WO2013188494A1 - Fixed dosage regimens for anti-type i interferon receptor (ifnar) antibodies - Google Patents
Fixed dosage regimens for anti-type i interferon receptor (ifnar) antibodies Download PDFInfo
- Publication number
- WO2013188494A1 WO2013188494A1 PCT/US2013/045327 US2013045327W WO2013188494A1 WO 2013188494 A1 WO2013188494 A1 WO 2013188494A1 US 2013045327 W US2013045327 W US 2013045327W WO 2013188494 A1 WO2013188494 A1 WO 2013188494A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- ifn
- type
- patient
- disorder
- antibody
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2866—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/24—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
- C12Q1/6876—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes
- C12Q1/6883—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material
-
- G—PHYSICS
- G06—COMPUTING OR CALCULATING; COUNTING
- G06N—COMPUTING ARRANGEMENTS BASED ON SPECIFIC COMPUTATIONAL MODELS
- G06N7/00—Computing arrangements based on specific mathematical models
- G06N7/01—Probabilistic graphical models, e.g. probabilistic networks
-
- G—PHYSICS
- G16—INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS
- G16H—HEALTHCARE INFORMATICS, i.e. INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR THE HANDLING OR PROCESSING OF MEDICAL OR HEALTHCARE DATA
- G16H50/00—ICT specially adapted for medical diagnosis, medical simulation or medical data mining; ICT specially adapted for detecting, monitoring or modelling epidemics or pandemics
- G16H50/20—ICT specially adapted for medical diagnosis, medical simulation or medical data mining; ICT specially adapted for detecting, monitoring or modelling epidemics or pandemics for computer-aided diagnosis, e.g. based on medical expert systems
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/54—Medicinal preparations containing antigens or antibodies characterised by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/545—Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/77—Internalization into the cell
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q2600/00—Oligonucleotides characterized by their use
- C12Q2600/106—Pharmacogenomics, i.e. genetic variability in individual responses to drugs and drug metabolism
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q2600/00—Oligonucleotides characterized by their use
- C12Q2600/158—Expression markers
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q2600/00—Oligonucleotides characterized by their use
- C12Q2600/16—Primer sets for multiplex assays
Definitions
- the present disclosure provides methods for the treatment of autoimmune diseases such as systemic lupus erythematosus, scleroderma, lupus nephritis, and myositis with fixed doses of anti-interferon receptor antibodies.
- Type I interferons are a family of cytokines including 14 IFN-a subtypes
- IFN- ⁇ , -co, and - ⁇ all of which are involved in antiviral or antitumor function.
- a potential role for type I IFNs in the disease pathogenesis of several autoimmune disorders including systemic sclerosis (SSc, scleroderma), systemic lupus erythematous (SLE), primary Sj5gren's, rheumatoid arthritis, as well as myositis.
- SLE is a chronic rheumatic disease characterized by autoreactive antibodies targeting a variety of self-antigens resulting in inflammation, tissue and organ damage.
- the role of type I IFNs has been implicated in the development of SLE.
- SSc is a rheumatic disease of the connective tissue, affecting multiple systems including skin, muscle, and internal organs.
- type I IFN activity plays a role in the pathogenesis of SSc, as confirmed by the over-expression of type I IFN-inducible genes and the enrichment of plasmacytoid dendritic cells in skin and/or blood of SSc patients (Fleming et al., PLoS One 3:el452 (2008); Coelho et al., Arch. Dermatol. Res. 299:259-262 (2007); Tan et al, Rheumatology (Oxford) 45:694-702 (2006); Duan et al, Arthritis Rheum. 58:1465-1474 (2008)).
- Type I IFNs in serum or plasma are not easily measured.
- type II IFNs in serum or plasma are not easily measured.
- I IFN inducible genes can be conveniently measured improved sensitivity and specificity (Bengtsson et al, Lupus 9:664-671 (2000); Dall'era et al, Ann. Rheum. Dis. 64: 1692-1697 (2005); Kirou et al, Arthritis Rheum. 50:3958-3967 (2004)).
- type I IFN signatures have been used to correlate type I IFN activity with SLE or SSc disease pathogenesis (Eloranta et al, Ann. Rheum. Dis. 69: 1396-1402 (2010)), disease activity (Bilgic et al, Arthritis Rheum.
- Type I IFN-mediated diseases such as SLE present diverse disease manifestations and highly variable disease progression, flares and remissions. Due to this heterogeneity, it is crucial to identify patients with similar pathway activation parameters to designate the most appropriate therapies for the different patient subsets.
- a relevant, sensitive and robust set of PD markers that can be easily tracked or monitored in patients is of great value for dose finding at the early clinical development stage. Methods of applying this set of PD markers would be highly valuable tools to account for differences in target expression and pathway activation in different diseases, and to facilitate bridging between clinical trials in different indications.
- the present disclosure provides method for treating a subject having a type I IFN- mediated disease or disorder comprising administration of a fixed dose of an anti-interferon alpha receptor antibody.
- the disclosure also provides methods for suppressing a type I interferon (IFN) gene signature (GS) in a subject.
