WO2014005959A1 - Complexes of cytomegalovirus proteins - Google Patents

Complexes of cytomegalovirus proteins Download PDF

Info

Publication number
WO2014005959A1
WO2014005959A1 PCT/EP2013/063750 EP2013063750W WO2014005959A1 WO 2014005959 A1 WO2014005959 A1 WO 2014005959A1 EP 2013063750 W EP2013063750 W EP 2013063750W WO 2014005959 A1 WO2014005959 A1 WO 2014005959A1
Authority
WO
WIPO (PCT)
Prior art keywords
hcmv
seq
membrane protein
complex
protein complex
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2013/063750
Other languages
English (en)
French (fr)
Inventor
Andrea Carfi
Yingxia Wen
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Novartis AG
Original Assignee
Novartis AG
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=48783208&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2014005959(A1) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority to GB1413863.0A priority Critical patent/GB2513768B/en
Priority to JP2015519155A priority patent/JP2015522581A/ja
Priority to KR1020157002267A priority patent/KR20150031322A/ko
Priority to CN201380036145.0A priority patent/CN104853771A/zh
Priority to ES13736518T priority patent/ES2753138T3/es
Priority to EP13736518.5A priority patent/EP2869843B1/en
Application filed by Novartis AG filed Critical Novartis AG
Priority to IN2929KON2014 priority patent/IN2014KN02929A/en
Priority to RU2015103891A priority patent/RU2015103891A/ru
Priority to MX2018000675A priority patent/MX378747B/es
Priority to MX2014015496A priority patent/MX355469B/es
Priority to US14/410,461 priority patent/US9683022B2/en
Priority to AU2013286093A priority patent/AU2013286093B2/en
Priority to HK15110880.5A priority patent/HK1210037A1/xx
Priority to SG11201408328VA priority patent/SG11201408328VA/en
Priority to CA2878344A priority patent/CA2878344A1/en
Publication of WO2014005959A1 publication Critical patent/WO2014005959A1/en
Priority to IL236261A priority patent/IL236261A0/en
Priority to ZA2014/09364A priority patent/ZA201409364B/en
Anticipated expiration legal-status Critical
Priority to US15/596,066 priority patent/US10287322B2/en
Priority to US16/363,127 priority patent/US20190211064A1/en
Priority to US17/551,867 priority patent/US20220106364A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • A61K39/245Herpetoviridae, e.g. herpes simplex virus
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/20Antivirals for DNA viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/20Antivirals for DNA viruses
    • A61P31/22Antivirals for DNA viruses for herpes viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • C07K14/01DNA viruses
    • C07K14/03Herpetoviridae, e.g. pseudorabies virus
    • C07K14/045Cytomegalovirus
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N7/00Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N7/00Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
    • C12N7/02Recovery or purification
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/53DNA (RNA) vaccination
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55555Liposomes; Vesicles, e.g. nanoparticles; Spheres, e.g. nanospheres; Polymers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55566Emulsions, e.g. Freund's adjuvant, MF59
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55588Adjuvants of undefined constitution
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/57Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
    • A61K2039/572Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 cytotoxic response
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011Details
    • C12N2710/16011Herpesviridae
    • C12N2710/16111Cytomegalovirus, e.g. human herpesvirus 5
    • C12N2710/16122New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011Details
    • C12N2710/16011Herpesviridae
    • C12N2710/16111Cytomegalovirus, e.g. human herpesvirus 5
    • C12N2710/16134Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011Details
    • C12N2710/16011Herpesviridae
    • C12N2710/16111Cytomegalovirus, e.g. human herpesvirus 5
    • C12N2710/16151Methods of production or purification of viral material

