol. 70, 1996, pages 7071 - 7078 |
| JONES ET AL., NATURE, vol. 321, 1986, pages 522 - 525 |
| KABSCH, W.: "Integration, scaling, space-group assignment and post-refinement", ACTA CRYSTALLOGR D BIOL CRYSTALLOGR, vol. 66, 2010, pages 133 - 144 |
| KABSCH, W.: "Xds.", ACTA CRYSTALLOGR D BIOL CRYSTALLOGR, vol. 66, 2010, pages 125 - 132 |
| KAJON, A. E.; X. LU; D. D. ERDMAN; J. LOUIE, D; SCHNURR, K. S. GEORGE; M. P. KOOPMANS; T. ALLIBHAI; D. METZGAR: "Molecular epidemiology and brief history of emerging adenovirus 14-associated respiratory disease in the United States", J INFECT DIS, vol. 202, 2010, pages 93 - 103 |
| KETTLEBOROUGH, C. A. ET AL., PROTEIN ENG, vol. 4, no. 7, 1991, pages 773 - 83 |
| KLEMM ET AL., ANNU. REV. IMMUNOL., vol. 16, 1998, pages 569 - 592 |
| LATORRE IJ ET AL., J CELL SCI, vol. 118, 2005, pages 4283 - 4293 |
| LEWIS, P. F.; M. A. SCHMIDT; X. LU; D. D. ERDMAN; M. CAMPBELL; A. THOMAS; P. R. CIESLAK; L. D. GRENZ; L. TSAKNARDIS; C. GLEAVES: "A community-based outbreak of severe respiratory illness caused by human adenovirus serotype 14", J INFECT DIS, vol. 199, 2009, pages 1427 - 1434 |
| LOUIE, J. K.; A. E. KAJON; M. HOLODNIY; L. GUARDIA-LABAR; B. LEE; A. M. PETRU; J. K. HACKER; D. P. SCHNURR: "Severe pneumonia due to adenovirus serotype 14: a new respiratory threat?", CLIN INFECT DIS, vol. 46, 2008, pages 421 - 425 |
| MCBRIDE, A. ET AL., PROC NATL ACAD SCI USA, vol. 86, 1989, pages 510 - 514 |
| MCCOY, A. J.; R. W. GROSSE-KUNSTLEVE; P. D. ADAMS; M. D. WINN; L. C. STORONI; R. J. READ: "Phaser crystallographic software", J APPL CRYSTALLOGR, vol. 40, 2007, pages 658 - 674 |
| METZGAR, D.; M. OSUNA; A. E. KAJON; A. W. HAWKSWORTH; M. IRVINE; K. L. RUSSELL: "Abrupt emergence of diverse species B adenoviruses at US military recruit training centers", THE JOURNAL OF INFECTIOUS DISEASES, vol. 196, 2007, pages 1465 - 1473, XP002534787, DOI: doi:10.1086/522970 |
| MORRISON ET AL., PROC. NATL. ACAD. SCI., U.S.A., vol. 81, 1984, pages 6851 - 6855 |
| MORRISON; OI, ADV. IMMUNOL., vol. 44, 1988, pages 65 - 92 |
| O'SHEA, SCIENCE, vol. 254, 1991, pages 539 |
| PACHE, L.; S. VENKATARAMAN; G. R. NEMEROW; V. S. REDDY: "Conservation of fiber structure and CD46 usage by subgroup B2 adenoviruses", VIROLOGY, vol. 375, 2008, pages 573 - 579, XP022665867, DOI: doi:10.1016/j.virol.2008.02.013 |
| PADLAN, MOLEC. IMMUN, vol. 28, 1991, pages 489 - 498 |
| PADLAN, MOLEC. IMMUNOL., vol. 31, no. 3, 1994, pages 169 - 217 |
| PERSSON, B. D.; D. M. REITER; M. MARTTILA; Y. F. MEI; J. M. CASASNOVAS; N. ARNBERG; T. STEHLE: "Adenovirus type 11 binding alters the conformation of its receptor CD46", NAT STRUCT MOL BIOL, vol. 14, 2007, pages 164 - 166 |
| POMERANZ ET AL., BIOCHEM., vol. 37, 1998, pages 965 |
| R.I. FRESHNEY: "Culture of Animal Cells: A Manual of Basic Technique", 1987, LISS, INC. |
| R.I. FRESHNEY: "Culture ofAnimal Cells: A Manual ofBasic Technique", 1987, LISS, INC. |
| RANKI TUULI ET AL: "Serotype Chimeric Human Adenoviruses for Cancer Gene Therapy", VIRUSES-BASEL, vol. 2, no. 10, October 2010 (2010-10-01), pages 2196 - 2212, XP002718814, ISSN: 1999-4915 * |
| SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS |
| SAMBROOK; FRITSCH; MANIATIS: "Molecular Cloning, A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS |
| SHAYAKHMETOV, D. M.; T. PAPAYANNOPOULOU; G. STAMATOYANNOPOULOS; A. LIEBER: "Efficient gene transfer into human CD34(+) cells by a retargeted adenovirus vector", J VIROL, vol. 74, 2000, pages 2567 - 2583, XP002157424, DOI: doi:10.1128/JVI.74.6.2567-2583.2000 |
| SONODA N ET AL., J CELL BIOL, vol. 147, 1999, pages 195 - 204 |
| STRAUSS, R.; A. LIEBER: "Anatomical and physical barriers to tumor targeting with oncolytic adenoviruses in vivo", CURR OPIN MOL THER, vol. 11, 2009, pages 513 - 522 |
| STRAUSS, R.; P. SOVA; Y. LIU; Z.-Y. LI; S. TUVE; D. PRITCHARD; P. BRINKKOETTER; T. MOLLER; O. WILDNER; S. PESONEN: "Epithelial phenotype of ovarian cancer mediates resistance to oncolytic adenoviruses", CANCER RESEARCH, vol. 15, 2009, pages 5115 - 5125 |
| STRAUSS, R.; Z. Y. LI; Y. LIU; I. BEYER; J. PERSSON; P. SOVA; T. MOLLER; S. PESONEN; A. HEMMINKI; P. HAMERLIK: "Analysis of epithelial and mesenchymal markers in ovarian cancer reveals phenotypic heterogeneity and plasticity", PLOS ONE, vol. 6, 2011, pages E16186 |
| TANG, L.; J. AN; Z. XIE; S. DEHGHAN; D. SETO; W. XU; Y. JI.: "Genome and Bioinformatic Analysis of a HADV-B 14p 1 Virus Isolated from a Baby with Pneumonia in Beijing, China.", PLOS ONE, vol. 8, 2013, pages E60345 |
| TREI, J. S.; N. M. JOHNS; J. L. GARNER; L. B. NOEL; B. V. ORTMAN; K. L. ENSZ; M. C. JOHNS; M. L. BUNNING; J. C. GAYDOS: "Spread of adenovirus to geographically dispersed military installations, May-October 2007", EMERG INFECT DIS, vol. 16, 2010, pages 769 - 775 |
| TRINH, H. V.; G. LESAGE; V. CHENNAMPARAMPIL; B. VOLLENWEIDER; C. J. BURCKHARDT; S. SCHAUER; M. HAVENGA; U. F. GREBER; S. HEMMI: "Avidity binding of human adenovirus serotypes 3 and 7 to the membrane cofactor CD46 triggers infection", J VIROL, vol. 86, 2012, pages 1623 - 1637 |
| TUVE, S.; B. M. CHEN; Y. LIU; T. L. CHENG; P. TOURE; P. S. SOW; Q. FENG; N. KIVIAT; R. STRAUSS; S. NI: "Combination of tumor site-located CTL-associated antigen-4 blockade and systemic regulatory T- cell depletion induces tumor-destructive immune responses", CANCER RES, vol. 67, 2007, pages 5929 - 5939, XP002621187 |
| TUVE, S.; H. WANG; C. WARE; Y. LIU; A. GAGGAR; K. BERNT; D. SHAYAKHMETOV; Z. LI; R. STRAUSS; D. STONE: "A new group B adenovirus receptor is expressed at high levels on human stem and tumor cells", J VIROL, vol. 80, 2006, pages 12109 - 12120, XP055060774, DOI: doi:10.1128/JVI.01370-06 |
| UENO, N. T.; D. ZHANG: "Targeting EGFR in Triple Negative Breast Cancer", J CANCER, vol. 2, 2011, pages 324 - 328 |
| VERHOEYER ET AL., SCIENCE, vol. 239, 1988, pages 1534 - 1536 |
| WALTERS, R. W.; P. FREIMUTH; T. O. MONINGER; I. GANSKE; J. ZABNER; M. J. WELSH: "Adenovirus fiber disrupts CAR-mediated intercellular adhesion allowing virus escape", CELL, vol. 110, 2002, pages 789 - 799 |
| WANG ET AL., J. VIROLOGY, vol. 81, 2007, pages 12785 - 12792 |
| WANG HONGJIE ET AL: "Multimerization of Adenovirus Serotype 3 Fiber Knob Domains Is Required for Efficient Binding of Virus to Desmoglein 2 and Subsequent Opening of Epithelial Junctions", JOURNAL OF VIROLOGY, vol. 85, no. 13, July 2011 (2011-07-01), pages 6390 - 6402, XP002718813 * |
| WANG HONGJIE ET AL: "Structural and Functional Studies on the Interaction of Adenovirus Fiber Knobs and Desmoglein 2", JOURNAL OF VIROLOGY, vol. 87, no. 21, November 2013 (2013-11-01), pages 11346 - 11362, XP009175552 * |