- IFN type I interferon
- GS type I interferon gene signature
- the disclosure provides methods of prognosing and monitoring disease progression in a subject having a type I IFN- mediated disease or disorder, methods of predicting a dosage regimen, methods of identifying a candidate therapeutic agent, methods of identifying a patient as a candidate for a therapeutic agent, and methods of designing a personalized therapy.
- dosage regimens and personalized therapies selected according to these methods.
- the present disclosure provides a method of treating a patient having a type I IFN-mediated disease or disorder comprising (a) measuring a type I Interferon Gene Signature (type I IFN GS) score in a sample taken from a patient having a type I IFN- mediated disease or disorder, relative to a baseline type I IFN GS score; and (b) administering to the patient a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity if the patient's type I IFN GS score is elevated; wherein the fixed dose of the antibody or fragment thereof effectively treats the disease or disorder.
- type I IFN GS type I Interferon Gene Signature
- the present disclosure provides a method of treating a patient having a type I IFN-mediated disease or disorder comprising (a) administering to a patient having a type I IFN- mediated disease or disorder a fixed dose of an antibody or antigen- binding fragment thereof that modulates type I IFN activity; (b) measuring the patient's type I IFN GS score relative to a baseline type I IFN GS score; and (c) increasing the amount or frequency of subsequent fixed doses if the patient's type I IFN GS score is elevated; wherein suppression of the type I IFN GS of the patient is indicative of treatment efficacy.
- the present disclosure provides a method of treating a patient having a type I IFN-mediated disease or disorder comprising (a) submitting a sample taken from a patient with a type I IFN-mediated disease or disorder for measurement of a type I IFN GS score; (b) determining from the results of the measurement whether the patient's type I IFN GS score is elevated relative to a baseline type I IFN GS score; and, (c) administering to the patient a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity if the patient's type I IFN GS score is elevated; wherein the fixed dose of the antibody or fragment thereof effectively treats the disease or disorder.
- the present disclosure provides a method of treating a patient having a type I IFN-mediated disease or disorder comprising (a) administering to a patient having a type I IFN-mediated disease or disorder a fixed dose of an antibody or antigen- binding fragment thereof that modulates type I IFN activity; (b) submitting a sample taken from the patient for measurement of a type I IFN GS score; (c) determining from the results of the measurement whether the patient's type I IFN GS score is elevated relative to a baseline type I IFN GS score; and, (d) increasing the amount or frequency of subsequent fixed doses if the patient's type I IFN GS score is elevated; wherein suppression of the type I IFN GS of the patient is indicative of treatment efficacy.
- the present disclosure provides a method of treating a patient having a type I IFN-mediated disease or disorder comprising (a) submitting a sample taken from a patient with a type I IFN-mediated disease or disorder for measurement of a type I IFN GS score and comparison to a baseline type I IFN GS score; and (b) administering to the patient a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity if the patient's type I IFN GS score is elevated; wherein the fixed dose of the antibody or fragment thereof effectively treats the disease or disorder.
- the present disclosure provides a method of treating a patient having a type I IFN-mediated disease or disorder comprising (a) administering to a patient having a type I IFN-mediated disease or disorder a fixed dose of an antibody or antigen- binding fragment thereof that modulates type I IFN activity; (b) submitting a sample taken from the patient for measurement of a type I IFN GS score and comparison to a baseline type I IFN GS score; and (c) increasing the amount or frequency of subsequent fixed doses if the patient's type I IFN GS score is elevated; wherein suppression of the type I IFN GS of the patient is indicative of treatment efficacy.
- the present disclosure provides a method of treating a patient having a type I IFN-mediated disease or disorder comprising (a) measuring a type I IFN GS score from a sample taken from a patient having a type I IFN-mediated disease or disorder; (b) determining whether the patient's type I IFN GS score is elevated relative to a baseline type I IFN GS score; (c) instructing a healthcare provider to administer a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity if the patient's type I IFN GS score is elevated; wherein the fixed dose of the antibody or fragment thereof effectively treats the disease or disorder.
- the present disclosure provides a method of treating a patient having a type I IFN-mediated disease or disorder comprising (a) obtaining a sample from a patient having a type I IFN- mediated disease or disorder, where the patent has received a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity; (b) measuring a type I IFN GS score from the sample; (c) determining whether the patient's type I IFN GS score is elevated relative to a baseline type I IFN GS score; (d) instructing a healthcare provider to increase the amount or frequency of subsequent fixed doses if the patient's type I IFN GS score is elevated; wherein suppression of the type I IFN GS of the patient is indicative of treatment efficacy.
- the present disclosure provides a method of suppressing an type
- I IFN GS in a patient comprising (a) measuring the type I IFN GS score in a sample taken from a patient having a type I IFN- mediated disease or disorder, relative to a baseline type I IFN GS score; and (b) administering to the patient a fixed dose of an antibody or antigen- binding fragment thereof that modulates type I IFN activity if the patient's type I IFN GS score is elevated; wherein the administration of the antibody or antigen-binding fragment thereof suppresses the type I IFN GS of the patient.