Definitions

  • This invention is in the field of vaccination against human cytomegalovirus (HCMV), and in particular the isolation of purified complexes comprising gH, gL and at least one more HCMV glycoprotein, preferably the trimeric gH/gL/gO complex or the pentameric gH/gL/pUL128/pUL130/pUL131A complex, and their subsequent use in vaccines.
  • HCMV human cytomegalovirus
  • Cytomegalovirus is a genus of virus that belongs to the viral family known as Herpesviridae or herpesviruses. The species that infects humans is commonly known as HCMV or human herpesvirus-5 (HHV-5). Within Herpesviridae, HCMV belongs to the Betaherpesvirinae subfamily, which also includes cytomegaloviruses from other mammals.
  • HCMV infections are frequently associated with the salivary glands. HCMV infects between 50% and 80% of adults in the United States (40%) worldwide), as indicated by the presence of antibodies in much of the general population. HCMV infection is typically unnoticed in healthy people, but can be life-threatening for the immunocompromised, such as HIV-infected persons, organ transplant recipients, or new born infants (Mocarski, Shenk and Pass 2006). HCMV is the virus most frequently transmitted to a developing fetus. After infection, HCMV has an ability to remain latent within the body for the lifetime of the host, with occasional reactivations from latency.
  • HCMV seems to have a large impact on immune parameters in later life and may contribute to increased morbidity and eventual mortality (Simanek, et al. (2011)).
  • HCMV strains AD169, Towne and Merlin can be obtained from the American Type Culture Collection (ATCC VR538, ATCC VR977 and ATCC VR1590,
  • HCMV contains an unknown number of membrane protein complexes.
  • gH and gL have emerged as particularly interesting due to their presence in several different complexes: dimeric gH/gL, trimeric gH/gL/gO (also known as the gCIII complex) and the pentameric gH/gL/pUL128/pUL130/pUL131A (the latter protein is also referred to as pUL131).
  • HCMV is thought to use the pentameric complexes to enter epithelial and endothelial cells by endocytosis and low-pH-dependent fusion but it is thought to enter fibroblasts by direct fusion at the plasma membrane in a process involving gH/gL or possibly gH/gL/gO.
  • the gH/gL and/or gH/gL/gO complex(es) is/are sufficient for fibroblast infection, whereas the pentameric complex is required to infect endothelial and epithelial cells (Ryckman, Rainish, et al. 2008).
  • Genini et al. discloses a serum antibody response to the pentameric complex of HCMV in primary and reactivated HCMV infections.
  • the response was determined by both indirect immunofluorescence (IF A) and ELISA, using fixed or lysed epithelial (ARPE- 19) cells infected with one or more adenoviral vectors, each carrying one HCMV gene and, in parallel, with a control adenovirus vector.
  • the specificity of results was determined by the reactivity of human neutralizing monoclonal antibodies recognizing two, three, or four proteins of the complex.
  • IgG antibody seroconversion to the UL128-131 gene products was consistently detected within 2-4 weeks after onset of infection, while antibodies persisted for at least 12 months.
  • the IgG antibody response to UL128-131 gene products was generally superior to the response to gH and appeared to follow the neutralizing antibody response (as determined in epithelial cells).
  • the antibody response showed a trend pronounced of a booster response.
  • IgG antibodies were detected in HCMV-seropositive healthy adult controls, but not in HCMV- seronegative individuals.
  • US7704510 discloses that pUL131A is required for epithelial cell tropism. US7704510 also discloses that pUL128 and pUL130 form a complex with gH/gL, which is incorporated into virions. This complex is required to infect endothelial and epithelial cells but not fibroblasts. Anti-CD46 antibodies were found to inhibit HCMV infection of epithelial cells. However, US7704510 does not disclose isolation of HCMV complexes.
  • the invention is based on the recombinant expression and purification of HCMV membrane protein complexes, wherein said complexes comprise gH, gL and at least one more HCMV glycoprotein.
  • the invention provides a process for producing an HCMV membrane protein complex comprising gH, gL and at least one more HCMV glycoprotein, wherein said process comprises the recombinant co-expression of an HCMV gH protein, an HCMV gL protein, and at least one more HCMV glycoprotein, under conditions in which said gH, gL and at least one more HCMV glycoprotein assemble to form a protein complex.
  • This process may optionally involve isolation of the protein complex, so that it can be prepared in purified form.
  • the process does not involve co-expression of any non-envelope HCMV proteins, such as the tegument or capsid proteins.
  • the invention also provides a protein complex produced by this process.
  • the complex can comprise (i) gH, gL and gO or (ii) gH, gL, pUL128, pUL130 and pUL131A.
  • the complexes of the invention can be produced at high yields.
  • the membrane protein complex of the invention may accumulate to a level of more than 0.4 mg per litre of growth medium (e.g. 0.45, 0.5, 0.55, 0.6, 0.65, 0.7, 0.75, 0.8, 0.85, 0.9, 0.95, 1.0, 1.2, 1.4, 1.6, 1.8, 2, 2.5, 3, 3.5, 4, 4.5 or 5 mg per litre of growth medium or more).
  • the invention also provides an isolated protein complex comprising an HCMV gH, an HCMV gL and at least one more HCMV glycoprotein.
  • a protein complex that comprises gH and gL is the trimeric complex consisting of gH, gL and gO.
  • Another example of a protein complex that comprises gH and gL is the pentameric complex consisting of gH, gL, pUL128, pUL130 and pUL131A.
  • the invention also provides a composition comprising a protein complex of the invention.
  • the composition does not contain polyacrylamide.
  • the composition is a liquid e.g. an aqueous liquid, not a gel.
  • the protein complex is not immobilised within the composition.
  • said HCMV membrane protein complex may not be present in a gel, or on a film, membrane, paper or slide.
  • the invention also provides a composition comprising a protein complex of the invention, wherein said composition does not contain any non-envelope HCMV proteins, such as the HCMV tegument or HCMV capsid proteins.
  • the invention also provides a modified HCMV gH polypeptide, wherein said polypeptide lacks a transmembrane (TM) domain.
  • TM transmembrane
  • the absence of a TM domain means that this modified polypeptide cannot reside within a lipid bilayer.
  • the gH polypeptide lacks the full-length natural TM domain; in other embodiments, it can retain a portion of the natural TM domain, but not enough to let the protein reside in a lipid bilayer.
  • the polypeptide can contain up to 10 amino acids (e.g. 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 amino acids) of the natural gH TM domain.
  • the polypeptide may also lack the natural C- terminal domain of HCMV gH or may lack a portion of the C-terminal domain.
  • the invention also provides nucleic acid molecules encoding said modified gH polypeptide, and processes for producing said modified gH polypeptide e.g. by recombinant expression, or by chemical synthesis (at least in part).
  • the invention provides a method of transfection involving the introduction of one or more nucleic acid molecules which encode the protein components of said HCMV membrane protein complex into cells.
  • Said one or more nucleic acid molecules may be stably introduced into the cells (e.g. by chromosomal integration) or may be transiently introduced into the cells.
  • the invention also provides a cell which is derived from said transfection.
  • a cell which is derived from said transfection is a cell in which said one or more nucleic acid molecules have been stably introduced.
  • the invention also provides progeny of said cell, a clone of said cell or a cell which has been passaged from said cell. These cells can be cultured to express complexes of the invention, which may then be purified.
  • the invention also provides a cell that produces an HCMV membrane protein complex, wherein the cell does not (i) contain an HCMV genome, and/or (ii) produce HCMV virions, and/or (iii) express any non-envelope HCMV proteins.
  • the cell lacks one of (i), (ii) or (iii); preferably, it lacks two; more preferably, it lacks all three of (i), (ii) and (iii).
  • the invention provides antibodies which recognise an isolated HCMV membrane protein complex of the invention, but do not bind to any of isolated gH, gL, gO, pUL128, pUL130 or pUL131A polypeptides and/or do not bind to isolated gH-gL heterodimers.
  • the antibodies of the invention may have been raised using an isolated HCMV membrane protein complex of the invention as an antigen.
  • the antibodies of the invention are neutralizing antibodies.
  • the antibodies of the invention may have been identified using in vitro selection methods, such as phage display using diverse antibody libraries.
  • antibodies of the invention may be human or humanised antibodies and/or they may be monoclonal or polyclonal antibodies.
  • the invention also provides a method for raising antibodies using an isolated HCMV membrane protein complex of the invention.
  • isolated HCMV membrane protein complex of the invention may be used to identify antibodies using in vitro selection methods, such as phage display using diverse antibody libraries.
  • the antibodies of the invention may be used in a diagnostic assay and may be labelled directly or indirectly. In some embodiments, the antibodies of the invention may be used in therapy, for example in the treatment of HCMV infection. Proteins of the invention
  • HCMV glycoprotein H which is encoded by the UL75 gene, is a virion glycoprotein that is essential for infectivity and which is conserved among members of the alpha-, beta- and gammaherpesviruses. It forms a stable complex with gL, and the formation of this complex facilitates the cell surface expression of gH.
  • the gL subunit and N-terminal residues of gH form a globular domain at one end of the structure (the 'head'), which is implicated in interactions with gB and activation of membrane fusion.
  • gH The C-terminal domain of gH, proximal to the viral membrane (the 'tail'), is also implicated in membrane fusion.
  • gH displays determinants that are recognized by the host factor TLR2, and it directly interacts with a heterodimer formed between the host factors TLR2 and TLR1.
  • TLR2 mediates NF- ⁇ activation and inflammatory cytokine responses from cells (Boehme, Guerrero and Compton 2006).
  • the gH from HCMV strain Merlin has been reported (GL52139248, SEQ ID NO: 1) to consist of 742 amino acids.
  • the gH from HCMV strain Towne (GL 138314, SEQ ID NO: 2) also consists of 742 amino acids, and has been reported to have six N-glycosylation sites (at residues 55, 62, 67, 192, 641 and 700), and consist of a hydrophobic signal sequence at its N-terminus (amino acid residues 1- 23), an ectodomain (residues 24-717) that projects out of the cell into the extracellular space, a hydrophobic TM domain (residues 718-736) and a C-terminal cytoplasmic domain (residues 737- 742).
  • SEQ ID NO: 2 shares 99% and 96% amino acid similarity to SEQ ID NO: 1 and the gH from HCMV strain AD169 (GI: 138313, SEQ ID NO: 3), respectively.
  • the N-terminal signal sequence of gH proteins is cleaved by a host cell signal peptidase to produce mature gH proteins.
  • the gH proteins in HCMV membrane complexes of the invention may lack an N-terminal signal sequences.
  • mature forms of gH (as found in isolated HCMV membrane complexes of the invention) lack the N-terminal signal sequence, the TM domain and the C-terminal domain.
  • constructs encoding just the N- terminal signal sequence and the ectodomain of gH (but not the TM domain) can be used to express a form of gH which is easily purified.
  • Said constructs may encode the majority (e.g. 70%>, 80%), 85%>, 90%, 95%, 96%, 97%, 98%, 99%, 99.5% or more) of the ectodomain of gH, but none or only a small portion of the TM domain.
  • gH proteins of the invention may include the whole of the gH ectodomain or a truncated form of the gH ectodomain. Said truncated forms of the ectodomain may lack between 1 and 20 amino acids (e.g. 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19 or 20 amino acid residues) at their N-termini and/or C-termini relative to a full-length HCMV gH protein.
  • An example of a gH protein of the invention is SEQ ID NO: 4, which consists of amino acid residues 1-715 of SEQ ID NO: 1.
  • An example of a preferred gH protein of the invention is SEQ ID NO: 29, which lacks the N-terminal signal sequence, TM domain and C-terminal domain of gH and consists of amino acid residues 24-715 of SEQ ID NO: 1.
  • gH proteins of the invention may contain additional amino acid residues, such as N-terminal or C-terminal extensions.
  • Such extensions may include one or more tags, which can facilitate detection (e.g. an epitope tag for detection by monoclonal antibodies) and/or purification (e.g. a polyhistidine- tag to allow purification on a nickel-chelating resin) of the gH protein.
  • An example of a C-terminal extension which includes a myc-tag and a polyhistidine-tag is given as SEQ ID NO: 5.
  • gH proteins of the invention e.g.
  • SEQ ID NOs: 6 and 30 may include at their C-termini an amino acid sequence which is at least 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the sequence recited in SEQ ID NO: 5.
  • gH proteins of the invention may comprise a truncated gH ectodomain fused to a C-terminal extension.
  • the ectodomain of gH corresponds to the portion of gH which lacks the hydrophobic TM.
  • the location and length of the ectodomain can be predicted based on pairwise alignment of a given sequence to SEQ ID NO: 1 , for example by aligning the amino acid sequence of a gH polypeptide of interest to SEQ ID NO: 1 and identifying the sequence that aligns to residues 24-717 of SEQ ID NO: 1.
  • the locations of the TM and C-terminal domains can be predicted by aligning the amino acid sequence of a gH polypeptide of interest to SEQ ID NO: 1 and identifying the sequences that align to residues 718-736 and 737-742 of SEQ ID NO: 1 , respectively.
  • the location and length of the ectodomain, the signal sequence and the TM domain can be predicted based on computational analysis of the hydrophobicity along the length of a given gH protein sequence.
  • the signal sequence and the TM domain have the highest levels of hydrophobicity and these two regions flank the ectodomain, which is less hydrophobic.
  • gH proteins of the invention can have various degrees of identity to SEQ ID NO: 4 such as at least 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the sequence recited in SEQ ID NO: 4.
  • gH proteins of the invention can have various degrees of identity to SEQ ID NO: 6 such as at least 60%, 70%, 80%, 85%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the sequence recited in SEQ ID NO: 6.
  • gH proteins of the invention can have various degrees of identity to SEQ ID NO: 29 such as at least 60%, 10%, 80%), 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the sequence recited in SEQ ID NO: 29.
  • gH proteins of the invention can have various degrees of identity to SEQ ID NO: 30 such as at least 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the sequence recited in SEQ ID NO: 30.
  • Preferred gH proteins can dimerise with HCMV gL; (ii) form part of the trimeric gH/gL/gO complex; (iii) form part of the pentameric gH/gL/pUL128/pUL130/pUL131A complex; (iv) comprise at least one epitope from SEQ ID NO: 4 or SEQ ID NO: 29; and/or (v) can elicit antibodies in vivo which immunologically cross-react with an HCMV virion.
  • HCMV glycoprotein L (gL) is encoded by the UL1 15 gene. gL is thought to be essential for viral replication and all known functional properties of gL are directly associated with its dimerization with gH. The gL/gH complex is required for the fusion of viral and plasma membranes leading to virus entry into the host cell. gL from HCMV strain Merlin (GL398421 15, SEQ ID NO: 7) and HCMV strain Towne (GL239909463, SEQ ID NO: 8) have been reported to be 278 amino acids in length.
  • gL from HCMV strain AD 169 (GL2506510, SEQ ID NO: 9) has been reported to be 278 amino acids in length, include a signal sequence at its N-terminus (amino acid residues 1-35), have two N-glycosylation sites (at residues 74 and 114) and lack a TM domain (Rigoutsos, et al. 2003).
  • the N-terminal signal sequence in SEQ ID NO: 7 is predicted to comprise amino acid residues 1-30.
  • SEQ ID NO: 8 shares 98% amino acid identity with SEQ ID NO: 7.
  • the N-terminal signal sequence of gL proteins is cleaved by a host cell signal peptidase to produce mature gL proteins.
  • the gL proteins in HCMV membrane complexes of the invention may lack an N-terminal signal sequences.
  • An example of a preferred gL protein of the invention is SEQ ID NO: 31, which lacks an N-terminal signal sequence and consists of amino acid residues 31-278 of SEQ ID NO: 7.
  • gL proteins of the invention can have various degrees of identity to SEQ ID NO: 7 such as at least 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the sequence recited in SEQ ID NO: 7.
  • gL proteins of the invention can have various degrees of identity to SEQ ID NO: 31 such as at least 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the sequence recited in SEQ ID NO: 31.
  • Preferred gL proteins can dimerise with HCMV gH; (ii) form part of the trimeric gH/gL/gO complex; (iii) form part of the pentameric gH/gL/pUL128/pUL130/pUL131A complex; (iv) comprise at least one epitope from SEQ ID NO: 7 or SEQ ID NO: 31 ; and/or (v) can elicit antibodies in vivo which immunologically cross-react with an HCMV virion.
  • HCMV glycoprotein O which is encoded by the UL74 gene, has been reported to act as a molecular chaperone, increasing gH/gL ER export and incorporation into virions. It has been proposed that gO competes with pUL128-131A for binding onto gH/gL but is released from gH/gL, so that gH/gL (lacking pUL128-131A) is incorporated into virions (Ryckman, Chase and Johnson 2010).
  • HCMV gO is unusually variable among different HCMV strains: the variability of the gO amino acid sequence among 22 to 39 clinical isolates, as well as laboratory strains AD 169, Towne and Toledo approached 45%) ⁇ i.e. there was only 55% identity between the gO amino acid sequences between different isolates) (Rasmussen, et al. 2002).
  • the gO from HCMV strains Merlin (GL39842082, SEQ ID NO: 10), AD169 (GI: 136968, SEQ ID NO: 11) and Towne have been reported (GL239909431, SEQ ID NO: 12) to consist of 472, 466 and 457 amino acids, respectively.
  • the gO of HCMV strain AD169 which shares a 73%) amino acid similarity to SEQ ID NO: 10, has 18 N-glycosylation sites (at residues 75, 83, 87, 103, 130, 157, 162, 171, 219, 242, 288, 292, 350, 385, 392, 399, 433 and 454), and may include a cleavable signal sequence at its N-terminus (predicted to consist of amino acid residues 1-30), which is absent from the mature polypeptide.
  • Rigoutsos (2003) predicted the presence of TM domains (in regions 10-28 and 190-212) and a coiled coil region (residues 240-272).
  • the N-terminal signal sequence of gO proteins is cleaved by a host cell signal peptidase to produce mature gO proteins.
  • the gO proteins in HCMV membrane complexes of the invention may lack an N-terminal signal sequences.
  • An example of a preferred gO protein of the invention is SEQ ID NO: 32, which lacks an N-terminal signal sequence and consists of amino acid residues 31-472 of SEQ ID NO: 10.
  • gO proteins of the invention can have various degrees of identity to SEQ ID NO: 10 such as at least 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the sequence recited in SEQ ID NO: 10.
  • gO proteins of the invention can have various degrees of identity to SEQ ID NO: 32 such as at least 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the sequence recited in SEQ ID NO: 32.
  • Preferred gO proteins can form part of the trimeric gH/gL/gO complex; (ii) cannot form part of the pentameric gH/gL/pUL128/pUL130/pUL131A complex, (iii) comprise at least one epitope of SEQ ID NO: 10 or SEQ ID NO: 32; and/or (iv) can elicit antibodies in vivo which immunologically cross-react with an HCMV virion.
  • the pUL128 from HCMV strain Merlin has been reported (GL39842124, SEQ ID NO: 13) to consist of 130 amino acids and to contain a 1 nucleotide substitution causing premature termination.