| WANG, H.; I. BEYER; J. PERSSON; H. SONG; Z. LI; M. RICHTER; H. CAO; R. VAN RENSBURG; X. YAO; K. HUDKINS: "A new human DSG2-transgenic mouse model for studying the tropism and pathology of human adenoviruses", J VIROL, vol. 86, 2012, pages 6286 - 6302 |
| WANG, H.; S. TUVE; D. D. ERDMAN; A. LIEBER: "Receptor usage of a newly emergent adenovirus type 14", VIROLOGY, vol. 387, 2009, pages 436 - 441, XP026021103, DOI: doi:10.1016/j.virol.2009.02.034 |
| WANG, H.; Y. C. LIAW; D. STONE; O. KALYUZHNIY; I. AMIRASLANOV; S. TUVE; C. L. VERLINDE; D. SHAYAKHMETOV; T. STEHLE; S. ROMER: "Identification of CD46 binding sites within the adenovirus serotype 35 fiber knob", J VIROL, vol. 81, 2007, pages 12785 - 12792, XP008153231, DOI: doi:10.1128/JVI.01732-07 |
| WANG, H.; Z. LI; R. YUMUL; S. LARA; A. HEMMINKI; P. FENDER; A. LIEBER: "Multimerization of adenovirus serotype 3 fiber knob domains is required for efficient binding of virus to desmoglein 2 and subsequent opening of epithelial junctions", J VIROL, vol. 85, 2011, pages 6390 - 6402, XP002718813, DOI: doi:10.1128/JVI.00514-11 |
| WANG, H.; Z. Y. LI; Y. LIU; J. PERSSON; I. BEYER; T. MOLLER; D. KOYUNCU; M. R. DRESCHER; R. STRAUSS; X. B. ZHANG: "Desmoglein 2 is a receptor for adenovirus serotypes 3, 7, 11 and 14", NAT MED, vol. 17, 2011, pages 96 - 104 |
| WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 546 |
| ZENG, Y.; M. PINARD; J. JAIME; L. BOURGET; P. UYEN LE; M. D. O'CONNOR- MCCOURT; R. GILBERT; B. MASSIE: "A ligand-pseudoreceptor system based on de novo designed peptides for the generation of adenoviral vectors with altered tropism", THE JOURNAL OF GENE MEDICINE, vol. 10, 2008, pages 355 - 367 |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3464355A4 (en) * | 2016-06-06 | 2020-01-22 | Asclepiumm Taiwan Co., Ltd. | Dsg2 monoclonal antibody and use thereof |
| US10836823B2 (en) | 2016-06-06 | 2020-11-17 | Asclepiumm Taiwan Co., Ltd. | Dsg2 monoclonal antibody and the applications thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| KR20150058463A (ko) | 2015-05-28 |
| US20150246949A1 (en) | 2015-09-03 |
| AU2013323775B2 (en) | 2018-10-18 |
| EP2900818A1 (en) | 2015-08-05 |
| AU2013323775A1 (en) | 2015-04-09 |
| CN109796524A (zh) | 2019-05-24 |
| EP2900818B1 (en) | 2017-06-07 |
| JP2015532265A (ja) | 2015-11-09 |
| JP6290221B2 (ja) | 2018-03-07 |
| CN105008535B (zh) | 2018-10-16 |
| CN105008535A (zh) | 2015-10-28 |
| KR102175034B1 (ko) | 2020-11-06 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12466859B2 (en) | Desmoglein 2 (DSG2) binding proteins and uses therefor | |
| EP2900818B1 (en) | Desmoglein 2 (dsg2) binding proteins and uses therefor | |
| AU2011265260C1 (en) | Methods and systems for adenovirus interaction with desmoglein 2 (DSG2) | |
| HK1221262B (en) | Desmoglein 2 (dsg2) binding proteins and uses therefor | |
| HK40013714A (zh) | 桥粒芯糖蛋白2( dsg2 )结合蛋白质及其用途 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 13771350 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2015533277 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 14429705 Country of ref document: US |
|
| REEP | Request for entry into the european phase |
Ref document number: 2013771350 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2013771350 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2013323775 Country of ref document: AU Date of ref document: 20130924 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20157010265 Country of ref document: KR Kind code of ref document: A |