- the present disclosure provides a method of suppressing a type I
- IFN GS in a patient comprising (a) administering to a patient having a type I IFN-mediated disease or disorder a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity; (b) measuring the patient's type I IFN GS score relative to a baseline type I IFN GS score; and (c) increasing the amount or frequency of subsequent fixed doses if the patient's type I IFN GS score is elevated; wherein the administration of the antibody or antigen-binding fragment thereof suppresses the type I IFN GS of the patient.
- the present disclosure provides a method of suppressing a type I
- IFN GS in a patient comprising (a) submitting a sample taken from a patient with a type I IFN-mediated disease or disorder for measurement of a type I IFN GS score; (b)determining from the results of the measurement whether the patient's type I IFN GS score is elevated relative to a baseline type I IFN GS score; and, (c) administering to the patient a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity if the patient's type I IFN GS score is elevated; wherein the administration of the antibody or antigen-binding fragment thereof suppresses the type I IFN GS of the patient.
- the present disclosure provides a method of suppressing a type I
- IFN GS in a patient comprising (a) administering to a patient having a type I IFN-mediated disease or disorder a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity; (b) submitting a sample taken from the patient for measurement of a type I IFN GS score; (c) determining from the results of the measurement whether the patient's type I IFN GS score is elevated relative to a baseline type I IFN GS score; and, (d) increasing the amount or frequency of subsequent fixed doses if the patient's type I IFN GS score is elevated; wherein the administration of the antibody or antigen- binding fragment thereof suppresses the type I IFN GS of the patient.
- the present disclosure provides a method of suppressing a type I
- IFN GS in a patient comprising (a) submitting a sample taken from a patient with a type I IFN-mediated disease or disorder for measurement of a type I IFN GS score and comparison to a baseline type I IFN GS score; and (b) administering to the patient a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity if the patient's type I IFN GS score is elevated; wherein the administration of the antibody or antigen-binding fragment thereof suppresses the type I IFN GS of the patient.
- the present disclosure provides a method of suppressing a type I
- IFN GS in a patient comprising (a) administering to a patient having a type I IFN- mediated disease or disorder a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity; (b) submitting a sample taken from the patient for measurement of a type I IFN GS score and comparison to a baseline type I IFN GS score; and (c) increasing the amount or frequency of subsequent fixed doses if the patient's type I IFN GS score is elevated; wherein the administration of the antibody or antigen-binding fragment thereof suppresses the type I IFN GS of the patient.
- the present disclosure provides a method of suppressing a type
- I IFN GS in a patient comprising (a) measuring a type I IFN GS score from a sample taken from a patient having a type I IFN-mediated disease or disorder; (b) determining whether the patient's type I IFN GS score is elevated relative to a baseline type I IFN GS score; (c) instructing a healthcare provider to administer a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity if the patient's type I IFN GS score is elevated; wherein the administration of the antibody or antigen-binding fragment thereof suppresses the type I IFN GS of the patient.
- the present disclosure provides a method of suppressing a type I
- IFN GS in a patient comprising (a) obtaining a sample from a patient having a type I IFN- mediated disease or disorder, where the patent has received a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity; (b) measuring a type I IFN GS score from the sample; (c) determining whether the patient's type I IFN GS score is elevated relative to a baseline type I IFN GS score; (d) instructing a healthcare provider to increase the amount or frequency of subsequent fixed doses if the patient's type I IFN GS score is elevated; wherein the administration of the antibody or antigen-binding fragment thereof suppresses the type I IFN GS of the patient.
- the present disclosure provides a method of monitoring therapeutic efficacy of a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity in a patient having a type I IFN-mediated disease or disorder comprising (a) measuring a first type I IFN GS score in a sample taken from a patient having a type I IFN- mediated disease or disorder; (b) administering to the patient a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity; (c) measuring a second type I IFN GS score in a sample taken from the patient following antibody administration; and (d) comparing the second type I IFN GS score to the first type I IFN GS score; wherein a decrease between the first and second type I IFN GS scores indicates efficacy or good prognosis.
- the present disclosure provides a method of monitoring therapeutic efficacy of a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity in a patient having a type I IFN-mediated disease or disorder comprising (a) submitting a sample taken from a patient with a type I IFN-mediated disease or disorder for measurement of a first type I IFN GS score; (b) administering to the patient a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity; (c) submitting a sample taken from a patient with a type I IFN-mediated disease or disorder for measurement of a second type I IFN GS score; and (d) comparing the second type I IFN GS score to the first typ I IFN GS score; wherein a decrease between the first and second type I IFN GS scores indicates efficacy or good prognosis.
- the present disclosure provides a method of monitoring therapeutic efficacy of a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity in a patient having a type I IFN-mediated disease or disorder comprising (a) measuring a first type I IFN GS score from a sample taken from a patient having a type I IFN-mediated disease or disorder; (b) instructing a healthcare provider to administer a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity; (c) measuring a second type I IFN GS score in a sample taken from the patient following antibody administration; and (d) comparing the second type I IFN GS score to the first type I IFN GS score; wherein a decrease between the first and second type I IFN GS scores indicates efficacy or good prognosis.