  • the pUL128 from HCMV strains Towne (GL39841882, SEQ ID NO: 14) and AD169 (GL59803078, SEQ ID NO: 15) have been reported to consist of 171 amino acids. Due to the premature termination of SEQ ID NO: 13, SEQ ID NOs: 13 and 15 only share 75% identity over the full-length of SEQ ID NO: 15.
  • pUL128 is predicted to have an N-terminal signal sequence, which is located at residues 1-27 of SEQ ID NO: 13, but it is predicted to lack a TM domain.
  • SEQ ID NO: 33 An example of a preferred pUL128 protein of the invention is SEQ ID NO: 33, which lacks an N-terminal signal sequence and consists of amino acid residues 28-171 of SEQ ID NO: 14. SEQ ID NO: 33 also consists of amino acid residues 28-171 of SEQ ID NO: 15.
  • pUL128 proteins of the invention can have various degrees of identity to SEQ ID NO: 15 such as at least 60%, 70%, 75%, 76%, 77%, 78%, 79%, 80%, 81%. 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the sequence recited in SEQ ID NO: 15.
  • pUL128 proteins of the invention can have various degrees of identity to SEQ ID NO: 33 such as at least 60%, 70%, 75%, 76%, 77%, 78%, 79%, 80%, 81%.
  • Preferred pUL128 proteins can form part of the pentameric gH/gL/pUL128/pUL130/pUL131A complex, (ii) comprise at least one epitope of SEQ ID NO: 15 or SEQ ID NO: 33, and/or (iii) can elicit antibodies in vivo which immunologically cross-react with an HCMV virion.
  • UL130 is the central and the largest (214 codons) gene of the UL131A-128 locus.
  • Conceptual translation of the gene predicts a long (25 amino acids) N-terminal signal sequence that precedes a hydrophilic protein containing two potential N-linked glycosylation sites (Asn85 and Asnl 18) within a putative chemokine domain (amino acids 46 to 120) and an additional N-glycosylation site (Asn201) close to the end of a unique C-terminal region.
  • pUL130 is predicted to lack a TM domain.
  • the N-terminal signal sequence of pUL130 proteins is cleaved by a host cell signal peptidase to produce mature pUL130 proteins.
  • the pUL130 proteins in HCMV membrane complexes of the invention may lack an N-terminal signal sequences.
  • An example of a preferred pUL130 protein of the invention is SEQ ID NO: 34, which lacks an N-terminal signal sequence and consists of amino acid residues 26-214 of SEQ ID NO: 16.
  • pUL130 proteins of the invention can have various degrees of identity to SEQ ID NO: 16 such as at least 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the sequence recited in SEQ ID NO: 16.
  • pUL130 proteins of the invention can have various degrees of identity to SEQ ID NO: 34 such as at least 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the sequence recited in SEQ ID NO: 34.
  • pUL130 proteins of the invention can have various degrees of identity to SEQ ID NO: 17 such as at least 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the sequence recited in SEQ ID NO: 17.
  • Preferred pUL130 proteins (i) can form a pentameric gH/gL/pUL128/pUL130/pUL131A complex; (ii) comprise at least one epitope of SEQ ID NO: 16, SEQ ID NO: 34 or SEQ ID NO: 17, respectively; and/or (iii) can elicit antibodies in vivo which immunologically cross-react with an HCMV virion.
  • pUL131A function is required for HCMV replication not only in endothelial cells but also in epithelial cells.
  • the pUL131A from HCMV strains Merlin (GL39842126, SEQ ID NO: 18) and Towne (GL239909474, SEQ ID NO: 19) and AD169 (GL219879712, SEQ ID NO: 20) have been reported to consist of 129, 129 and 76 amino acids, respectively.
  • pUL131A is predicted to contain an N-terminal signal sequence, which is located at residues 1-18 of SEQ ID NO: 18, and to lack a TM domain.
  • the UL131A from strain AD169 has been reported to contain a 1-base-pair insertion, which causes a frame-shift (Wang and Shenk 2005).
  • SEQ ID NO: 18 is 96% identical to SEQ ID NO: 20 over the N-terminal 28 amino acids, but it is only 36%) identical to SEQ ID NO: 20 over the full-length of SEQ ID NO: 18 due to the frame-shift in the AD169 UL131A gene.
  • the N-terminal signal sequence of pUL131A proteins is cleaved by a host cell signal peptidase to produce mature pUL131A proteins.
  • the pUL131A proteins in HCMV membrane complexes of the invention may lack an N-terminal signal sequences.
  • An example of a preferred pUL131A protein of the invention is SEQ ID NO: 35, which lacks an N-terminal signal sequence and consists of amino acid residues 19-129 of SEQ ID NO: 18.
  • SEQ ID NO: 35 also consists of amino acid residues 19-129 of SEQ ID NO: 19.
  • pUL131A proteins of the invention can have various degrees of identity to SEQ ID NO: 17 such as at least 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the sequence recited in SEQ ID NO: 18.
  • pUL131A proteins of the invention can have various degrees of identity to SEQ ID NO: 35 such as at least 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the sequence recited in SEQ ID NO: 35.
  • Preferred pUL131A proteins can form pentameric gH/gL/pUL128/pUL130/pUL131A complexes, (ii) comprise at least one epitope of SEQ ID NO: 18 or SEQ ID NO: 35; and/or (iii) can elicit antibodies in vivo which immunologically cross-react with an HCMV virion.
  • a clinical isolate If a clinical isolate is passaged in fibroblasts, it can very rapidly accumulate a mutation in the UL131A-128 locus, precluding its ability to infect other cell types. Indeed, as few as three passages in fibroblasts can be sufficient for such mutations to appear in virus stocks. For example, compared to clinical isolates which have not been passaged in fibroblasts, Merlin and Toledo carry mutations in UL128, Towne carries a mutation in the UL130 ORF and AD169 contains a mutated UL131A ORF.
  • the invention provides an immunogenic composition comprising HCMV complexes, wherein said complexes comprise gH, gL and at least one more HCMV glycoprotein, e.g. gH/gL/gO or gH/gL/pUL128/pUL130/pUL131A.
  • Such immunogenic compositions may additionally comprise other HCMV proteins (but preferably not non-envelope HCMV proteins), such as glycoprotein B (gB).
  • gB is encoded by UL55 and mediates fusion between the virus and the cell membrane. It therefore has a key role to play in entry and infection of the virus. Like many other viral fusion proteins, gB contains hydrophobic loops that insert into the cell membrane and it undergoes a large structural change (pre- and post- fusion conformation) during entry. Like gH, gB displays determinants that are recognized by the host factor TLR2, and it directly interacts with a heterodimer formed between the host factors TLR2 and TLR1. TLR2 mediates NF- ⁇ activation and inflammatory cytokine responses from cells (Boehme, Guerrero and Compton 2006).
  • Glycoprotein B is the most highly conserved of the envelope glycoproteins of human herpesviruses. Although the structure of HCMV gB is currently unknown, it is assumed that the structure of HCMV gB is similar to that of the gBs of HSV and EBV based on sequence homology. The postfusion conformations of HSV- 1 and EBV gBs also show a surprising degree of structural homology to the postfusion conformation of fusion protein (G) of vesicular stomatitis virus (VSV) protein, despite the lack of sequence similarity between the gBs of HSV- 1 and EBV and VSV-G.
  • G postfusion protein
  • VSV vesicular stomatitis virus
  • the gB from HCMV strains Merlin (GL39842076, SEQ ID NO: 21) and Towne (GI: 138193, SEQ ID NO: 22) have been reported to consist of 907 amino acids.
  • the gB from HCMV strain AD169 (GI: 138192, SEQ ID NO: 23) has been reported to consist of 906 amino acids, have 19 N- glycosylation sites (at residues 37, 68, 73, 85, 208, 281, 286, 302, 341, 383, 405, 409, 417, 447, 452, 464, 465, 554, and 585) and consists of a signal sequence at its N-terminus (at amino acid residues 1- 25), an extracellular region (residues 26-751), a TM domain (residues 752-772) and a cytoplasmic domain (residues 773-907) (Rigoutsos, et al.
  • gBs of HCMV strain Merlin and AD169 share 95% amino acid similarity.
  • the N-terminal signal sequence is predicted to consist of amino acid residues 1-22 of SEQ ID NO: 21 in the HCMV strain Merlin gB.
  • the N-terminal signal sequence of gB proteins is cleaved by a host cell signal peptidase to produce mature gB proteins.
  • the gB proteins in HCMV membrane complexes of the invention may lack an N-terminal signal sequences.
  • An example of a preferred gB protein of the invention is SEQ ID NO: 36, which lacks an N-terminal signal sequence and consists of amino acid residues 23-907 of SEQ ID NO: 21.
  • gB proteins of the invention can have various degrees of identity to SEQ ID NO: 21 such as at least 70%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the sequence recited in SEQ ID NO: 21.
  • gB proteins of the invention can have various degrees of identity to SEQ ID NO: 36 such as at least 70%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the sequence recited in SEQ ID NO: 36.
  • Preferred gB proteins (i) comprise at least one epitope of SEQ ID NO: 18 or SEQ ID NO: 36; and/or (ii) can elicit antibodies in vivo which immunologically cross-react with an HCMV virion.
  • polypeptides are not glycosylated.
  • one or more (or all) polypeptides in a complex of the invention are glycosylated.
  • one or more (or all) polypeptides in a complex of the invention are glycosylated by glycosylation mutants of cultured cells, such as mutated mammalian cells. Such glycosylation mutants produce a pattern of polypeptide glycosylation which differs from a wild-type pattern of glycosylation, i.e. the resulting polypeptide glycoforms differs from wild-type glycoforms.
  • glycosylation The level and type of glycosylation is dependent on the species of the host cell. In general, the species most distant to humans in evolutionary terms, such as bacteria, yeasts, fungi, insects and plants, have glycosylation repertoires that are least similar to that of humans. Proteins are usually not glycosylated in bacterial cells, although the transfer of N-linked glycosylation systems into Escherichia coli has been reported (Langdon, Cuccui and Wren 2009). Proteins can be glycosylated in insect cells. However, unlike vertebrate cells, insect cells are unable to produce complex N-linked side chains with penultimate galactose and terminal sialic acid. Hence, the type of glycosylation in insect cells can be sub-optimal for therapeutic proteins.
  • Yeast cells can perform N-linked (to asparagine) and O-linked (to serine/threonine) glycosylation using mannose.
  • Hyperglycosylation (outer chain extension) in the Golgi is a characteristic feature of yeast cells which is not typical of mammalian cells, and this can lead to problems with antibody reactivity.
  • yeast cells are unable to incorporate sugars other than mannose.
  • mammalian glycoproteins expressed in mammalian cells are authentically glycosylated resulting in a recombinant product most similar to that formed in vivo.
  • glycosylated polypeptides in complexes of the invention (i) have a mammalian glycosylation pattern; and/or (ii) do not contain an insect cell pattern of glycosylation.
  • one or more of the proteins of the invention contain complex N-linked side chains with penultimate galactose and terminal sialic acid.
  • HCMV membrane protein complexes of the invention are hetero-oligomeric associations between gH, gL and at least one additional HCMV protein.
  • the proteins in these complexes may be associated by non-covalent and/or covalent interactions.
  • disulfide bonds link gH to gO and gL.
  • pentameric complex of the invention gH, gL and pUL128 are typically linked through disulfide bonds, but pUL130 and pUL131A are typically incorporated into the pentameric complex by non-covalent interactions (as shown in Example 7).
  • the pUL130 protein of the invention and/or pUL131A protein of the invention is incorporated into the pentameric complex by non-covalent interactions. Furthermore, the pUL130 protein of the invention and/or pUL131A may be inter-linked by non-covalent interactions.
  • the stoichiometries of the trimeric and pentameric complexes are assumed to be 1 : 1 : 1 (Huber and Compton 1999) and 1 : 1 : 1 : 1 : 1 (Ryckman, Chase and Johnson 2010), respectively, but this has yet to be definitively confirmed.
  • membrane protein complexes of the invention are able to induce an immunogenic response.
  • Membrane protein complexes of the invention may thus be able to induce immunity against HCMV infection. These two functions are dependent on the retention of epitopes on the membrane protein complexes of the invention that can elicit the production of antibodies, including neutralizing antibodies.
  • a range of conformational epitopes for the pentameric complex are known. For example, Macagno (2010) isolated a panel of human monoclonal antibodies that neutralized HCMV infection of endothelial, epithelial, and myeloid cells.
  • the pentameric complexes of the invention possess one or more of the conformational epitopes identified by Macagno (2010).
  • Each protein of the invention may contain mutations, such as insertions, deletions and substitutions relative to the Merlin strain and/or the AD 169 strain of HCMV, so long as these mutations are not detrimental to the use of the proteins as antigens, in particular so long as they retain one or more epitopes that can elicit the production of antibodies that can bind to at least a membrane protein complex of the Merlin and/or AD 169 strain of HCMV and/or antibodies that can neutralize the biological effects of said HCMV membrane protein complex.
  • mutations should not prevent the capacity of the proteins to form a membrane protein complex of the invention.
  • the ability to form a membrane protein complex of the invention can be tested by performing protein purification, and analyzing the proteins by non-reducing PAGE, Western blot and/or size exclusion chromatography. If the proteins form part of a complex, they may all be present in a single band on a native PAGE gel and/or be present in a single peak in a size exclusion chromatogram.
  • the HCMV membrane protein complex of the invention can be prepared at various levels of purity e.g. at least 80%, 85%, 90%, 95%, or 99% of total protein by mass, i.e. the complex makes up at least 80%) of the total proteinaceous mass in a composition.
  • the composition may be free from polyacrylamide.
  • the invention provides a process for expressing the membrane protein complex of the invention.
  • Suitable expression systems for use in the present invention are well known to those of skill in the art and many are described in detail in Doyle (2008).
  • any system or vector that is suitable to maintain, propagate and express nucleic acid molecules to produce a polypeptide in the required host may be used.
  • the appropriate nucleotide sequence may be inserted into an expression system by any of a variety of well-known and routine techniques, such as, for example, those described in Sambrook (2000).
  • the encoding gene can be placed under the control of a control element such as a promoter, and, optionally, an operator, so that the DNA sequence encoding the desired peptide is transcribed into RNA in the transformed host cell.
  • suitable expression systems include, for example, chromosomal, episomal and virus-derived systems, including, for example, vectors derived from: bacterial plasmids, bacteriophage, transposons, yeast episomes, insertion elements, yeast chromosomal elements, viruses such as baculoviruses, papova viruses such as SV40, vaccinia viruses, adenoviruses, fowl pox viruses, pseudorabies viruses and retroviruses, or combinations thereof, such as those derived from plasmid and bacteriophage genetic elements, including cosmids and phagemids.
  • Human artificial chromosomes may also be employed to deliver larger fragments of DNA than can be contained and expressed in a plasmid.
  • Suitable expression systems include microorganisms such as bacteria transformed with recombinant bacteriophage, plasmid or cosmid DNA expression vectors; yeast transformed with yeast expression vectors; insect cell systems infected or transfected with virus expression vectors (for example, baculovirus); plant cell systems transformed with virus expression vectors (for example, cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV) or with bacterial expression vectors (for example, Ti or pBR322 plasmids); or animal cell systems.
  • Cell-free translation systems can also be employed to produce the proteins of the invention.
  • the proteins of the invention are produced in eukaryotic cells, such as mammalian cells.
  • Recombinant polypeptides may be expressed transiently or stably.
  • the recombinant proteins are expressed stably.
  • cell lines that stably express the peptide of interest may be trans fected using expression vectors which may contain viral origins of replication and/or endogenous expression elements and a selectable marker gene on the same or on a separate vector. Following the introduction of the vector, cells may be allowed to grow for 1 -2 days in an enriched media before they are switched to selective media.
  • the purpose of the selectable marker is to confer resistance to selection, and its presence allows growth and recovery of cells that successfully express the introduced sequences. Resistant clones of stably transformed cells may be proliferated using tissue culture techniques appropriate to the cell type.
  • Mammalian cell lines available as hosts for expression are known in the art and include many immortalised cell lines available from the American Type Culture Collection (ATCC) including, but not limited to, Chinese hamster ovary (CHO), HeLa, baby hamster kidney (BHK), monkey kidney (COS), CI 27, 3T3, BHK, human embryonic kidney (HEK) 293, Bowes melanoma and human hepatocellular carcinoma (for example Hep G2) cells and a number of other cell lines.
  • ATCC American Type Culture Collection
  • CHO Chinese hamster ovary
  • BHK baby hamster kidney
  • COS monkey kidney
  • CI 27, 3T3, BHK human embryonic kidney
  • HEK human embryonic kidney
  • Bowes melanoma human hepatocellular carcinoma
  • the materials for baculovirus/insect cell expression systems are commercially available in kit form from, inter alia, Invitrogen, San Diego CA (the "MaxBac” kit). These techniques are generally known to those skilled in the art and are described fully in Summers et al. (Summers and Smith 1987).
  • Particularly suitable host cells for use in this system include insect cells such as Drosophila S2 ⁇ i.e. by recombinant baculovirus infection of stably transfected Drosophila S2 cells) and Spodoptera Sf9 cells.
  • the proteins of the invention are not produced in insect cells.
  • suitable plant cellular genetic expression systems include those described in US Patent 5,693,506; US Patent 5,659,122; US Patent 5,608,143 and Zenk (1991) 23 .
  • all plants from which protoplasts can be isolated and cultured to give whole regenerated plants can be utilised, so that whole plants are recovered which contain the transferred gene.
  • Practically all plants can be regenerated from cultured cells or tissues, including but not limited to all major species of sugar cane, sugar beet, cotton, fruit and other trees, legumes and vegetables.
  • prokaryotic expression systems include those that use streptococci, staphylococci, E. coli, Streptomyces and Bacillus subtilis as host cells.
  • fungal expression systems include those that use yeast (for example, S. cerevisiae) and Aspergillus as host cells.
  • HEK293 cells are suitable for transient expression of the HCMV proteins of the invention due to their high transferability by various techniques, including the calcium phosphate and polyethylenimine (PEI) methods.
  • a useful cell line of HEK293 is one that expresses the EBNA1 protein of EBV, such as 293-6E (Loignon, et al. 2008).
  • Transformed HEK293 cells have been shown to secrete high levels of the protein complexes of the invention into the growth medium, thus allowing the purification of such protein complexes directly from the growth medium.
  • CHO cells are particularly suitable mammalian hosts for industrial production of the HCMV proteins of the invention for use as immunogens or antigens because they allow long-term, stable gene expression and high yields of proteins.
  • the membrane protein complexes of the invention are secreted from the cells in which they are expressed. In other embodiments of the invention, the proteins of the invention are not secreted. In E. coli, for example, non-secreted proteins may accumulate in inclusion bodies. Methods for purifying recombinant proteins from inclusion bodies are well known in the art.
  • Transfection can be carried out by a range of methods including using calcium phosphate, electroporation, or by mixing a cationic lipid with the material to produce liposomes which fuse with the cell membrane and deposit their cargo inside.