- the method of treating a patient having a type I IFN-mediated disease or disorder, and the method of suppressing a type I IFN GS in a patient further comprise measuring the patient's type I IFN GS score relative to a baseline type I IFN GS score, relative to the patient's earlier IFN GS score, or both, after the administration of the fixed dose.
- the method of treating a patient having a type I IFN-mediated disease or disorder, and the method of suppressing a type I IFN GS in a patient further comprise measuring the patient's type I IFN GS score relative to a baseline type I IFN GS score, relative to the patient's earlier type I IFN GS score, or both, after the administration of a subsequent fixed dose.
- the method of treating a patient having a type I IFN-mediated disease or disorder, and the method of suppressing a type I IFN GS in a patient further comprise submitting a sample from the patient for measurement of the patient's type I IFN GS score relative to a baseline type I IFN GS score, relative to the patient's earlier type I IFN GS score, or both, after the administration of the fixed dose.
- the method of treating a patient having a type I IFN-mediated disease or disorder, and the method of suppressing a type I IFN GS in a patient further comprise submitting a sample from the patient for measurement of the patient's type I IFN GS score relative to a baseline type I IFN GS score, relative to the patient's earlier type I IFN GS score, or both, after the administration of a subsequent fixed dose.
- the method of treating a patient having a type I IFN-mediated disease or disorder, and the method of suppressing a type I IFN GS in a patient further comprise increasing the amount or frequency of subsequent fixed doses if the patent's type I IFN GS score remains elevated.
- the method of treating a patient having a type I IFN-mediated disease or disorder, and the method of suppressing a type I IFN GS in a patient further comprise instructing a healthcare provider to increase the amount or frequency of subsequent fixed doses if the patent's type I IFN GS score remains elevated.
- the method of treating a patient having a type I IFN-mediated disease or disorder, and the method of suppressing a type I IFN GS in a patient further comprise increasing the amount or frequency of subsequent fixed doses if the patent's type I IFN GS score remains elevated.
- the present disclosure also provides a method of treating a patient having a type I
- IFN-mediated disease or disorder comprising administering a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity, wherein the fixed dose is effective to treat the disorder.
- the type I IFN activity is IFN-alpha activity.
- the type I IFN GS comprises up-regulated expression or activity of at least 4 pharmacodynamic (PD) marker genes selected from the group consisting of IFI6, RSAD2, IFI44, IFI44L, IFI27, MX1, IFIT1, HERC5, ISG15, LAMP3, OAS3, OAS1, EPST1, IFIT3, LY6E, OAS2, PLSCR1, SIGLECl, USP18, RTP4, and DNAPTP6.
- the type I IFN GS comprises up-regulated expression or activity of genes IFI27, IFI44, IFI44L, and RSAD2.
- the type I IFN GS further comprises up-regulated expression or activity of gene IFI6.
- the antibody or antigen-binding fragment thereof that modulates type I IFN activity specifically binds to an IFN receptor.
- the IFN receptor is an IFN alpha receptor.
- the IFN alpha receptor is IFNAR1.
- the antibody or antigen binding fragment thereof specifically binds to subunit 1 of IFNAR1.
- the antibody or antigen-binding fragment thereof is monoclonal.
- the antibody or antigen-binding fragment thereof comprises an immunoglobulin IgG Fc region.
- the antibody is MEDI-546 or an antigen-binding fragment thereof.
- the antibody or antigen-binding fragment thereof suppresses the type I IFN GS in disease tissue.
- the fixed dose ranges from about 300 mg to about 1000 mg. In other aspects, the fixed dosage is lower than about 300 mg. In other aspects, the fixed dose is about 100 mg. In certain aspects, the fixed dose is selected from the group consisting of about 300 mg, about 400 mg, about 500 mg, about 600 mg, about 700 mg, about 800, about 900 mg and about 1000 mg.
- the disease tissue is skin.
- the antibody or antigen-binding fragment thereof suppresses the type I IFN GS in peripheral blood.
- the suppression is full suppression.
- the suppression is partial suppression.
- the antibody or antigen-binding fragment thereof is administered in two or more doses.
- the therapeutic agent is administered monthly.
- the therapeutic agent is administered intravenously, intramuscularly, subcutaneously, or a combination thereof.
- the disease is an autoimmune disease.
- the autoimmune disease is systemic lupus erythematosus (SLE), scleroderma (SSc), myositis, or lupus nephritis.
- the antibody or antigen-binding fragment thereof suppresses the type I IFN GS by at least 10%, at least 20%, at least 30% or at least 40% as compared to the type I IFN GS of the subject prior to the administration of the fixed dose of the antibody or antigen-binding fragment thereof.
- the therapeutic agent suppresses the type I IFN GS by at least 10%, at least 20%, at least 30% or at least 40% as compared to the average type I IFN GS signature in a population.
- the present disclosure also provides a kit for detecting a type I IFN genetic signature (IFN GS) common to two diseases whose pathogeneses are mediated by type I IFN comprising a set of diagnostic assays capable of measuring differentially regulated pharmacodynamic (PD) marker genes in a patient sample, wherein the type I IFN GS is suppressed by the administration of a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity.
- IFN GS type IFN genetic signature
- PD pharmacodynamic
- the type I IFN GS comprises up- regulated expression or activity of at least four PD marker genes selected from the group consisting of IFI6, RSAD2, IFI44, IFI44L, IFI27, MX1, IFIT1, HERC5, ISG15, LAMP3, OAS3, OAS 1, EPST1, IFIT3, LY6E, OAS2, PLSCR1, SIGLECl, USP18, RTP4, and DNAPTP6.
- the type I IFN GS comprises up-regulated expression or activity of at least five of the PD marker genes.
- the type I IFN GS comprises up- regulated expression or activity of genes IFI27, IFI44, IFI44L, and RSAD2.
- the type I IFN GS further comprises up-regulated expression or activity of gene IFI6.
- the patient sample is blood or a fraction thereof, muscle, skin, or a combination thereof.
- the diagnostic assays comprise nucleic acid probes which hybridize to mRNA in the patient sample.
- the present disclosure also provides a computer- implemented method for predicting an optimal dosage regimen with an antibody or antigen-binding fragment thereof that modulates type I IFN activity.
- This method comprises (a) inputting PK/PD data from a second type I IFN-mediated disease or disorder into a computer system comprising a pharmacokinetic -pharmacodynamic (PK/PD) stochastic model based on PK/PD data corresponding a first type I IFN-mediated disease or disorder, wherein the inputted PK/PD data from the second type I IFN-mediated disease or disorder is used to adjust the PK/PD stochastic model; (b) applying the adjusted PK/PD stochastic model to the inputted PK/PD data from the second type I IFN-mediated disease or disorder; and, (c) identifying an optimal dosage of the antibody or antigen-binding fragment thereof that modulates type I IFN activity for the second type I IFN-mediated disease or disorder from the output of the adjusted PK/PD stochastic model.
- PK/PD pharmacokinetic
- the present disclosure also provides a computer-implemented method of identifying an antibody or antigen-binding fragment thereof that modulates type I IFN activity as a candidate therapeutic agent for treating a type I IFN-mediated disease or disorder.
- This method comprises (a) inputting PD/PK data from a second type I IFN- mediated disease or disorder into a computer system comprising a PK/PD stochastic model based on PK/PD values corresponding a first type I IFN-mediated disease or disorder, wherein the inputted PD/PK data from the second type I IFN-mediated disease or disorder is used to adjust the PK/PD stochastic model; (b) applying the adjusted PK/PD stochastic model to the inputted data from the second type I IFN-mediated disease or disorder; and, (c) identifying an antibody or antigen-binding fragment thereof that modulates type I IFN activity as a candidate therapeutic agent for treating the second type I IFN-mediated disease or disorder from the output of the adjusted PK/PD stochastic model.
- the present disclosure also provides a computer-implemented method of identifying a patient as a candidate for therapy with an antibody or antigen-binding fragment thereof that modulates type I IFN activity.
- This method comprises (a) inputting PD/PK data from a second type I IFN-mediated disease or disorder into a computer system comprising a PK/PD stochastic model based on PK/PD data corresponding a first type I IFN-mediated disease or disorder, wherein the inputted PD/PK data from the second type I IFN-mediated disease is used to adjust the PK/PD stochastic model; applying the adjusted PK/PD stochastic model to the inputted PD/PK data from the second type I IFN-mediated disease or disorder; and, identifying a patient with the second disease as a candidate for therapy with an antibody or antigen-binding fragment thereof that modulates type I IFN activity for the second type I IFN-mediated disease from the output of the adjusted PK/PD stochastic model.
- the present disclosure also provides a computer-implemented method of designing a personalized therapy for treating a type I IFN-mediated disease or disorder with an antibody or antigen binding fragment thereof that modulates type I IFN activity.
- This method comprises (a) inputting PD/PK data from a second type I IFN-mediated disease or disorder into a computer system comprising a PK/PD stochastic model based on PK/PD data corresponding a first type I IFN-mediated disease or disorder, wherein the inputted data from the second type I IFN-mediated disease or disorder is used to adjust the PK/PD stochastic model; (b) applying the adjusted PK/PD stochastic model to the inputted PD/PK data from the second type I IFN-mediated disease or disorder; and, (c) identifying a personalized therapy for treating a type I IFN-mediated disease or disorder with an antibody or antigen binding fragment thereof that modulates type I IFN activity for the second type I IFN- mediated disease or disorder from the output of the adjusted PK/PD stochastic
- the type I IFN activity in the computer-implemented method is
- the first and second type I IFN-mediated disease or disorder in the computer-implemented method share a common type I IFN GS.
- the type I IFN GS in the computer-implemented method is differentially regulated.
- the type I IFN GS in the computer- implemented method comprises up-regulated expression or activity of at least 4 PD marker genes selected from the group consisting of IFI6, RSAD2, IFI44, IFI44L, IFI27, MX1, IFIT1, HERC5, ISG15, LAMP3, OAS3, OAS1, EPST1, IFIT3, LY6E, OAS2, PLSCR1, SIGLECl, USP18, RTP4, and DNAPTP6.