  • the invention provides a recombinant nucleic acid which encodes gL, gH that lacks a TM domain, and at least one additional HCMV glycoprotein.
  • said recombinant nucleic acid (a) is not a self-replicating NA molecule; (b) is not an. alphavirus rcplicon; (c) docs not encode any alphavirus nonstructural proteins, such as NSP I , NSP2, S.P3 and NSP4; (d) does not contain an Internal ibosomal Entry Site (IRES), such as EMCV or EV71 ; and/or (c) does not contain a viral 2A site, such as FMDV.
  • I Internal ibosomal Entry Site
  • An example of said recombinant nucleic acid may be a single construct which encodes a gL protein of the invention, a gH protein of the invention, a pUL128 protein of the invention, a pUL130 protein of the invention and a pUL131 protein of the invention.
  • the invention also provides a plurality of recombinant nucleic acids which encode one or more proteins of the invention.
  • the invention provides two nucleic acid constructs: the first construct encoding a gH protein of the invention and a gL protein of the invention, and the second construct encoding a pUL128 protein of the invention, a pUL130 protein of the invention and a pUL 131 A protein of the invention.
  • the invention also provides a plurality of recombinant nucleic acids comprising: a first recombinant nucleic acid molecule which encodes a gL protein of the invention; a second recombinant nucleic acid molecule which encodes a gH protein of the invention; and one or more third recombinant nucleic acid molecules which encode one or more additional HCMV proteins.
  • said first, second and/or third recombinant nucleic acid molecule(s) is/arc not a self- replicating RNA molecule; (b) is/are not (an) alphavirus replicon(s); (c) do(cs) not encode any alphavirus nonstructural proteins, such as NSP 1 , NSP2, NSP3 and NSP4; (d) do(cs) not contain: an. Internal Ribosomal Entry Site (IRES), such as EIV1CV or EV71 ; and/or (e) do(es) not contain a viral 2A site, such as FMDV.
  • IRS Internal Ribosomal Entry Site
  • the third recombinant nucleic acid molecule encodes a gO protein of the invention and in another embodiment the third recombinant nucleic acid molecule(s) encode(s) pUL128, pUL130 and pUL131A proteins of the invention.
  • sequences encoding each individual polypeptide in a complex can be present in a single nucleic acid molecule, or distributed among two or more nucleic acid molecules.
  • the invention provides a plurality of recombinant nucleic acids comprising: (i) a first recombinant nucleic acid molecule which encodes a gL protein of the invention, (ii) a second recombinant nucleic acid molecule which encodes a gH protein of the invention, (iii) a third recombinant nucleic acid molecule which encodes a pUL128 protein of the invention, (iv) a fourth recombinant nucleic acid molecule which encodes a pUL130 protein of the invention, and (v) a fifth recombinant nucleic acid molecule which encodes a pUL131A protein of the invention.
  • said first, second, third, fourth and/or fifth recombinant nucleic acid molecule(s) (a) is/are not a self-replicating RNA molecule; (b) is/are not (an) alphavirus replicon(s);
  • IRS Internal Ribosomal Entry Site
  • Nucleic acid molecules which encode a gH protein of the invention can have various degrees of identity to SEQ ID NO: 24 such as at least 89% 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%) or 99% identical to the sequence recited in SEQ ID NO: 24.
  • Nucleic acid molecules which encode a gL protein of the invention can have various degrees of identity to SEQ ID NO: 25 such as at least 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the sequence recited in SEQ ID NO: 25.
  • Nucleic acid molecules which encode a pUL128 protein of the invention can have various degrees of identity to SEQ ID NO: 26 such as at least 74%, 76%, 78%, 80%, 82%, 84%, 86%, 88%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the sequence recited in SEQ ID NO: 26.
  • Nucleic acid molecules which encode a pUL130 protein of the invention can have various degrees of identity to SEQ ID NO: 27 such as at least 74%, 76%), 78%), 80%, 82%, 84%, 86%, 88%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the sequence recited in SEQ ID NO: 27.
  • Nucleic acid molecules which encode a pUL131A protein of the invention can have various degrees of identity to SEQ ID NO: 28 such as at least 74%), 76%), 78%, 80%, 82%, 84%, 86%, 88%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the sequence recited in SEQ ID NO: 28.
  • the nucleic acids of the invention may comprise genomic DNA and/or cDNAs. Unlike cDNA, genomic DNA may contain introns. Some genes are expressed more efficiently when introns are present. Genomic UL128 and UL131A genes each consist of two exons, whereas UL130 does not contain any introns. If genomic sequences are used, the proteins that are produced will depend on splicing, which can vary according to which expression system is used.
  • the invention provides vectors that comprise said nucleic acids, wherein said vectors include suitable promoters and terminators.
  • Said recombinant nucleic acids may be plasmids, or may be incorporated into the genome of a cell.
  • the promoters in these vectors can be HCMV promoters or non-HCMV promoters.
  • the invention also provides a process for expressing an HCMV membrane protein complex comprising gH, gL and at least one more HCMV glycoprotein by introducing one or more recombinant nucleic acid molecules which encode gH, gL and at least one more HCMV glycoprotein into an expression system; expressing said one or more nucleic acids in said expression system; and purifying said HCMV membrane protein complex.
  • this process comprises transfecting cells with a first nucleic acid construct which encodes: either gH, gL, pUL128, pUL130 and pUL131A proteins of the invention or gH, gL and gO proteins of the invention.
  • this process may comprise transfecting cells with a first nucleic acid construct which encodes a gH protein of the invention, a second nucleic acid construct which encodes a gL protein of the invention; and one or more third nucleic acid construct(s) which encode(s) one or more additional HCMV glycoprotein(s) of the invention.
  • this process may comprise transfecting cells with a first nucleic acid construct which encodes a gH protein of the invention and a gL protein of the invention; and a second nucleic acid construct(s) which encode(s) one or more additional HCMV glycoprotein(s) of the invention, such as gO or pUL128, pUL130 and pUL131A.
  • Said HCMV membrane protein complex may be expressed in a mammalian cell.
  • Said isolated HCMV membrane protein complex may optionally be purified.
  • the invention also provides a cell that expresses a nucleic acid molecule or plurality of nucleic acid molecules of the invention, wherein said cell does not comprise the full HCMV genome.
  • Said cell may be stably transformed with said nucleic acid molecule or plurality of nucleic acid molecules of the invention.
  • said cell is a mammalian cell, for example a CHO cell.
  • the invention provides a cell comprising gH, gL and at least one additional HCMV glycoprotein, wherein said cell does not contain the HCMV genome and/or does not produce HCMV virions and/or does not express any non-envelope HCMV proteins. Isolation and purification of membrane protein complexes
  • Complexes of the invention are preferably prepared and used in isolated form.
  • isolated as used herein means removed from its natural environment.
  • an "isolated HCMV membrane protein complex” does not encompass the HCMV membrane protein complex on the surface of HCMV infected cells or within an infectious HCMV virion.
  • the complexes of the invention can be produced at high yields. [See above].
  • the invention provides processes for purifying HCMV membrane complexes of the invention. Such processes of the invention allow for production of the HCMV membrane protein complex at a purity of >85%, >86%, >87%, >88%, >89%, >90%, >91%, >92%, >93%, >94% or >95% of total protein by mass, as determined by gel electrophoresis. These high levels of purity make the complexes suitable for use as an immunogen in diagnostic applications or as an antigen in vaccine formulations.
  • the invention provides a process for purifying an HCMV membrane protein complex of the invention, wherein said purification comprises one or more chromatographic steps.
  • Said chromatographic steps may comprise affinity chromatography, such as Ni 2+ affinity chromatography and/or size exclusion chromatography.
  • the invention also provides compositions comprising the isolated HCMV membrane protein complexes of the invention.
  • the invention also provides compositions comprising the purified HCMV membrane protein complexes of the invention.
  • the HCMV membrane protein complex can be incorporated into an immunogenic composition, or a vaccine composition.
  • Such compositions can be used to raise antibodies in a mammal (e.g. a human).
  • the invention provides pharmaceutical compositions comprising an HCMV membrane protein complex of the invention. Similarly, the invention provides processes for making a pharmaceutical composition involving combining an HCMV membrane protein complex of the invention with a pharmaceutically acceptable carrier.
  • immunogenic and pharmaceutical compositions of the invention typically include a pharmaceutically acceptable carrier, and a thorough discussion of such carriers is available in Remington: The Science and Practice of Pharmacy.
  • the pH of the composition is usually between 6 and 8, and more preferably between 6.5 and 7.5 (e.g. about 7). Stable pH may be maintained by the use of a buffer e.g. a Tris buffer, a citrate buffer, phosphate buffer, or a histidine buffer.
  • a composition will generally include a buffer.
  • a composition may be sterile and/or pyrogen- free. Compositions may be isotonic with respect to humans.
  • a composition comprises an immunologically effective amount of its antigen(s).
  • An 'immunologically effective amount' is an amount which, when administered to a subject, is effective for eliciting an antibody response against the antigen. This amount can vary depending upon the health and physical condition of the individual to be treated, their age, the capacity of the individual's immune system to synthesise antibodies, the degree of protection desired, the formulation of the vaccine, the treating doctor's assessment of the medical situation, and other relevant factors. It is expected that the amount will fall in a relatively broad range that can be determined through routine trials.
  • the antigen content of compositions of the invention will generally be expressed in terms of the mass of protein per dose. A dose of 10-500 ⁇ g (e.g. 50 ⁇ g) per antigen can be useful.
  • Immunogenic compositions may include an immunological adjuvant.
  • they may include an aluminium salt adjuvant or an oil-in-water emulsion (e.g. an oil-in-water emulsion comprising squalene, such as MF59 or AS03).
  • Suitable aluminium salts include hydroxides (e.g. oxyhydroxides), phosphates (e.g. hydroxyphosphates, orthophosphates), (e.g. see chapters 8 & 9 of Vaccine Design... (1995) eds. Powell & Newman. ISBN: 030644867X. Plenum), or mixtures thereof.
  • the salts can take any suitable form (e.g.
  • the concentration of Al +++ in a composition for administration to a patient is preferably less than 5mg/ml e.g. ⁇ 4 mg/ml, ⁇ 3 mg/ml, ⁇ 2 mg/ml, ⁇ 1 mg/ml, etc.
  • a preferred range is between 0.3 and lmg/ml.
  • a maximum of 0.85mg/dose is preferred.
  • Aluminium hydroxide and aluminium phosphate adjuvants are particularly suitable for use with the invention.
  • One suitable immunological adjuvant comprises a compound of Formula (I) as defined in WO201 1/027222, or a pharmaceutically acceptable salt thereof, adsorbed to an aluminum salt.
  • Many further adjuvants can be used, including any of those disclosed in Powell & Newman (1995).
  • Compositions may include an antimicrobial, particularly when packaged in multiple dose format.
  • Antimicrobials such as thiomersal and 2-phenoxyethanol are commonly found in vaccines, but it is preferred to use either a mercury- free preservative or no preservative at all.
  • Compositions may comprise detergent e.g. a polysorbate, such as polysorbate 80.
  • Detergents are generally present at low levels e.g. ⁇ 0.01%.
  • Compositions may include sodium salts (e.g. sodium chloride) to give tonicity.
  • sodium salts e.g. sodium chloride
  • a concentration of 10+2 mg/ml NaCl is typical e.g. about 9 mg/ml.
  • compositions of the invention will generally be administered directly to a subject.
  • Direct delivery may be accomplished by parenteral injection (e.g. subcutaneously, intraperitoneally, intravenously, intramuscularly, or to the interstitial space of a tissue), or by any other suitable route.
  • Intramuscular administration is preferred e.g. to the thigh or the upper arm.
  • Injection may be via a needle (e.g. a hypodermic needle), but needle-free injection may alternatively be used.
  • a typical intramuscular dosage volume is 0.5 ml.
  • Administration can involve a single dose schedule or a multiple dose schedule.
  • the subject who is immunised is a human being, who may be any age e.g. 0-12 months old, 1- 5 years old, 5-18 years old, 18-55 years old, or more than 55 years old.
  • Vaccines of the invention may be prophylactic (i. e. to prevent disease) or therapeutic (i. e. to reduce or eliminate the symptoms of a disease).
  • Isolated and/or purified HCMV membrane protein complexes of the invention can be administered alone or as either prime or boost in mixed-modality regimes, such as a RNA prime followed by a protein boost.
  • benefits of the RNA prime protein boost strategy include, for example, increased antibody titers, a more balanced IgGl :IgG2a subtype profile, induction of THl-type CD4+ T cell-mediated immune response that was similar to that of viral particles, and reduced production of non-neutralizing antibodies.
  • the RNA prime can increase the immunogenicity of compositions regardless of whether they contain or do not contain an adjuvant.
  • RNA prime-protein boost strategy the RNA and the protein are directed to the same target antigen.
  • suitable modes of delivering RNAs include virus-like replicon particles (VRPs), alphavirus RNA, replicons encapsulated in lipid nanoparticles (LNPs) or formulated RNAs, such as replicons formulated with cationic nanoemulsions (CNEs).
  • VRPs virus-like replicon particles
  • LNPs lipid nanoparticles
  • CNEs formulated RNAs, such as replicons formulated with cationic nanoemulsions
  • Suitable cationic oil-in-water nanoemulsions are disclosed in WO2012/006380 e.g. comprising an oil core (e.g. comprising squalene) and a cationic lipid (e.g. DOTAP, DMTAP, DSTAP, DC-cholesterol, etc.).
  • WO2012/05121 1 discloses that antibodies to the pentameric complex are produced in mice that have been immunized with VRPs and formulated RNAs (CNEs and LNPs) that encode the protein constituents of the pentameric complex. These antibodies have been found to be capable of neutralizing HCMV infection in epithelial cells.
  • the RNA prime-protein boost regimen may involve first (e.g. at weeks 0-8) performing one or more priming immunization(s) with RNA (which could be delivered as VRPs, LNPs, CNEs, etc.) that encodes one or more of the protein components of an HCMV membrane protein complex of the invention and then perform one or more boosting immunization(s) later (e.g. at weeks 24-58) with: an isolated HCMV membrane protein complex of the invention, optionally formulated with an adjuvant or a purified HCMV membrane protein complex of the invention, optionally formulated with an adjuvant.
  • RNA which could be delivered as VRPs, LNP
  • the invention thus provides an immunogenic composition comprising: a self-replicating RNA molecule that encodes a first polypeptide HCMV antigen comprising a first epitope; and a second polypeptide HCMV antigen comprising a second epitope.
  • kits comprising: (i) a priming composition comprising a self-replicating RNA molecule that encodes a first polypeptide antigen that comprises a first epitope from a pathogen; and (ii) a boosting composition comprising a second polypeptide antigen that comprises a second epitope from the pathogen.
  • Antigens may be independently selected from the group consisting of gB, gH, gL, gO, pUL128, pUL130 and pUL131A.
  • Said first polypeptide HCMV antigen is preferably an HCMV membrane protein complex of the invention, such as the trimeric gH/gL/gO complex or the pentameric complex.
  • Said second polypeptide HCMV antigen is preferably: an isolated HCMV membrane protein complex of the invention, such as the trimeric gH/gL/gO complex or the pentameric complex or a purified HCMV membrane protein complex of the invention, such as the trimeric gH/gL/gO complex or the pentameric complex.
  • the first and second polypeptide antigens can be substantially the same.
  • the first polypeptide antigen can be a soluble or membrane anchored polypeptide, and the second polypeptide antigen can be a soluble polypeptide.
  • the first polypeptide antigen can be a fusion polypeptide.
  • the second polypeptide antigen can be a fusion polypeptide.
  • the self-replicating RNA can be an alphavirus-derived RNA replicon.
  • the self-replicating RNA molecule can comprise one or more modified nucleotides.
  • the self-replicating RNA molecule encodes an HCMV membrane protein complex of the invention, such as the trimeric gH/gL/gO complex or the pentameric complex of the invention.
  • the second polypeptide antigen is a purified HCMV membrane protein complex of the invention, such as a purified trimeric gH/gL/gO complex or purified pentameric complex of the invention.
  • the RNA molecule is encapsulated in, bound to or adsorbed on a cationic lipid, a liposome, a cochleate, a virosome, an immune-stimulating complex, a microparticle, a microsphere, a nanosphere, a unilamellar vesicle, a multilamellar vesicle, an oil-in-water emulsion, a water-in-oil emulsion, an emulsome, a polycationic peptide, a cationic nanoemulsion or combinations thereof.
  • the priming composition of the kit or the immunogenic composition further comprises a cationic lipid, a liposome, a cochleate, a virosome, an immune-stimulating complex, a microparticle, a microsphere, a nanosphere, a unilamellar vesicle, a multilamellar vesicle, an oil-in-water emulsion, a water-in-oil emulsion, an emulsome, a polycationic peptide, or a cationic nanoemulsion.
  • the invention provides antibodies which recognise an isolated and/or purified HCMV membrane protein complex of the invention, but which do not bind to any of isolated gH, gL, gO, pUL128, pUL130 or pUL131A polypeptides and/or do not bind to isolated gH-gL heterodimers.
  • antibodies of the invention may be human or humanised antibodies and/or they may be monoclonal or polyclonal antibodies.
  • Antibodies of the invention may be polyclonal or monoclonal. Monoclonal antibodies (mAbs) are preferred for many situations.
  • the word “monoclonal” does not imply any particular cellular origin, but refers to any population of antibodies that display a single binding specificity and affinity for a particular epitope in the same target protein. This usage is normal in the art.
  • a mAb may be produced using any suitable protein synthesis system, including immune cells, non-immune cells, acellular systems, etc.
  • a mAb can thus be produced by a variety of techniques, including conventional monoclonal antibody methodology ⁇ e.g. the standard somatic cell hybridization technique of Kohler & Milstein), by viral or oncogenic transformation of B lymphocytes, by combinatorial synthesis, by phage display, etc.
  • antibodies of the invention may be raised in vivo using: an isolated HCMV membrane protein complex of the invention as an antigen or a purified HCMV membrane protein complex of the invention as an antigen.
  • the animal which raises the antibodies can be a mouse, a rat, a rabbit, a goat, etc.
  • antibodies may be identified using in vitro selection methods, such as phage display of antibodies.
  • Antibodies of the invention can take various forms. For instance, they may be native antibodies, as naturally found in mammals. Native antibodies are made up of heavy chains and light chains. The heavy and light chains are both divided into variable domains and constant domains. The ability of different antibodies to recognize different antigens arises from differences in their variable domains, in both the light and heavy chains. Light chains of native antibodies in vertebrate species are either kappa ( ⁇ ) or lambda ( ⁇ ), based on the amino acid sequences of their constant domains. The constant domain of a native antibody's heavy chains will be ⁇ , ⁇ , ⁇ , ⁇ or ⁇ , giving rise respectively to antibodies of IgA, IgD, IgE, IgG, or IgM class.