- the type I IFN GS in the computer-implemented method comprises up-regulated expression or activity of at least 5 PD marker genes selected from the group consisting of IFI6, RSAD2, IFI44, IFI44L, IFI27, MX1, IFIT1, HERC5, ISG15, LAMP3, OAS3, OAS1, EPST1, IFIT3, LY6E, OAS2, PLSCR1, SIGLECl, USP18, RTP4, and DNAPTP6.
- the type I IFN GS in the computer-implemented method comprises up-regulated expression or activity of genes IFI27, IFI44, IFI44L, and RSAD2.
- the type I IFN GS in the computer-implemented method further comprises up- regulated expression or activity of gene IFI6.
- the antibody or antigen binding fragment thereof in the computer-implemented method specifically binds to an IFN receptor.
- the IFN receptor in the computer-implemented method is an IFN alpha receptor.
- the IFN alpha receptor in the computer- implemented method is IFNAR1.
- the antibody or antigen binding fragment thereof in the computer-implemented method specifically binds to subunit 1 of IFNAR1.
- the antibody or antigen binding fragment thereof in the computer-implemented method is monoclonal.
- the antibody or antigen binding fragment thereof in the computer-implemented method comprises an immunoglobulin IgG Fc region.
- the antibody in the computer-implemented method is MEDI-546.
- the first and the second type I IFN-mediated disease or disorder in the computer-implemented method are autoimmune diseases.
- the autoimmune diseases in the computer-implemented method are rheumatic diseases.
- the rheumatic diseases in the computer-implemented method are selected from the group consisting of systemic lupus erythematosus (SLE), scleroderma (SSc), myositis, and lupus nephritis.
- the first type I IFN-mediated disease or disorder in the computer- implemented method is SSc and the second type I IFN-mediated disease or disorder is SLE. In some aspects, the first type I IFN-mediated disease or disorder in the computer- implemented method is SSc and the second type I IFN-mediated disease or disorder is myositis. In some aspects, the first type I IFN-mediated disease or disorder in the computer- implemented method is SSc and the second type I IFN-mediated disease or disorder is lupus nephritis.
- the PK/PD data in the computer-implemented method corresponding to the first or second type I IFN-mediated disease or disorder comprises binding affinity data.
- the binding affinity data in the computer-implemented method corresponds to the binding of an antibody or antigen binding fragment thereof to an IFN receptor.
- the antibody or antigen binding fragment thereof in the computer-implemented method is MEDI-546.
- the IFN receptor in the computer- implemented method is IFNAR1.
- the PK/PD data corresponding the first or second type I IFN- mediated disease or disorder in the computer-implemented method comprises kinetics data.
- the kinetics data corresponds to internalization kinetics of an antigen- antibody complex by cells.
- the antigen in the computer-implemented method is IFNAR1.
- the antibody in the computer-implemented method is MEDI- 546.
- the cells in the computer- implemented method are THP-1 cells.
- the PK/PD data corresponding to the first or second type I IFN- mediated disease or disorder in the computer-implemented method comprises type I IFN GS suppression data.
- the type I IFN GS suppression in the computer- implemented method is full suppression.
- the type I IFN GS suppression in the computer-implemented method is partial suppression.
- the type I IFN GS in the computer-implemented method comprises up-regulated expression or activity of genes IFI27, IFI44, IFI44L, RSAD2, and IFI6.
- the PK/PD stochastic model comprises two compartments. In some aspects, the two compartments in the PK/PD stochastic model are a central compartment and a peripheral compartment. In some aspects, the PK/PD stochastic model further comprises a skin compartment. In some aspects, the PK/PD stochastic model comprises two elimination pathways. In some aspects, the two elimination pathways are a clearance pathway and a target-mediated disposition pathway. In one specific aspect, the clearance pathway in the PK/PD stochastic model is a reticuloendothelial system pathway.
- the present disclosure also provides a computer-readable medium containing program instructions for predicting an optimal dosage regimen with an antibody or antigen- binding fragment thereof that modulates type I IFN activity, wherein execution of the program instructions by one or more processors of a computer system causes the one or more processors to carry out the steps of (a) processing inputted PK/PD data from a second type I IFN-mediated disease or disorder; (b) adjusting a PK/PD stochastic model based on PK/PD data corresponding a first type I IFN-mediated disease or disorder with the processed PK/PD data from the second type I IFN-mediated disease or disorder; and, (c) executing a stochastic simulation applying the adjusted PK/PD stochastic model to the inputted PK/PD data from the second type I IFN-mediated disease or disorder; wherein the output of the simulation identifies an optimal dosage of the antibody or antigen-binding fragment thereof that modulates type I IFN activity in the second type I IFN-mediated disease or disorder.
- the present disclosure also provides a computer-readable medium containing program instructions for identifying an antibody or antigen-binding fragment thereof that modulates type I IFN activity as a candidate therapeutic agent for treating a type I IFN- mediated disease or disorder, wherein execution of the program instructions by one or more processors of a computer system causes the one or more processors to carry out the steps of
- the present disclosure also provides a computer-readable medium containing program instructions for identifying a patient as a candidate for therapy with an antibody or antigen-binding fragment thereof that modulates type I IFN activity, wherein execution of the program instructions by one or more processors of a computer system causes the one or more processors to carry out the steps of (a) processing inputted PK/PD data from a second type I IFN-mediated disease or disorder; (b) adjusting a PK/PD stochastic model based on PK/PD data corresponding a first type I IFN-mediated disease or disorder with the processed PK/PD data from the second type I IFN-mediated disease or disorder; and, (c) executing a stochastic simulation applying the adjusted PK/PD stochastic model to the inputted PK/PD data from the second type I IFN-mediated disease or disorder; wherein the output of the simulation identifies a patient with the second type I IFN-mediated disease as a candidate for therapy with an antibody or antigen-binding fragment thereof that modulates type I IFN
- the present disclosure also provides a computer-readable medium containing program instructions for designing a personalized therapy for treating a type I IFN-mediated disease or disorder with an antibody or antigen binding fragment thereof that modulates type I IFN activity, wherein execution of the program instructions by one or more processors of a computer system causes the one or more processors to carry out the steps of (a) processing inputted PK/PD data from a second type I IFN-mediated disease or disorder; (b) adjusting a PK/PD stochastic model based on PK/PD data corresponding a first type I IFN-mediated disease or disorder with the processed PK/PD data from the second type I IFN-mediated disease or disorder; and, (c) executing a stochastic simulation applying the adjusted PK/PD stochastic model to the inputted PK/PD data from the second type I IFN-mediated disease or disorder; wherein the output of the simulation identifies a personalized therapy for treating the second type I IFN-mediated disease or disorder with an antibody or antigen binding fragment thereof that modulates
- the type I IFN activity is IFN-a activity. In other aspects of the computer-readable medium, the first and second type I IFN-mediated disease or disorder share a common IFN GS. In some aspects of the computer-readable medium, the type I IFN GS is differentially regulated.
- the type I IFN GS comprises up-regulated expression or activity of at least 4 PD marker genes selected from the group consisting of IFI6, RSAD2, IFI44, IFI44L, IFI27, MX1, IFIT1, HERC5, ISG15, LAMP 3, OAS3, OAS1, EPST1, IFIT3, LY6E, OAS2, PLSCR1, SIGLECl, USP18, RTP4, and DNAPTP6.
- 4 PD marker genes selected from the group consisting of IFI6, RSAD2, IFI44, IFI44L, IFI27, MX1, IFIT1, HERC5, ISG15, LAMP 3, OAS3, OAS1, EPST1, IFIT3, LY6E, OAS2, PLSCR1, SIGLECl, USP18, RTP4, and DNAPTP6.
- the type I IFN GS comprises up-regulated expression or activity of at least 5 PD marker genes selected from the group consisting of IFI6, RSAD2, IFI44, IFI44L, IFI27, MX1, IFIT1, HERC5, ISG15, LAMP3, OAS3, OAS1, EPST1, IFIT3, LY6E, OAS2, PLSCR1, SIGLECl, USP18, RTP4, and DNAPTP6.
- the type I IFN GS comprises up-regulated expression or activity of genes IFI27, IFI44, IFI44L, and RSAD2.
- the type I IFN GS further comprises up-regulated expression or activity of gene IFI6.
- the antibody or antigen binding fragment thereof specifically binds to an IFN receptor.
- the IFN receptor is an IFN alpha receptor.
- the IFN alpha receptor is IFNARl.
- the antibody or antigen binding fragment thereof specifically binds to subunit 1 of IFNARl.
- the antibody or antigen binding fragment thereof is monoclonal.
- the antibody or antigen binding fragment thereof comprises an immunoglobulin IgG Fc region.
- the antibody is MEDI-546.
- IFN-mediated disease or disorder are autoimmune diseases.
- the autoimmune diseases are rheumatic diseases.
- the rheumatic diseases are selected from the group consisting of systemic lupus erythematosus (SLE), scleroderma (SSc), myositis, and lupus nephritis.
- SLE systemic lupus erythematosus
- SSc scleroderma
- myositis myositis
- lupus nephritis systemic lupus erythematosus
- SSc scleroderma
- myositis myositis
- myositis myositis.
- the first type I IFN-mediated disease or disorder is SSc and the second type I IFN-mediated disease or disorder is lupus nephritis.
- the PK/PD data corresponding to the first or second type I IFN-mediated disease or disorder comprise binding affinity data.
- the binding affinity data corresponds to the binding of an antibody or antigen binding fragment thereof to an IFN receptor.
- the antibody or antigen binding fragment thereof is MEDI-546.
- the IFN receptor is IFNAR1.
- the PK/PD data corresponding the first or second type I IFN-mediated disease or disorder comprise kinetics data.
- the kinetics data is corresponds to internalization kinetics of an antigen-antibody complex by cells.
- the antigen is IFNAR1.
- the antibody is MEDI-546.