  • Classes may be further divided into subclasses or isotypes e.g. IgGl, IgG2, IgG3, IgG4, IgA, IgA2, etc.
  • Antibodies may also be classified by allotype e.g. a ⁇ heavy chain may have Glm allotype a, f, x or z, G2m allotype n, or G3m allotype bO, bl, b3, b4, b5, c3, c5, gl, g5, s, t, u, or v; a ⁇ light chain may have a Km(l), Km(2) or Km(3) allotype.
  • a native IgG antibody has two identical light chains (one constant domain CL and one variable domain VL) and two identical heavy chains (three constant domains CHI CH2 & CH3 and one variable domain VH), held together by disulfide bridges.
  • CL constant domain
  • VL variable domain
  • VH variable domain
  • the domain and three-dimensional structures of the different classes of native antibodies are well known.
  • an antibody of the invention has a light chain with a constant domain, it may be a ⁇ or ⁇ light chain.
  • an antibody of the invention may be an ⁇ , ⁇ , ⁇ , ⁇ or ⁇ heavy chain.
  • Heavy chains in the ⁇ class ⁇ i.e. IgG antibodies) are preferred.
  • Antibodies of the invention may be fragments of native antibodies that retain antigen binding activity. For instance, papain digestion of native antibodies produces two identical antigen-binding fragments, called “Fab” fragments, each with a single antigen-binding site, and a residual "Fc” fragment without antigen-binding activity. Pepsin treatment yields a "F(ab')2" fragment that has two antigen-binding sites. "Fv” is the minimum fragment of a native antibody that contains a complete antigen-binding site, consisting of a dimer of one heavy chain and one light chain variable domain. Thus an antibody of the invention may be Fab, Fab', F(ab')2, Fv, or any other type, of fragment of a native antibody.
  • An antibody of the invention may be a "single-chain Fv" (“scFv” or “sFv”), comprising a VH and VL domain as a single polypeptide chain.
  • scFv single-chain Fv
  • the VH and VL domains are joined by a short polypeptide linker (e.g. >12 amino acids) between the VH and VL domains that enables the scFv to form the desired structure for antigen binding.
  • a typical way of expressing scFv proteins, at least for initial selection is in the context of a phage display library or other combinatorial library. Multiple scFvs can be linked in a single polypeptide chain.
  • An antibody of the invention may be a "diabody” or “triabody” etc. , comprising multiple linked Fv (scFv) fragments.
  • scFv linked Fv
  • VH and VL domains that is too short to allow them to pair with each other (e.g. ⁇ 12 amino acids)
  • they are forced instead to pair with the complementary domains of another Fv fragment and thus create two antigen-binding sites.
  • These antibodies may include CH and/or CL domains.
  • An antibody of the invention may be a single variable domain or VHH antibody.
  • Antibodies naturally found in camelids (e.g. camels and llamas) and in sharks contain a heavy chain but no light chain. Thus antigen recognition is determined by a single variable domain, unlike a mammalian native antibody.
  • the constant domain of such antibodies can be omitted while retaining antigen binding activity.
  • One way of expressing single variable domain antibodies, at least for initial selection, is in the context of a phage display library or other combinatorial library.
  • An antibody of the invention may be a "domain antibody” (dAb).
  • dAbs are based on the variable domains of either a heavy or light chain of a human antibody and have a molecular weight of approximately 13 kDa (less than one-tenth the size of a full antibody).
  • dAbs are cleared from the body quickly and so benefit from a sustained release system, but can additionally be sustained in circulation by fusion to a second dAb that binds to a blood protein ⁇ e.g. to serum albumin), by conjugation to polymers ⁇ e.g. to a polyethylene glycol), or by other techniques.
  • the antibody may have a scaffold which is based on the fibronectin type III domain e.g. an adnectin or trinectin.
  • the fibronectin-based scaffold is not an immunoglobulin, although the overall fold is closely related to that of the smallest functional antibody fragment. Because of this structure the non- immunoglobulin antibody mimics antigen binding properties that are similar in nature and affinity to those of natural antibodies.
  • the Fnlll domain has 7 or 8 beta strands which are distributed between two beta sheets, which themselves pack against each other to form the core of the protein, and further containing loops (analogous to antibody CDRs) which connect the beta strands to each other and are solvent exposed.
  • the Fnlll loops can be replaced with immunoglobulin CDRs using standard cloning techniques, and can be used in a loop randomization and shuffling strategy in vitro that is similar to the process of affinity maturation of antibodies in vivo.
  • the Fnlll scaffold may be based on the tenth module of fibronectin type III (i. e. 10 Fn3).
  • antibody encompasses a range of proteins having diverse structural features, but usually including at least one immunoglobulin domain, having an all- ⁇ protein fold with a 2 layer sandwich of anti-parallel ⁇ -strands arranged in two ⁇ -sheets.
  • Antibodies used with the invention may include a single antigen binding site (e.g. as in a Fab fragment or a scFv) or multiple antigen binding sites (e.g. as in a F(ab')2 fragment or a diabody or a native antibody). Where an antibody has more than one antigen binding site then advantageously it can result in cross-linking of antigens.
  • the antibody may be mono specific
  • antigen-binding sites recognize the same antigen
  • it may be multi specific (i. e. the antigen- binding sites recognise more than one antigen).
  • An antibody of the invention may include a non-protein substance e.g. via covalent conjugation.
  • an antibody may include a radio isotope e.g. the ZEVALINTM and BEXXARTM products include 90 Y and 13 T isotopes, respectively.
  • an antibody may include a cytotoxic molecule e.g. MYLOTARGTM is linked to N-acetyl- ⁇ calicheamicin, a bacterial toxin.
  • an antibody may include a covalently-attached polymer e.g. attachment of polyoxyethylated polyols or polyethylene glycol (PEG) has been reported to increase the circulating half- life of antibodies.
  • PEG polyethylene glycol
  • an antibody can include one or more constant domains (e.g. including
  • the constant domains may form a ⁇ or ⁇ light chain or an ⁇ , ⁇ , ⁇ , ⁇ or ⁇ heavy chain.
  • an antibody may be a native constant domain or a modified constant domain.
  • a heavy chain may include either three (as in ⁇ , ⁇ , ⁇ classes) or four (as in ⁇ , ⁇ classes) constant domains.
  • Constant domains are not involved directly in the binding interaction between an antibody and an antigen, but they can provide various effector functions, including but not limited to: participation of the antibody in antibody dependent cellular cytotoxicity (ADCC); Clq binding; complement dependent cytotoxicity; Fc receptor binding; phagocytosis; and down regulation of cell surface receptors.
  • ADCC antibody dependent cellular cytotoxicity
  • Clq binding complement dependent cytotoxicity
  • Fc receptor binding phagocytosis
  • down regulation of cell surface receptors including but not limited to: participation of the antibody in antibody dependent cellular cytotoxicity (ADCC); Clq binding; complement dependent cytotoxicity; Fc receptor binding
  • the constant domains can form a "Fc region", which is the C-terminal region of a native antibody's heavy chain.
  • an antibody of the invention may be a native Fc region or a modified Fc region.
  • a Fc region is important for some antibodies' functions e.g. the activity of HERCEPTINTM is Fc dependent.
  • the boundaries of the Fc region of a native antibody may vary, the human IgG heavy chain Fc region is usually defined to stretch from an amino acid residue at position Cys226 or Pro230 to the heavy chain's C-terminus.
  • the Fc region will typically be able to bind one or more Fc receptors, such as a FcyRI (CD64), a FcyRII (e.g.
  • the Fc region may also or alternatively be able to bind to a complement protein, such as Clq. Modifications to an antibody's Fc region can be used to change its effector function(s) e.g. to increase or decrease receptor binding affinity.
  • Antibodies will typically be glycosylated. N-linked glycans attached to the CH2 domain of a heavy chain, for instance, can influence Clq and FcR binding, with aglycosylated antibodies having lower affinity for these receptors.
  • the glycan structure can also affect activity e.g. differences in complement-mediated cell death may be seen depending on the number of galactose sugars (0, 1 or 2) at the terminus of a glycan's biantennary chain.
  • An antibody's glycans preferably do not lead to a human immunogenic response after administration.
  • Antibodies can be prepared in a form free from products with which they would naturally be associated. Contaminant components of an antibody's natural environment include materials such as enzymes, hormones, or other host cell proteins.
  • Useful antibodies have nanomolar or picomolar affinity constants for their target antigens e.g. 10 "9 M, 10 "10 M, 10 "n M, 10 "12 M, 10 “13 M or tighter).
  • Such affinities can be determined using conventional analytical techniques e.g. using surface plasmon resonance techniques as embodied in BIAcoreTM instrumentation and operated according to the manufacturer's instructions.
  • the monoclonal antibody used with the invention may be a human antibody, a humanized antibody, a chimeric antibody or (e.g. for veterinary purposes) a non-human antibody.
  • the antibodies are human mAbs. These can be prepared by various means.
  • human B cells producing an antigen of interest can be immortalized e.g. by infection with Epstein Barr Virus (EBV), optionally in the presence of a polyclonal B cell activator.
  • EBV Epstein Barr Virus
  • Human monoclonal antibodies can also be produced in non-human hosts by replacing the host's own immune system with a functioning human immune system e.g. into Scid mice or Trimera mice.
  • Transgenic and transchromosomic mice have been successfully used for generating human monoclonal antibodies, including the "humab mouse” from Medarex and the "xeno-mouse" from Abgenix, collectively referred to herein as "human Ig mice”. Phage display has also been successful for this purpose.
  • human antibodies will not elicit an immune response directed against their constant domains when administered to humans.
  • the variable domains of these human antibodies are fully human (in particular the framework regions of the variable domains are fully human, in addition to the complementarity determining regions [CDRs]) and so will not elicit an immune response directed against the variable domain framework regions when administered to humans (except, potentially, for any anti-idiotypic response).
  • Human antibodies do not include any sequences that do not have a human origin.
  • the antibodies are humanised mAbs, CDR-grafted mAbs or chimeric mAbs. These can be prepared by various means. For example, they may be prepared based on the sequence of a non-human (e.g. murine) monoclonal antibody. DNA encoding the non-human heavy and light chain immunoglobulins can be obtained and engineered to contain human immunoglobulin sequences using standard molecular biology techniques. For example, to create a chimeric antibody, the murine variable regions can be linked to human constant regions using methods known in the art. To create a CDR-grafted antibody, the murine CDR regions can be inserted into a human framework.
  • a non-human (e.g. murine) monoclonal antibody DNA encoding the non-human heavy and light chain immunoglobulins can be obtained and engineered to contain human immunoglobulin sequences using standard molecular biology techniques.
  • the murine variable regions can be linked to human constant regions using methods known in the art.
  • one or more non-CDR variable framework residue(s) is also altered.
  • the HI, H2 and H3 CDRs may be transferred together into an acceptor VH domain, but it may also be adequate to transfer only one or two of them.
  • one two or all three of the LI, L2 and L3 CDRs may be transferred into an acceptor VL domain.
  • Preferred antibodies will have 1 , 2, 3, 4, 5 or all 6 of the donor CDRs. Where only one CDR is transferred, it will typically not be the L2 CDR, which is usually the shortest of the six.
  • the donor CDRs will all be from the same human antibody, but it is also possible to mix them e.g. to transfer the light chain CDRs from a first antibody and the heavy chain CDRs from a second antibody.
  • the antibodies are non-human mAbs. These can be prepared by various means e.g. the original Kohler & Milstein technique for preparing murine mAbs.
  • the invention also provides a method for raising antibodies using: isolated HCMV membrane protein complexes of the invention or purified HCMV membrane protein complexes of the invention.
  • These antibodies may be human or humanised.
  • these antibodies are specific to the isolated HCMV membrane protein complexes of the invention, and do not bind to isolated gH, gL, gO, pUL128, pUL130 or pUL131A.
  • Such antibodies may be used for diagnostic assays, and may be labelled directly or indirectly.
  • a wide range of antibody labels are known in the art.
  • antibodies of the invention can be used for therapy, e.g. in the treatment of HCMV infection, and may be in the form of neutralizing antibodies, which can inhibit or neutralize the antigen's biological activity.
  • Recombinant as used herein to describe a polynucleotide means a polynucleotide of genomic, cDNA, semisynthetic, or synthetic origin which, by virtue of its origin or manipulation: (1) is not associated with all or a portion of the polynucleotide with which it is associated in nature; and/or (2) is linked to a polynucleotide other than that to which it is linked in nature.
  • the term "recombinant” as used with respect to a protein or polypeptide means a polypeptide produced by expression of a recombinant polynucleotide.
  • composition comprising X may consist exclusively of X or may include something additional e.g. X + Y.
  • animal (and particularly bovine) materials are used in the culture of cells, they should be obtained from sources that are free from transmissible spongiform encaphalopathies (TSEs), and in particular free from bovine spongiform encephalopathy (BSE). Overall, it is preferred to culture cells in the total absence of animal-derived materials.
  • TSEs transmissible spongiform encaphalopathies
  • BSE bovine spongiform encephalopathy
  • a compound is administered to the body as part of a composition then that compound may alternatively be replaced by a suitable prodrug.
  • a process for producing an isolated HCMV membrane protein complex comprising gH, gL and at least one additional HCMV glycoprotein, wherein said process comprises recombinant expression of said gH, gL and at least one more HCMV glycoprotein.
  • a process for expressing an HCMV membrane protein complex comprising gH, gL and at least one more HCMV glycoprotein by:
  • nucleic acid molecules which encode gH, gL and at least one more HCMV glycoprotein into an expression system
  • the process of claim 3 which comprises the step of transfecting cells with a first nucleic acid construct which encodes a fragment of gH that lacks the transmembrane domain, a second nucleic acid construct which encodes the gL protein; and a third nucleic acid construct which encodes at least one more HCMV glycoprotein.
  • a first nucleic acid construct which encodes a fragment of gH that lacks the transmembrane domain
  • a second nucleic acid construct which encodes the gL protein
  • a third nucleic acid construct which encodes at least one more HCMV glycoprotein.
  • a process for producing a purified HCMV membrane protein complex comprising gH, gL and at least one more HCMV glycoprotein, wherein said process comprises expressing said HCMV membrane protein complex according to the process of claim 3 and purifying the isolated HCMV membrane protein complex.
  • HCMV membrane protein complex consists of gH, gL and gO.
  • HCMV membrane protein complex consists of gH, gL, pUL128, pUL130 and pUL131A.
  • said gH comprises or consists of any one of the sequences recited in SEQ ID NOs: 1, 2, 3, 4, 6, 29 or 30; and/or said gL comprises or consists of any one of the sequences recited in SEQ ID NOs: 7, 8, 9 or 31.
  • pUL128 comprises or consists of any one of the sequences recited in SEQ ID NOs: 13, 14, 15 or 33;
  • pUL130 comprises or consists of any one of the sequences recited in SEQ ID NOs: 16, 17 or 34; and/or
  • pUL131A comprises or consists of any one of the sequences recited in SEQ ID NOs: 18, 19, 20 or 35.
  • gH comprises or consists of sequences which is at least 70% identical to any one of the sequences recited in SEQ ID NOs: 1, 2, 3, 4, 6, 29 or 30; and/or
  • gL comprises or consists of sequences which is at least 70% identical to any one of the sequences recited in SEQ ID NOs: SEQ ID NOs: 7, 8, 9 or 31.
  • said gO comprises or consists of sequences which is at least 70% identical to any one of the sequences recited in SEQ ID NOs: SEQ ID NOs: 10, 11, 12 or 32.
  • pUL128 comprises or consists of sequences which is at least 70% identical to any one of the sequences recited in SEQ ID NOs: 13, 14, 15 or 33;
  • pUL130 comprises or consists of sequences which is at least 70% identical to any one of the sequences recited in SEQ ID NOs: 16, 17 or 34; and/or
  • pUL131A comprises or consists of sequences which is at least 70% identical to any one of the sequences recited in SEQ ID NOs: 18, 19, 20 or 35.
  • chromatographic steps comprise affinity chromatography, preferably Ni 2+ affinity chromatography and/or size exclusion chromatography.
  • HCMV membrane protein complex has a purity of >85%, >86%, >87%, >88%, >89%, >90%, >91%, >92%, >93%, >94% or >95% by mass.
  • a purified HCMV membrane protein complex comprising gH, gL and at least one more HCMV glycoprotein.
  • HCMV membrane protein complex comprising gH, gL and at least one more HCMV glycoprotein, wherein said complex is produced by the process of any preceding claim.
  • composition comprising the isolated HCMV membrane protein complex of claim 18 or claim 19.
  • An immunogenic composition comprising:
  • RNA molecule that encodes an HCMV membrane protein complex
  • HCMV membrane protein complex of claim 18 or claim 19.
  • a kit comprising:
  • a priming composition comprising a self-replicating RNA molecule that encodes an HCMV membrane protein complex
  • a boosting composition comprising the HCMV membrane protein complex of claim 18 or claim 19.
  • a recombinant nucleic acid molecule which encodes gL, gH that lacks a transmembrane domain, and at least one additional HCMV glycoprotein, wherein said recombinant nucleic acid:
  • (a) is not a self-replicating RNA molecule
  • (b) is not an alphavirus replicon
  • (c) does not encode any alphavirus nonstructural proteins, such as NSP1, NSP2, NSP3 and
  • (d) does not contain: an Internal Ribosomal Entry Site (IRES), such as EMCV or EV71 ; and/or
  • IRS Internal Ribosomal Entry Site
  • (e) does not contain a viral 2A site, such as FMDV.
  • a plurality of recombinant nucleic acids wherein said plurality of recombinant nucleic acids encode gL, gH that lacks a transmembrane domain, and at least one additional HCMV glycoprotein, wherein one or more or all of said plurality of recombinant nucleic acids: (a) is not a self-replicating RNA molecule;
  • (b) is not an alphavirus replicon
  • (c) does not encode any alphavirus nonstructural proteins, such as NSP1, NSP2, NSP3 and
  • (d) does not contain: an Internal Ribosomal Entry Site (IRES), such as EMCV or EV71 ; and/or
  • IRS Internal Ribosomal Entry Site
  • (e) does not contain a viral 2A site, such as FMDV.
  • a second recombinant nucleic acid molecule which encodes a fragment of gH that lacks a transmembrane domain
  • one or more third recombinant nucleic acid molecules which encode one or more additional HCMV proteins.
  • nucleic acid molecule which encodes gH is 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the sequence recited in SEQ ID NO: 24;
  • nucleic acid molecule which encodes gL is 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the sequence recited in SEQ ID NO: 25;
  • said nucleic acid molecule which encodes pUL128 is 74%, 76%, 78%, 80%, 82%, 84%, 86%, 88%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the sequence recited in SEQ ID NO: 26;
  • said nucleic acid molecule which encodes pUL130 is 74%, 76%, 78%, 80%, 82%, 84%, 86%, 88%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the sequence recited in SEQ ID NO: 27; and/or (e) said nucleic acid molecule which encodes pUL131A is 74%, 76%, 78%, 80%, 82%, 84%, 86%, 88%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the sequence recited in SEQ ID NO: 28.
  • the cell of claim 41 wherein said cell is stably transformed with said recombinant nucleic acid or plurality of recombinant nucleic acids.
  • a cell comprising gH, gL and at least one additional HCMV glycoprotein, wherein said cell does not:
  • (c) contain self-replicating RNA molecules encoding said gH, gL and at least one additional HCMV glycoprotein;
  • a process for producing an isolated or a purified HCMV membrane protein complex comprising gH, gL and at least one additional HCMV glycoprotein wherein said process involves growing the cell of any one of claims 41 -44 in growth medium.
  • HCMV membrane protein complex accumulates to a concentration of >0.8 mg, >0.85 mg, >0.88mg, >0.9 mg, >0.95 mg, >lmg, >1.5mg, >2mg, >2.5mg, >3mg, >3.5mg, >4mg, >4.5mg, >5mg of complex per litre of growth medium.
  • RNA prime-protein boost regimen comprising:
  • RNA that encodes one or more of the protein components of an HCMV membrane protein complex, wherein said HCMV membrane protein complex comprises gH, gL and at least one additional HCMV glycoprotein;
  • FIG. 1 shows the plasmid map of the 7591 bp construct used for the expression of His-tagged, soluble gH in mammalian cells.
  • the nucleotide sequence of this construct is given as SEQ ID NO: 23.
  • the construct comprises a CMV promoter, a gene which encodes SEQ ID NO: 4 (the gH soluble protein, which consists of amino acid residues 1-715 of the full-length gH protein) fused to a myc- polyhistidine tag, bovine growth hormone (BGH) polyadenylation (bgh-PolyA) signal termination sequence, F 1 phage origin of replication, SV40 origin of replication, Neomycin resistance gene, pUC subgenomic promoter and an ampicillin resistance gene.
  • BGH bovine growth hormone
  • bgh-PolyA bovine growth hormone
  • FIG. 2 shows the plasmid map of the 5156 bp construct used for the expression of gL in mammalian cells.
  • the nucleotide sequence of this construct is given as SEQ ID NO: 24.
  • the construct comprises a CMV promoter/enhancer which contains intronA, a gene which encodes SEQ ID NO: 7 (gL), bovine growth hormone (BGH) polyadenylation (bgh-PolyA) signal termination sequence, a kanamycin resistance gene and the ColEl origin of replication.
  • BGH bovine growth hormone
  • bgh-PolyA bovine growth hormone
  • FIG. 3 shows the plasmid map of the 4835 bp construct used for the expression of UL128 in mammalian cells.
  • the nucleotide sequence of this construct is given as SEQ ID NO: 25.
  • the construct comprises a CMV promoter/enhancer which contains intronA, the UL128 gene, bovine growth hormone (BGH) polyadenylation (bgh-PolyA) signal termination sequence, a kanamycin resistance gene and the ColEl origin of replication.
  • BGH bovine growth hormone
  • bgh-PolyA bovine growth hormone polyadenylation
  • FIG. 4 shows the plasmid map of the 4964 bp construct used for the expression of UL130 in mammalian cells.
  • the nucleotide sequence of this construct is given as SEQ ID NO: 26.
  • the construct comprises a CMV promoter/enhancer which contains intronA, the UL130 gene, bovine growth hormone (BG11) polyadenylation (bgh-PolyA) signal termination sequence, a kanamycin resistance gene and the ColEl origin of replication.
  • BG11 bovine growth hormone
  • bgh-PolyA bovine growth hormone polyadenylation
  • FIG. 5 shows the plasmid map of the 4709 bp construct used for the expression of UL131A in mammalian cells.
  • the nucleotide sequence of this construct is given as SEQ ID NO: 27.
  • the construct comprises a CMV promoter/enhancer which contains intronA, the UL131A gene, bovine growth hormone (BGH) polyadenylation (bgh-PolyA) signal termination sequence, a kanamycin resistance gene and the ColEl origin of replication.
  • BGH bovine growth hormone
  • bgh-PolyA bovine growth hormone polyadenylation
  • FIG. 6 lanes A-C correspond to a silver-stained SDS-PAGE, whereas lanes E-K correspond to Western blot analysis.
  • the ladder is shown in lanes A, E and H.
  • Lanes B, F and I correspond to samples that have been briefly heated to near boiling in the presence of dithiothreitol (DTT), whereas lanes C, G and K correspond to samples that have not been subjected to heat or DTT.
  • DTT dithiothreitol
  • FIG. 7 shows a size exclusion chromatogram. All five proteins were eluted as a single peak, thus demonstrating the presence of an intact pentameric complex.
  • FIG. 8 shows SDS-PAGE and Western blot analysis.
  • FIG. 9 shows a comparison between the neutralization titers elicited by gH/gL either alone or formulated with MF59 versus those elicited by the pentameric complex either alone or formulated with MF59.
  • Purified pentameric complex formulated with MF59 elicited higher neutralizing titers than the unformulated protein.
  • FIG. 10 shows the neutralization titers elicited by pentameric complex alone (A) and pentameric complex formulated with MF59 (B), aluminium oxyhydroxide (C) and aluminium hydroxide to which a TLR7 agonist is adsorbed (D).
  • FIG. 11 is a graph showing that self amp liyfying RNA and subunit, alone or in combination, elicit high neutralizing antibody titers.
  • the neutralization titers elicited by: the self amplifying RNA (self replicating RNA, encapsulated in LNPs) encoding the HCMV pentameric complex; purified pentameric subunit adjuvanted with MF59; different sequences of self amplifying RNA followed by subunit in MF59; or a combination of self amplifying RNA and subunit are shown.
  • Self amplifying RNA and subunit dose were ⁇ g, mixed dose was 1+1 ⁇ g.
  • Neutralizing assay VR1814 infection of ARPE-19 cells in presence of complement.
  • FIG. 12 are graphs showing the CD4+ T cell responses (in terms of the net % of CD4+ T cells, and the % of ThO, Thl and Th2 CD4) to the vaccinations using purified gH/gL and pentameric subunits at (A) 3wp3 (day 64) and (B) 4wp3 (day 71).
  • FIG. 13 are graphs showing the CD4+ T cell responses (in terms of the net % of CD4+ T cells) to the vaccinations using purified pentameric complex at (A) 3wp3 (day 64) and (B) 4wp3 (day 71).
  • FIG. 14 are graphs showing the CD8+ T cell responses (in terms of the net % of CD8+ T cells) to the vaccinations using purified pentameric complex at (A) 3wp3 (day 64) and (B) 4wp3 (day 71).
  • FIG. 15 are graphs showing the CD8+ T cell responses (in terms of the net % of CD8+ T cells) to the vaccinations using gH peptide pool 2 at (A) 3wp3 (day 64) and (B) 4wp3 (day 71).
  • WO 2012/051211 an alphavirus replicon vector expressing all five proteins of the pentameric complex (gH, gL, pUL128, pUL130 and pUL131A) from a single construct was produced.
  • the RNAs expressed by this vector were either packaged into VRPs or formulated for RNA vaccination either by complexing replicons with CNEs or by encapsulating replicons in LNPs.
  • the VRPs and formulated RNAs were used to immunize BALB/c mice at three-week intervals. Sera from immunized mice were used in microneutralization assays to block infection of epithelial cells with HCMV TB40 (in the absence of complement).
  • the HCMV TB40 strain is similar to clinical strains and infects endothelial and epithelial cells, natural target cells of HCMV in vivo (17).
  • Microneutralization assay data demonstrated that replicons expressing the pentameric complex elicited more potently neutralizing antibodies than replicons expressing gH/gL.
  • Microneutralisation data also showed that antibodies elicited by RNA expressing pentameric complex are able to neutralize HCMV infection in epithelial cells (because they target the pentameric complex), but not in fibroblasts (in which infection does not require the pentameric complex), thus demonstrating that RNA expressing the pentameric complex elicits antibodies that specifically target the intact pentameric complex rather than a gH/gL dimer.
  • This work demonstrates that antibodies can be raised against the pentameric complex, and these antibodies are capable of neutralizing HCMV infection.
  • Example 2 Constructs for stable expression of the pentameric complex in mammalian cells
  • nucleic acid constructs were produced to enable to expression and purification of the pentameric complex in mammalian cells. Previous attempts to purify the pentameric complex when constructs including the gene encoding the full-length gH protein were unsuccessful. In an attempt to overcome this problem, the inventors produced constructs that encode only the ectodomain of gH (gHecto) with a C-terminal myc-(His)6 tag (SEQ ID NO: 6) rather than the full-length sequence. The following five constructs were used to produce the pentameric complex: a construct encoding SEQ ID NO: 6 (Fig. 1 and SEQ ID NO: 23), a construct encoding full-length gL (Fig.
  • Mammlian 293-6E cells (Gibco FreeStyle 293 Expression Medium; Opti-MEM and Polyethylenimine Linear (PEI), MW 25,000.
  • 293-6E cells were maintained in serum-free 293 Expression Medium. Once the cells are doubling every 24 hours and at more than 90% viability, the cells were diluted to a density of lxl 0 6 /lmL media.
  • DNA corresponding to each construct was diluted in Opti-MEM using a volume of Opti-MEM that is 2.5% of the volume of cell culture to be transfected.
  • DNA constructs were combined in an appropriate ratio such that total DNA was equal to 1 ⁇ g /l mL culture volume. For example, for the stable expression of the pentameric complex using 1 L cell culture, 200 ⁇ g of each of SEQ ID NOs: 23-27 were added to 25 mL Opti-MEM.
  • PEI was diluted in Opti-MEM using a volume of Opti-MEM that is 2.5% the volume of cell culture to be transfected. The diluted PEI was incubated for 5 min at room temperature with occasional swirling to mix. 3 ⁇ g PEI was used per lmL culture ⁇ e.g., for 1L cell culture 3mg PEI was diluted in 25mL Opti-MEM).
  • the DNA mix was added to the PEI mix (so that 1 ⁇ g total DNA + 3 ⁇ g PEI were used per 1 mL culture), swirled and incubated at room temperature for 30min.
  • the DNA-PEI mix was added to cells by gradually adding mixture and swirling cells occasionally such that mixture was added evenly to culture. The cells were then immediately returned to the original growth conditions.
  • the media was harvested by spinning the cells down at 2,000 rpm. The media was then concentrated approximately lOx and diafiltered into buffer containing 300mM NaCl, 25mM Tris pH 7.5. Finally, the dialyzed media was frozen at -80° C. Fresh media were added to the culture and three more days later the media was harvested and concentrated/diafiltered as above.
  • Buffers were prepared with endotoxin- free stock solutions and filtered Milli-Q water.
  • the medium to be purified was thawed in a warm water bath. Meanwhile AKTAxpress was cleaned with 0.5M NaOH, to get rid of possible endotoxin contamination as well as residual protein/media, and then rinsed with filtered endotoxin- free Milli-Q water.
  • Ni-NTA superflow cartridge was connected to the AKTAxpress system, and the water and buffers A and B were set in place.
  • the program "Ni-NTA prep” was then started in order to flush the system with buffers, wash away ethanol in the column, and run buffer A through the column to equilibrate it.
  • the fraction collecting 96-well was prepared by putting 3.5 ⁇ 1 500mM EDTA solution in each well.
  • the loading sample was also prepared immediately before loading. When the medium had thawed, 1/500 volume of 2.5M Imidazole stock was added, and mixed gently. The loading sample was then set in place.
  • the sample loading rate was 2.5 ml/min, whereas the wash and elution rate was 5 mL/ min. The flow through in whole and 1.75 ml each of fractions from wash and elution were collected).
  • SEC size exclusion chromatography
  • gH ectodomain with C-terminal APP tag full- length gL and full-length gO with a C-terminal (His)6 tag.
  • These three constructs were co-expressed in HEK 293 cells according to the method described in Example 3.
  • the purification method of Example 4 involving Ni 2+ affinity chromatography, was performed.
  • the purified samples were then subjected to SDS-PAGE, followed by Western blot analysis using anti-APPtag (gH), anti-gL and anti-6His (gO) antibodies.
  • anti-APPtag gH
  • anti-gL and anti-6His (gO) antibodies were then subjected to SDS-PAGE, followed by Western blot analysis using anti-APPtag (gH), anti-gL and anti-6His (gO) antibodies.
  • These three antibodies bound to different proteins under reducing conditions (+heat, +DTT), but all bound to a single complex in non-reducing conditions (-heat, -DTT).
  • HEK293 cells were co-transfected with the five constructs described in Example 2 according to the method described in Example 3, the media were harvested 3 and 6 days post transfection, and the expressed protein was purified by Ni-NTA chromatography according to the method of Example 4.
  • Three sets of antibodies were used, one for the detection of gHecto-His/gL, one for the detection of pUL128/pUL131A, and one for the detection of pUL130.
  • Primary antibody solutions consisted of: (A) 1 :10000 dilution of anti-His tag and 1 :5000 dilution of anti-gL, (B) 1 :500 dilution of anti-pUL128 and 1 : 1000 dilution of anti-UL131A, and (C) 1 :500 dilution of anti-UL130, all diluted in 1 :1 mixture of the blocking buffer and DPBS.
  • the membranes were rinsed three times with PBS + 0.1% Tween at RT, and then incubated with secondary antibody solutions at RT for lhr.
  • membranes (A) and (B) 1 :25000 dilution each of anti-mouse and anti-rabbit antibodies in a 1 :1 mixture with the blocking buffer and DPBS was used.
  • membrane (C) 1 :25000 dilution of anti-mouse antibodies were used only. The membranes were rinsed three times with PBS+ 0.1% Tween at RT, and then rinsed with DPBS once at RT. The membrane was scanned with Odyssey Infrared Imaging System (Li-Cor 9201) and analyzed using Odyssey software version 2.1.12.
  • gHecto-His, gL and pUL128 co-migrate in an SDS Bis-tris gel without heat nor DTT, but the association of pUL128 and gH/gL completely disappears in the presence of DTT (data not shown), thus demonstrating that pUL128 associates with gH/gL through a disulfide bond.
  • pUL130/pUL131A does not co-migrate with gH/gL/pUL128, indicating that it is incorporated into the pentameric complex by non-covalent bonds.
  • the most dominant band on the gels was near the gH/gL complex position with non-reducing, non-boiling conditions, and was thus thought to correspond to the HCMV pentameric complex.
  • the purity was estimated to be 90%, by mass. With SEC purification the purity increased to nearly 100%. Approximately 0.6 mg of pentameric complex per litre of media could be purified by Ni-NTA purification.
  • Example 8 Recombinant pentameric complex binds to conformation dependent neutralizing antibodies
  • HumAb human neutralizing antibodies
  • Example 9 The pentameric complex elicits higher neutralizing titers than gH/gL
  • 0.1/1 ⁇ g purified gH/gL and 0.16 ⁇ g/1.6 ⁇ g pentameric complex protein were formulated with or without MF59 and used for immunization of mice.
  • the neutralizing titer of 3wp3 showed approximately a 4-fold increase for pentameric complex compared with gH/gL (which in turn elicits higher neutralizing titers compared with gB) (Fig. 9).
  • Purified pentameric complex formulated with MF59 elicited higher neutralizing titers than the unformulated protein (Fig. 9).
  • the purified gH/gL/gO complex is diluted to 0.4 mg/mL in 150 mM NaCl, 25 mM Tris (pH 7.5), 1 mM EDTA and frozen.
  • the gH/gL/gO complex is thawed on the day of vaccination and 438 ⁇ of adjuvant is added to the thawed gH/gL/gO complex and mixed well by inverting the tubes at least 10 times. The resulting composition is used within 1 hour of mixing.
  • mice Two groups of three 6-8 week-old female BALB/c mice are immunized with a composition comprising 50 ⁇ g purified gH/gL/gO, and MF59 adjuvant. Each mouse is immunized with 125 in each quadriceps muscle ⁇ i. e. each mouse received 250 ⁇ ) and bled from their orbital sinuses.
  • the gH/gL/gO antigen is used for primary ELISA screening and then the positive clones from the primary screening are then further screened using the gH/gL antigen.
  • a similar method can be employed to produce monoclonal antibodies using the purified pentameric complex as an antigen.
  • Example 11 A SAMTM Vaccine Prime, Protein Boost and Coadministration of RNA and subunit Using the HCMV Pentameric Antigen
  • mice were immunized three times, three weeks apart with a SAM vaccine, which is a self- replicating RNA as described herein, encoding the HCMV pentameric complex, purified pentameric subunit adjuvanted with MF59, different sequences of SAM vaccine followed by subunit in MF59, or a combination of the two (Table 3).
  • the SAM vaccine was encapsulated in synthetic LNPs for non- viral delivery. A group of control mice did not receive any vaccine.
  • Sera were harvested three weeks after each immunization and used for ELISA to determine binding antibody titers, using the same purified antigen in the assay as in the subunit vaccine. The sera were also used for HCMV microneutralization assay using TB40 or VR1814 infection of ARPE- 19 epithelial cells. Three or four weeks after the third immunization, spleens were extracted from sacrificed mice. Spleen cells were stimulated in vitro with purified protein or a pool of 15-mer peptides (overlapping by 11 amino acids) corresponding to the c-terminal half of the gH protein, stained for cytokine expression, and analyzed using flow cytometry.
  • SAM vaccine and subunit/MF59 alone elicited potently neutralizing antibody responses after three doses (Figure 11).
  • the pentameric subunit in MF59 did not respond as well as pentameric SAM vaccine to the first and second dose of vaccine, but titers elicited by subunit/MF59 surpassed titers elicited by SAM vaccine after the third dose.
  • One SAM vaccine prime followed by a single dose of subunit/MF59 elicited stronger neutralizing responses than two doses of subunit/MF59, but was equal to SAM alone.
  • a second subunit/MF59 boost administered to these animals raised neutralizing responses to a level that exceeded those seen after three doses of subunit/MF59 or SAM vaccine.
  • CD4+ T cell responses to the vaccinations using purified gH/gL and pentameric subunits were analyzed.
  • SAM vaccine prime protein boost and mixed SAM vaccine + subunit elicited more CD4+ T cells responding to gH/gL re-stimulation than SAM vaccine or subunit/MF59 alone (Figure 12).
  • CD4+ responses to RNA alone were insignificant, whereas responses to subunit/MF59 alone were Th2/Th0 phenotype.
  • the phenotype of the responding cells from mice immunized combinations of SAM vaccine and subunit was primarily Thl/ThO. Similar trends were seen when re-stimulating cells with purified pentameric complex, although the responses were generally stronger (Figure 13).
  • CD8+ T cell responses to the vaccinations using purified pentameric subunit or a pool of peptides to gH were also analyzed.
  • Cells from these animals also showed the strongest responses when re-stimulated with gH peptides ( Figure 15).
  • SEQ ID NO: 4 (gH protein consisting of amino acid residues 1-715 of SEQ ID NO: 1)
  • SEQ ID NO: 5 C-terminal extension which includes a myc-tag and a polyhistidine-tag
  • SEQ ID NO: 6 (gH protein comprising SEQ ID NOs : 4 and 5)
  • MSPKNLTPFLTALWLLLGHSRVPRVRAEECCEFINVNHPPERCYDFKMCNRFTVALRCPDGEVCYSPEKTAEIRGIV TTMTHSLTRQWHNKLTSCNYNPLYLEADGRIRCGKVNDKAQYLLGAAGSVPYRWINLEYDKITRIVGLDQYLESVK KHKRLDVCRAKMGYMLQ SEQ ID NO: 15 (pUL128 from HCMV strain AD169 GI : 59803078)
  • SEQ ID NO: 24 (a construct encoding gH(ecto) fused to a C-terminal myc- (His) 6 tag)
  • SEQ ID NO: 25 (a construct encoding full-length gL)
  • SEQ ID NO: 26 (a construct encoding full-length pUL128)
  • SEQ ID NO: 28 (a construct encoding full-length pUL131A)
  • SEQ ID NO: 29 (gH mature protein consisting of amino acid residues 24-715 of SEQ ID NO: 1)
  • SEQ ID NO: 30 (gH mature protein comprising SEQ ID NOs : 29 and 5)
  • SEQ ID NO: 32 (gO mature protein consisting of amino acid residues 31-472 of SEQ ID NO: 10)
  • SEQ ID NO: 33 (pUL128 mature protein consisting of amino acid residues 28-171 of SEQ ID NO: 14 and 15)
  • SEQ ID NO: 34 (pUL130 mature protein consisting of amino acid residues 26-214 of SEQ ID NO: 16)
  • SEQ ID NO: 36 (gB mature protein consisting of amino acid residues 23-907 of SEQ ID NO: 21)

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Virology (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Microbiology (AREA)
  • Immunology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biochemistry (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Molecular Biology (AREA)
  • Mycology (AREA)
  • Epidemiology (AREA)
  • Biotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biomedical Technology (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Oncology (AREA)
  • Communicable Diseases (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
PCT/EP2013/063750 2012-07-06 2013-06-29 Complexes of cytomegalovirus proteins Ceased WO2014005959A1 (en)

Priority Applications (20)

Application Number Priority Date Filing Date Title
AU2013286093A AU2013286093B2 (en) 2012-07-06 2013-06-29 Complexes of cytomegalovirus proteins
MX2014015496A MX355469B (es) 2012-07-06 2013-06-29 Complejos de proteinas de citomegalovirus.
KR1020157002267A KR20150031322A (ko) 2012-07-06 2013-06-29 사이토메갈로바이러스 단백질의 복합체
CN201380036145.0A CN104853771A (zh) 2012-07-06 2013-06-29 巨细胞病毒蛋白的复合物
ES13736518T ES2753138T3 (es) 2012-07-06 2013-06-29 Complejos de proteínas de citomegalovirus
EP13736518.5A EP2869843B1 (en) 2012-07-06 2013-06-29 Complexes of cytomegalovirus proteins
JP2015519155A JP2015522581A (ja) 2012-07-06 2013-06-29 サイトメガロウイルスタンパク質の複合体
IN2929KON2014 IN2014KN02929A (https=) 2012-07-06 2013-06-29
RU2015103891A RU2015103891A (ru) 2012-07-06 2013-06-29 Комплексы белков цитомегаловируса
MX2018000675A MX378747B (es) 2012-07-06 2013-06-29 Complejos de proteínas de citomegalovirus.
US14/410,461 US9683022B2 (en) 2012-07-06 2013-06-29 Complexes of cytomegalovirus proteins
GB1413863.0A GB2513768B (en) 2012-07-06 2013-06-29 Complexes of cytomegalovirus proteins and nucleic acids encoding such proteins
CA2878344A CA2878344A1 (en) 2012-07-06 2013-06-29 Complexes of cytomegalovirus proteins
HK15110880.5A HK1210037A1 (en) 2012-07-06 2013-06-29 Complexes of cytomegalovirus proteins
SG11201408328VA SG11201408328VA (en) 2012-07-06 2013-06-29 Complexes of cytomegalovirus proteins
IL236261A IL236261A0 (en) 2012-07-06 2014-12-15 Complexes of cytomegalovirus proteins
ZA2014/09364A ZA201409364B (en) 2012-07-06 2014-12-18 Complexes of cytomegalovirus proteins
US15/596,066 US10287322B2 (en) 2012-07-06 2017-05-16 Complexes of cytomegalovirus proteins
US16/363,127 US20190211064A1 (en) 2012-07-06 2019-03-25 Complexes of cytomegalovirus proteins
US17/551,867 US20220106364A1 (en) 2012-07-06 2021-12-15 Complexes of cytomegalovirus proteins

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201261668975P 2012-07-06 2012-07-06
US61/668,975 2012-07-06
US201361770257P 2013-02-27 2013-02-27
US61/770,257 2013-02-27

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US14/410,461 A-371-Of-International US9683022B2 (en) 2012-07-06 2013-06-29 Complexes of cytomegalovirus proteins
US15/596,066 Division US10287322B2 (en) 2012-07-06 2017-05-16 Complexes of cytomegalovirus proteins

Publications (1)

Publication Number Publication Date
WO2014005959A1 true WO2014005959A1 (en) 2014-01-09

Family

ID=48783208

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2013/063750 Ceased WO2014005959A1 (en) 2012-07-06 2013-06-29 Complexes of cytomegalovirus proteins

Country Status (17)

Country Link
US (4) US9683022B2 (https=)
EP (1) EP2869843B1 (https=)
JP (3) JP2015522581A (https=)
KR (1) KR20150031322A (https=)
CN (1) CN104853771A (https=)
AU (1) AU2013286093B2 (https=)
CA (1) CA2878344A1 (https=)
ES (1) ES2753138T3 (https=)
GB (1) GB2513768B (https=)
HK (1) HK1210037A1 (https=)
IL (1) IL236261A0 (https=)
IN (1) IN2014KN02929A (https=)
MX (2) MX355469B (https=)
RU (1) RU2015103891A (https=)
SG (1) SG11201408328VA (https=)
WO (1) WO2014005959A1 (https=)
ZA (1) ZA201409364B (https=)

Cited By (28)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2015161926A1 (en) * 2014-04-23 2015-10-29 Institute For Research In Biomedicine Human cytomegalovirus vaccine compositions and method of producing the same
WO2015165480A1 (en) * 2014-04-30 2015-11-05 Institute For Research In Biomedicine Human cytomegalovirus vaccine compositions and method of producing the same
WO2015170287A1 (en) * 2014-05-08 2015-11-12 Redvax Gmbh Means and methods for treating cmv
EP3015475A1 (en) 2014-10-31 2016-05-04 Novartis AG Mammalian cells expressing cytomegalovirus antigens
EP3048114A1 (en) 2015-01-22 2016-07-27 Novartis AG Cytomegalovirus antigens and uses thereof
EP3047856A1 (en) * 2015-01-23 2016-07-27 Novartis AG Cmv antigens and uses thereof
US10022436B2 (en) 2016-01-11 2018-07-17 Verndari, Inc. Microneedle compositions and methods of using same
WO2018193307A1 (en) 2017-04-19 2018-10-25 Glaxosmithkline Biologicals Sa Modified cytomegalovirus proteins and stabilized complexes
WO2019052975A1 (en) 2017-09-13 2019-03-21 Sanofi Pasteur IMMUNOGENIC COMPOSITION AGAINST HUMAN CYTOMEGALOVIRUS
EP3364981A4 (en) * 2015-10-22 2019-08-07 ModernaTX, Inc. VACCINE AGAINST THE HUMAN CYTOMEGALOVIRUS
EP2869843B1 (en) 2012-07-06 2019-08-07 GlaxoSmithKline Biologicals SA Complexes of cytomegalovirus proteins
US10376575B2 (en) 2012-07-27 2019-08-13 City Of Hope MVA vaccine for delivery of a UL128 complex and preventing CMV infection
WO2019211630A2 (en) 2018-05-04 2019-11-07 SpyBiotech Limited Vaccine composition
US10487139B2 (en) 2015-09-10 2019-11-26 City Of Hope MVA-gh/gL-PC vaccine derived antibodies neutralizing human cytomegalovirus infectivity and methods thereof
US10611800B2 (en) 2016-03-11 2020-04-07 Pfizer Inc. Human cytomegalovirus gB polypeptide
WO2020079586A1 (en) 2018-10-17 2020-04-23 Glaxosmithkline Biologicals Sa Modified cytomegalovirus proteins and stabilized complexes
WO2021014385A1 (en) 2019-07-24 2021-01-28 Glaxosmithkline Biologicals Sa Modified human cytomegalovirus proteins
US11197927B2 (en) 2016-10-21 2021-12-14 Modernatx, Inc. Human cytomegalovirus vaccine
WO2022090359A1 (en) 2020-10-28 2022-05-05 Sanofi Pasteur Liposomes containing tlr4 agonist, preparation and uses thereof
RU2775424C2 (ru) * 2017-09-13 2022-06-30 Санофи Пастер Иммуногенная композиция цитомегаловируса человека
US11406703B2 (en) 2020-08-25 2022-08-09 Modernatx, Inc. Human cytomegalovirus vaccine
WO2022180500A3 (en) * 2021-02-24 2023-01-19 Pfizer Inc. Novel druggable regions in the human cytomegalovirus glycoprotein b polypeptide and methods of use thereof
US11629172B2 (en) 2018-12-21 2023-04-18 Pfizer Inc. Human cytomegalovirus gB polypeptide
WO2023144665A1 (en) 2022-01-28 2023-08-03 Glaxosmithkline Biologicals Sa Modified human cytomegalovirus proteins
US11857622B2 (en) 2020-06-21 2024-01-02 Pfizer Inc. Human cytomegalovirus GB polypeptide
US11964007B2 (en) 2017-07-28 2024-04-23 Janssen Vaccines & Prevention B.V. Methods and compositions for heterologous repRNA immunizations
US12290560B2 (en) 2018-12-10 2025-05-06 Km Biologics Co., Ltd. Vaccine for preventing or treating congenital infection with cytomegalovirus
US12569552B2 (en) 2020-06-09 2026-03-10 Km Biologics Co., Ltd. Fusion protein of pentamer and gB of cytomegalovirus, and vaccine containing said fusion protein

Families Citing this family (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2015048744A2 (en) 2013-09-30 2015-04-02 Moderna Therapeutics, Inc. Polynucleotides encoding immune modulating polypeptides
JP6818551B2 (ja) * 2013-12-03 2021-01-20 ホオキパ バイオテック ジーエムビーエイチ Cmvワクチン
US11572389B2 (en) * 2017-01-27 2023-02-07 The Henry M. Jackson Foundation For The Advancement Of Military Medicine, Inc. Vaccine compositions of herpesvirus envelope protein combinations to induce immune response
HUE073526T2 (hu) 2017-04-04 2026-01-28 Univ Washington Önmagát összeállító fehérje nanostruktúrák, amelyek paramyxovírus és/vagy pneumovírus F fehérjéket jelenítenek meg és azok használata
US11174322B2 (en) * 2017-07-24 2021-11-16 INSERM (Institut National de la Santé et de la Recherche Médicale) Antibodies and peptides to treat HCMV related diseases
WO2019169120A1 (en) 2018-02-28 2019-09-06 University Of Washington Self-asssembling nanostructure vaccines

Citations (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5608143A (en) 1989-03-17 1997-03-04 E. I. Du Pont De Nemours And Company External regulation of gene expression
US5659122A (en) 1993-09-02 1997-08-19 Monsanto Company Enhanced expression in plants using non-translated leader sequences
US5693506A (en) 1993-11-16 1997-12-02 The Regents Of The University Of California Process for protein production in plants
US5767250A (en) * 1992-07-29 1998-06-16 Chiron Corporation Complexes comprising truncated CMV gH polypeptides and escort proteins
WO2007146024A2 (en) * 2006-06-07 2007-12-21 The Trustees Of Princeton University Cytomegalovirus surface protein complex for use in vaccines and as a drug target
WO2011027222A2 (en) 2009-09-02 2011-03-10 Novartis Ag Immunogenic compositions including tlr activity modulators
WO2012006380A2 (en) 2010-07-06 2012-01-12 Novartis Ag Cationic oil-in-water emulsions
WO2012051211A2 (en) 2010-10-11 2012-04-19 Novartis Ag Antigen delivery platforms
WO2013006842A2 (en) * 2011-07-06 2013-01-10 Novartis Ag Immunogenic compositions and uses thereof

Family Cites Families (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1990006953A2 (en) 1988-12-22 1990-06-28 Genentech, Inc. Method for preparing water soluble polypeptides
WO1992002628A1 (en) 1990-08-02 1992-02-20 Chiron Corporation Expression of human cmv glycoprotein-h using the baculovirus-insect cell expression system
US5815900A (en) 1995-03-06 1998-10-06 Matsushita Electric Industrial Co., Ltd. Method of manufacturing a surface acoustic wave module
US20040228842A1 (en) * 2003-02-27 2004-11-18 Shan Lu Compositions and methods for cytomegalovirus treatment
US7947274B2 (en) * 2007-01-04 2011-05-24 Humabs, LLC. Human cytomegalovirus neutralising antibodies and use thereof
US9439960B2 (en) 2007-10-10 2016-09-13 The Trustees Of Princeton University Cytomegalovirus vaccines and methods of production
WO2011106607A2 (en) * 2010-02-26 2011-09-01 Juvaris Biotherapeutics, Inc. Subunit vaccines for herpes viruses and methods of use
ES2557382T3 (es) 2010-07-06 2016-01-25 Glaxosmithkline Biologicals Sa Liposomas con lípidos que tienen un valor de pKa ventajoso para el suministro de ARN
WO2012015211A2 (ko) 2010-07-30 2012-02-02 주식회사종근당 사이클로스포린 에이 함유 점안제 조성물
EP2614072A4 (en) * 2010-09-09 2014-03-19 Univ Virginia Commonwealth VACCINE AGAINST THE HUMAN CYTOMEGALOVIRUS
EA033467B1 (ru) * 2011-01-31 2019-10-31 Univ Pennsylvania Молекула нуклеиновой кислоты для индукции иммунного ответа против герпесвируса и ее применение
MX350258B (es) * 2011-07-06 2017-08-31 Novartis Ag Emulsiones cationicas de aceite en agua.
MX366055B (es) * 2011-08-31 2019-06-26 Novartis Ag Liposomas pegilados para admistracion de acido ribonucleico (arn) que codifica para inmunogeno.
CA2878344A1 (en) 2012-07-06 2014-01-09 Novartis Ag Complexes of cytomegalovirus proteins
EP3015475A1 (en) 2014-10-31 2016-05-04 Novartis AG Mammalian cells expressing cytomegalovirus antigens

Patent Citations (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5608143A (en) 1989-03-17 1997-03-04 E. I. Du Pont De Nemours And Company External regulation of gene expression
US5767250A (en) * 1992-07-29 1998-06-16 Chiron Corporation Complexes comprising truncated CMV gH polypeptides and escort proteins
US5659122A (en) 1993-09-02 1997-08-19 Monsanto Company Enhanced expression in plants using non-translated leader sequences
US5693506A (en) 1993-11-16 1997-12-02 The Regents Of The University Of California Process for protein production in plants
WO2007146024A2 (en) * 2006-06-07 2007-12-21 The Trustees Of Princeton University Cytomegalovirus surface protein complex for use in vaccines and as a drug target
US7704510B2 (en) 2006-06-07 2010-04-27 The Trustees Of Princeton University Cytomegalovirus surface protein complex for use in vaccines and as a drug target
WO2011027222A2 (en) 2009-09-02 2011-03-10 Novartis Ag Immunogenic compositions including tlr activity modulators
WO2012006380A2 (en) 2010-07-06 2012-01-12 Novartis Ag Cationic oil-in-water emulsions
WO2012051211A2 (en) 2010-10-11 2012-04-19 Novartis Ag Antigen delivery platforms
WO2013006842A2 (en) * 2011-07-06 2013-01-10 Novartis Ag Immunogenic compositions and uses thereof

Non-Patent Citations (26)

* Cited by examiner, † Cited by third party
Title
"Methods in Molecular Biology", 2008, HUMANA PRESS, article "High Throughput Protein Expression and Purification: Methods and Protocols"
"Vaccine Design...", 1995, PLENUM
AKTER, P ET AL.: "Two novel spliced genes in human cytomegalovirus", JOURNAL OF GENERAL VIROLOGY, vol. 84, 2003, pages 1117 - 1122
BOEHME, KW; M GUERRERO; T COMPTON: "Human cytomegalovirus envelope glycoproteins B and H are necessary for TLR2 activation in permissive cells", JOURNAL OF IMMUNOLOGY, vol. 177, 2006, pages 7094 - 7102
ERIC R KINZLER ET AL: "Expression and reconstitution of the gH/gL/gO complex of human cytomegalovirus", JOURNAL OF CLINICAL VIROLOGY, vol. 25, no. Supp.2, 2002, pages S87 - S95, XP055079954, ISSN: 1386-6532, DOI: 10.1016/S1386-6532(02)00098-7 *
GENINI, E; E PERCIVALLE; A SARASINI; MG REVELLO; F BALDANTI; G GERNA: "Serum antibody response to the gH/gL/pUL128-131 five-protein complex of human cytomegalovirus (HCMV) in primary and reactivated HCMV infections", JOURNAL OF CLINICAL VIROLOGY, vol. 52, 2011, pages 113 - 118
HUBER, MT; T COMPTON: "Intracellular Formation and Processing of the Heterotrimeric gH-gL- gO (gCIII) Glycoprotein Envelope Complex of Human Cytomegalovirus", JOURNAL OF VIROLOGY, vol. 73, 1999, pages 3886 - 3892
KINZLER, ERIC R; REGAN N THEILER; TERESA COMPTON: "Expression and reconstitution of the gH/gL/gO complex of human cytomegalovirus", JOURNAL OF CLINICAL VIROLOGY, 2002, pages 87 - 95
LANGDON, RH; J CUCCUI; BW. WREN: "N-linked glycosylation in bacteria: an unexpected application", FUTURE MICROBIOLOGY, vol. 4, 2009, pages 401 - 412
LOIGNON, M ET AL.: "Stable high volumetric production of glycosylated human recombinant IFNalpha2b in HEK293 cells", BMC BIOTECHNOLOGY, vol. 8, 2008, pages 65
MACAGNO, A ET AL.: "Isolation of human monoclonal antibodies that potently neutralize human cytomegalovirus infection by targeting different epitopes on the gH/gL/UL128-131A complex", JOURNAL OF VIROLOGY, vol. 84, 2010, pages 1005 - 13
MELNICKA, M; PP SEDGHIZADEHB; CM ALLENC; T JASKOLLA: "Human cytomegalovirus and mucoepidermoid carcinoma of salivary glands: Cell-specific localization of active viral and oncogenic signaling proteins is confirmatory of a causal relationship", EXPERIMENTAL AND MOLECULAR PATHOLOGY, vol. 92, 2012, pages 118 - 125
MOCARSKI, ES; T SHENK; RF PASS: "Fields Virology", 2006, LIPPINCOTT WILLIAMS AND WILKINS, article "Cytomegalovirus"
MURTHY, S ET AL.: "Detection of a Single Identical Cytomegalovirus (CMV) Strain in Recently Seroconverted Young Women", PLOS ONE, vol. 6, 2011, pages E15949
NEEDLEMAN, SB; CD WUNSCH: "A general method applicable to the search for similarities in the amino acid sequences of two proteins", JOURNAL OF MOLECULAR BIOLOGY, vol. 48, 1970, pages 443 - 453
PATRONE, M; M SECCHI; L FIORINA; M LERARDI; G MILANESI; A GALLINA: "Human Cytomegalovirus UL130 Protein Promotes Endothelial Cell Infection through a Producer Cell Modification of the Virion", JOURNAL OF VIROLOGY, vol. 79, 2005, pages 8361 - 8373
RASMUSSEN, L; A GEISSLER; C COWAN; A CHASE; M WINTERS: "The Genes Encoding the gCIII Complex of Human Cytomegalovirus Exist in Highly Diverse Combinations in Clinical Isolates", JOURNAL OF VIROLOGY, vol. 76, 2002, pages 10841 - 10888
RICE, P; I LONGDEN; A BLEASBY: "EMBOSS: The European Molecular Biology Open Software Suite", TRENDS GENETICS, vol. 16, 2000, pages 276 - 277
RIGOUTSOS, I ET AL.: "In silico pattern-based analysis of the human cytomegalovirus genome", JOURNAL OF VIROLOGY, vol. 77, 2003, pages 4326 - 44
RYCKMAN BRENT J ET AL: "Characterization of the human cytomegalovirus gH/gL/UL128-131 complex that mediates entry into epithelial and endothelial cells", JOURNAL OF VIROLOGY, AMERICAN SOCIETY FOR MICROBIOLOGY, US, vol. 82, no. 1, 2008, pages 60 - 70, XP002519851, ISSN: 1098-5514, [retrieved on 20071017], DOI: 10.1128/JVI.01910-07 *
RYCKMAN, BJ ET AL.: "Characterization of the Human Cytomegalovirus gH/gL/UL128-131 Complex That Mediates Entry into Epithelial and Endothelial Cells", JOURNAL OF VIROLOGY, vol. 82, 2008, pages 60 - 70
RYCKMAN, BJ; MC CHASE; DC JOHNSON: "Human Cytomegalovirus TR Strain Glycoprotein O Acts as a Chaperone Promoting gH/gL Incorporation into Virions but Is Not Present in Virions", JOURNAL OF VIROLOGY, vol. 84, 2010, pages 2597 - 2609
SAMBROOK, J.: "Molecular Cloning: A Laboratory Manual", 2000, COLD SPRING HARBOR LABORATORY PRESS
SIMANEK, AMANDA M.; JENNIFER BEAM DOWD; GRAHAM PAWELEC; DAVID MELZER; AMBARISH DUTTA; ALLISON E. AIELLO: "Seropositivity to Cytomegalovirus, Inflammation, All-Cause and Cardiovascular Disease-Related Mortality in the United States", PLOS ONE, vol. 6, 2011, pages E16103
SUMMERS, MD; GE SMITH: "A manual of methods for baculovirus vectors and insect cell culture procedures", TEXAS AGRICULTURAL EXPERIMENT STATION BULLETIN NO. 1555, 1987
WANG, D; T SHENK: "Human Cytomegalovirus UL131 Open Reading Frame Is Required for Epithelial Cell Tropism. Human Cytomegalovirus UL131 Open Reading Frame Is Required for Epithelial Cell Tropism", JOURNAL OF VIROLOGY, vol. 79, 2005, pages 10330 - 10338

Cited By (59)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2869843B1 (en) 2012-07-06 2019-08-07 GlaxoSmithKline Biologicals SA Complexes of cytomegalovirus proteins
US11717568B2 (en) 2012-07-27 2023-08-08 City Of Hope MVA vaccine for delivery of a UL128 complex and preventing CMV infection
US12150987B2 (en) 2012-07-27 2024-11-26 City Of Hope MVA vaccine for delivery of a UL128 complex and preventing CMV infection
US10842864B2 (en) 2012-07-27 2020-11-24 City Of Hope MVA vaccine for delivery of a UL128 complex and preventing CMV infection
US10376575B2 (en) 2012-07-27 2019-08-13 City Of Hope MVA vaccine for delivery of a UL128 complex and preventing CMV infection
WO2015161926A1 (en) * 2014-04-23 2015-10-29 Institute For Research In Biomedicine Human cytomegalovirus vaccine compositions and method of producing the same
WO2015165480A1 (en) * 2014-04-30 2015-11-05 Institute For Research In Biomedicine Human cytomegalovirus vaccine compositions and method of producing the same
WO2015170287A1 (en) * 2014-05-08 2015-11-12 Redvax Gmbh Means and methods for treating cmv
CN106460010A (zh) * 2014-05-08 2017-02-22 辉瑞公司 治疗cmv之手段及方法
WO2016067239A1 (en) 2014-10-31 2016-05-06 Glaxosmithkline Biologicals Sa Mammalian cells expressing cytomegalovirus antigens
BE1023364B1 (fr) * 2014-10-31 2017-02-20 Glaxosmithkline Biologicals S.A. Cellules de mammiferes exprimant des antigenes du cytomegalovirus
US10414802B2 (en) 2014-10-31 2019-09-17 Glaxosmithkline Biologicals S.A. Mammalian cells expressing cytomegalovirus antigens
BE1023841B1 (fr) * 2014-10-31 2017-08-10 Glaxosmithkline Biologicals S.A. Cellules de mammiferes exprimant des antigenes du cytomegalovirus
BE1023840B1 (fr) * 2014-10-31 2017-08-10 Glaxosmithkline Biologicals S.A. Cellules de mammiferes exprimant des antigenes du cytomegalovirus
JP2017534283A (ja) * 2014-10-31 2017-11-24 グラクソスミスクライン バイオロジカルズ ソシエテ アノニム サイトメガロウイルス抗原を発現する哺乳動物細胞
EP3015475A1 (en) 2014-10-31 2016-05-04 Novartis AG Mammalian cells expressing cytomegalovirus antigens
WO2016116904A1 (en) 2015-01-22 2016-07-28 Glaxosmithkline Biologicals Sa Cytomegalovirus antigens and uses thereof
JP2018504117A (ja) * 2015-01-22 2018-02-15 グラクソスミスクライン バイオロジカルズ ソシエテ アノニム サイトメガロウイルス抗原およびその使用
CN107531761A (zh) * 2015-01-22 2018-01-02 葛兰素史密丝克莱恩生物有限公司 巨细胞病毒抗原及其用途
AU2016210548B2 (en) * 2015-01-22 2018-11-08 Glaxosmithkline Biologicals Sa Cytomegalovirus antigens and uses thereof
US10167321B2 (en) 2015-01-22 2019-01-01 Glaxosmithkline Biologicals, Sa Cytomegalovirus antigens and uses thereof
EP4180056A1 (en) 2015-01-22 2023-05-17 GlaxoSmithKline Biologicals SA Cytomegalovirus antigens and uses thereof
CN107531761B (zh) * 2015-01-22 2022-01-14 葛兰素史密丝克莱恩生物有限公司 巨细胞病毒抗原及其用途
EA038250B1 (ru) * 2015-01-22 2021-07-29 Глаксосмитклайн Байолоджикалс Са Рекомбинантный белок gl цитомегаловируса с мутацией в сайте распознавания протеазой, которая уменьшает протеазное расщепление
BE1023087B1 (fr) * 2015-01-22 2016-11-18 Glaxosmithkline Biologicals S.A. Antigenes du cytomegalovirus et leurs utilisations
AU2018226521B2 (en) * 2015-01-22 2019-10-31 Glaxosmithkline Biologicals Sa Cytomegalovirus antigens and uses thereof
EP3048114A1 (en) 2015-01-22 2016-07-27 Novartis AG Cytomegalovirus antigens and uses thereof
WO2016116905A1 (en) * 2015-01-23 2016-07-28 Glaxosmithkline Biologicals Sa Cmv antigens and uses thereof
EP3047856A1 (en) * 2015-01-23 2016-07-27 Novartis AG Cmv antigens and uses thereof
US10487139B2 (en) 2015-09-10 2019-11-26 City Of Hope MVA-gh/gL-PC vaccine derived antibodies neutralizing human cytomegalovirus infectivity and methods thereof
US11384137B2 (en) 2015-09-10 2022-07-12 City Of Hope MVA-gH/gL-PC vaccine derived antibodies neutralizing human cytomegalovirus infectivity and methods thereof
EP3364981A4 (en) * 2015-10-22 2019-08-07 ModernaTX, Inc. VACCINE AGAINST THE HUMAN CYTOMEGALOVIRUS
US11484590B2 (en) 2015-10-22 2022-11-01 Modernatx, Inc. Human cytomegalovirus RNA vaccines
US10022436B2 (en) 2016-01-11 2018-07-17 Verndari, Inc. Microneedle compositions and methods of using same
US10363303B2 (en) 2016-01-11 2019-07-30 Verndari, Inc. Microneedle compositions and methods of using same
US10611800B2 (en) 2016-03-11 2020-04-07 Pfizer Inc. Human cytomegalovirus gB polypeptide
US11541113B2 (en) 2016-10-21 2023-01-03 Modernatx, Inc. Human cytomegalovirus vaccine
US11197927B2 (en) 2016-10-21 2021-12-14 Modernatx, Inc. Human cytomegalovirus vaccine
WO2018193307A1 (en) 2017-04-19 2018-10-25 Glaxosmithkline Biologicals Sa Modified cytomegalovirus proteins and stabilized complexes
US11964007B2 (en) 2017-07-28 2024-04-23 Janssen Vaccines & Prevention B.V. Methods and compositions for heterologous repRNA immunizations
US11524069B2 (en) 2017-09-13 2022-12-13 Sanofi Pasteur Human cytomegalovirus immunogenic composition
US11207403B2 (en) 2017-09-13 2021-12-28 Sanofi Pasteur Human cytomegalovirus immunogenic composition
WO2019052975A1 (en) 2017-09-13 2019-03-21 Sanofi Pasteur IMMUNOGENIC COMPOSITION AGAINST HUMAN CYTOMEGALOVIRUS
IL273120B1 (en) * 2017-09-13 2023-06-01 Sanofi Pasteur A compound that induces an immune response to cytomegalovirus
AU2018331874B2 (en) * 2017-09-13 2022-06-02 Sanofi Pasteur Human cytomegalovirus immunogenic composition
IL273120B2 (en) * 2017-09-13 2023-10-01 Sanofi Pasteur A compound that induces an immune response to cytomegalovirus
RU2775424C2 (ru) * 2017-09-13 2022-06-30 Санофи Пастер Иммуногенная композиция цитомегаловируса человека
US12433944B2 (en) 2018-05-04 2025-10-07 SpyBiotech Limited Vaccine composition
WO2019211630A2 (en) 2018-05-04 2019-11-07 SpyBiotech Limited Vaccine composition
WO2020079586A1 (en) 2018-10-17 2020-04-23 Glaxosmithkline Biologicals Sa Modified cytomegalovirus proteins and stabilized complexes
US12290560B2 (en) 2018-12-10 2025-05-06 Km Biologics Co., Ltd. Vaccine for preventing or treating congenital infection with cytomegalovirus
US11629172B2 (en) 2018-12-21 2023-04-18 Pfizer Inc. Human cytomegalovirus gB polypeptide
WO2021014385A1 (en) 2019-07-24 2021-01-28 Glaxosmithkline Biologicals Sa Modified human cytomegalovirus proteins
US12569552B2 (en) 2020-06-09 2026-03-10 Km Biologics Co., Ltd. Fusion protein of pentamer and gB of cytomegalovirus, and vaccine containing said fusion protein
US11857622B2 (en) 2020-06-21 2024-01-02 Pfizer Inc. Human cytomegalovirus GB polypeptide
US11406703B2 (en) 2020-08-25 2022-08-09 Modernatx, Inc. Human cytomegalovirus vaccine
WO2022090359A1 (en) 2020-10-28 2022-05-05 Sanofi Pasteur Liposomes containing tlr4 agonist, preparation and uses thereof
WO2022180500A3 (en) * 2021-02-24 2023-01-19 Pfizer Inc. Novel druggable regions in the human cytomegalovirus glycoprotein b polypeptide and methods of use thereof
WO2023144665A1 (en) 2022-01-28 2023-08-03 Glaxosmithkline Biologicals Sa Modified human cytomegalovirus proteins

Also Published As

Publication number Publication date
MX355469B (es) 2018-04-19
GB2513768B (en) 2015-04-15
US9683022B2 (en) 2017-06-20
US20160159864A1 (en) 2016-06-09
IN2014KN02929A (https=) 2015-05-08
US20170320916A1 (en) 2017-11-09
KR20150031322A (ko) 2015-03-23
SG11201408328VA (en) 2015-02-27
ES2753138T3 (es) 2020-04-07
EP2869843A1 (en) 2015-05-13
US10287322B2 (en) 2019-05-14
JP2015522581A (ja) 2015-08-06
JP2017192399A (ja) 2017-10-26
RU2015103891A (ru) 2016-08-27
CN104853771A (zh) 2015-08-19
US20190211064A1 (en) 2019-07-11
CA2878344A1 (en) 2014-01-09
EP2869843B1 (en) 2019-08-07
MX2014015496A (es) 2015-03-06
MX378747B (es) 2025-03-10
GB2513768A (en) 2014-11-05
GB201413863D0 (en) 2014-09-17
AU2013286093B2 (en) 2018-01-04
US20220106364A1 (en) 2022-04-07
JP2017192400A (ja) 2017-10-26
HK1210037A1 (en) 2016-04-15
ZA201409364B (en) 2017-08-30
AU2013286093A1 (en) 2015-02-12
IL236261A0 (en) 2015-02-26

Similar Documents

Publication Publication Date Title
US20220106364A1 (en) Complexes of cytomegalovirus proteins
KR102242990B1 (ko) 헤테로다이머 면역글로불린 구조체 및 이의 제조 방법
DK2420572T3 (en) MONOCLONAL ANTIBODY THAT CAN BIND TO SPECIFIC discontinuous EPITOPE, OCCURRING IN AD 1 REGION OF HUMAN cytomegalovirus GB-glycoprotein AND ANTIBODY-binding fragment thereof.
US20190307879A1 (en) Adenovirus-vectored multivalent vaccine
Zhao et al. Immunization with Fc-based recombinant Epstein–Barr virus gp350 elicits potent neutralizing humoral immune response in a BALB/c mice model
CN103667304B (zh) 核酸
US20170158753A1 (en) Monoclonal antibodies directed against envelope glycoproteins from multiple filovirus species
KR20220093197A (ko) 지카/뎅기열 백신 및 이의 응용
US20170119874A1 (en) Human cytomegalovirus vaccine compositions and method of producing the same
CN119119211A (zh) 一种融合前构象的呼吸道合胞病毒重组融合蛋白、其制备方法及用途
EP4628095A1 (en) Fusion protein and granulated antigen comprising same
CN118406159B (zh) RSV pre-F截短体及其生产方法和应用
CN118812719A (zh) 特异性结合HBV pre-S1抗原和CD3抗原的多特异性抗体及其应用
CN115772544A (zh) 抗vegf-a和ang-2的aav载体
CN119708170B (zh) RSV pre-F突变体及其制备方法和应用
WO2024153068A1 (en) Anti-pdl1 single domain antibody, fusion protein and use thereof
US20240239875A1 (en) Sars-cov-2 spike protein antibodies
Wang et al. Research on the construction method and characterization of neutralizing mouse-canine chimeric antibody against canine distemper virus
WO2024182781A1 (en) Coronavirus compositions and uses thereof
CN121494982A (zh) 抗cd276纳米抗体及其用途
WO2025209940A1 (en) Ebv vaccine and antibodies
HK40004712B (en) Heterodimeric immunoglobulin constructs and preparation methods thereof
HK40004712A (en) Heterodimeric immunoglobulin constructs and preparation methods thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 13736518

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 1413863

Country of ref document: GB

Kind code of ref document: A

Free format text: PCT FILING DATE = 20130629

WWE Wipo information: entry into national phase

Ref document number: 1413863.0

Country of ref document: GB

WWE Wipo information: entry into national phase

Ref document number: MX/A/2014/015496

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: 14410461

Country of ref document: US

ENP Entry into the national phase

Ref document number: 2015519155

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2878344

Country of ref document: CA

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2013736518

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 20157002267

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2015103891

Country of ref document: RU

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2013286093

Country of ref document: AU

Date of ref document: 20130629

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112015000213

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112015000213

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20150106