- the cells are THP- 1 cells.
- the PK/PD data corresponding the first or second type I IFN-mediated disease or disorder comprise type I IFN GS suppression data.
- the type I IFN GS suppression is full suppression.
- the type I IFN GS suppression is partial suppression.
- the IFN GS comprises up-regulated expression or activity of genes IFI27, IFI44, IFI44L, RSAD2, and IFI6.
- the PK/PD stochastic model comprises two compartments. In some aspects of the computer-readable medium, the two compartments in the PK/PD stochastic model are a central compartment and a peripheral compartment. In some aspects of the computer-readable medium, the PK/PD stochastic model further comprises a skin compartment. In some aspects of the computer-readable medium, the PK/PD stochastic model comprises two elimination pathways. In some aspects of the computer-readable medium, the two elimination pathways in the PK/PD stochastic model are a clearance pathway and a target-mediated disposition pathway. In some aspects of the computer-readable medium, the clearance pathway in the PK/PD stochastic model is a reticuloendothelial system pathway.
- FIG. 1 shows baseline type I IFN Gene Signature (type I IFN GS) scores for SLE
- FIGS. 2A to 2D shows median type I IFN GS profiles (FIG. 2A and FIG. 2B) and percent remaining type I IFN GS (FIG. 2C and FIG. 2D) in diffuse SSc patients following single or multiple IV administrations of MEDI-546 in whole blood specimens (FIG. A and FIG. 2C) or skin specimens (FIG. 2B and FIG. 2D) from MI-CP 180 trial.
- the single and multiple dose treatment cohorts have been separated into their respective graph.
- X-axis represents time from the start of the study in days, where day 0 is pre treatment.
- Target modulation for each dose cohort is reported as a percentage from starting values of 100%, so each point post treatment for each cohort indicates the median percentage of remaining GS. Only baseline positive GS 0 score SSc patients were plotted. The minimum and average GS score among the pool of normal healthy controls are shown as the black dashed line and grey dashed line respectively (FIG. 2A and FIG. 2B).
- FIG. 3 shows the measurement of MEDI-546 internalization rate in THP- 1 cells by confocal fluorescence imaging studies.
- Cells were stained with CFSE (cytosol) and MEDI-546-Alexa647. Internalization was initiated by transferring cells from ice to 37°C. Overlays of CFSE and MEDI-546-Alexa647 fluorescent images are shown before (FIG. 3A) and 40 min after the start of internalization (FIG. 3B).
- MEDI-546-Alexa647 fluorescence signals in cytoplasm were normalized to total fluorescence and plotted versus time (FIG. 3C). Each data point represents the average of triplicates in an experiment. The graph combined data obtained from four independent experiments.
- FIG. 4 shows the MEDI-546 PK-PD model structure. Ab, Ab p and Ab skin are
- MEDI-546 in the central, peripheral and skin compartments, respectively.
- Q is the inter- compartmental clearance.
- the partitioning of MEDI-546 from blood (serum) to skin is represented by kb s and k s b.
- CLRES represents the clearance by the reticuloendothelial system.
- MEDI-546 (Ab) binds to IFNAR1 (R) and the complex (Ab.R) is subsequently internalized and degraded inside the cells.
- GSiFN,wb and GSiFN,skin represent type I IFN GS in the whole blood and skin, respectively.
- I max is the maximum fractional extent of inhibition of type I IFN GS production by MEDI-546
- IC5 0 potency (MEDI-546 concentration corresponding to half maximum inhibition of type I IFN GS production).
- kjn and k out are the production rate and elimination rate constant of IFN genes. The inclusion of the skin compartment is for simulation purpose only. There is no MEDI-546 mass loss from the central compartment due to the partitioning to the skin tissues.
- FIGS. 5A to 5D show representative individual MEDI-546 PK and type I IFN GS profiles in diffuse SSc patients from the MI-CP 180 clinical trial.
- FIGS. 5A and 5B correspond to PK and PD of single-dose phase, respectively.
- FIGS. 5C and 5D correspond to PK and PD of multiple-dose phase, respectively.
- Two patients were selected for each dose phase, one from a lower dose group and the other from a high dose group.
- Patients in the multiple-dose cohorts received four weekly intravenous administrations of MEDI-546; the last dose was given on Day 28. Open circles represent observed serum concentration of MEDI-546 or type I GS in peripheral blood.
- Grey lines are the population predictions while the black lines are individual predictions by the population PK-PD model.
- SD single dose regimen
- MD multiple dose regimen
- SID subject ID.
- FIGS. 6A and 6B show simulated type I IFN GS profiles in peripheral blood (FIG.
- FIG. 7 shows the target modulation profiles in the blood of seven SSc patients with baseline GSo >13 from the MI-CP 180 clinical trial.
- Black and grey lines represent single dose (0.3, 1, 10 or 20 mg/kg) or multiple dose (1 mg/kg) regimens respectively; the grey dashed line represents the average value of type I IFN GS score (1.1) of the pool of normal healthy controls.
- Mpk mg/kg.
- FIG. 8 shows the specific binding of MEDI-546 to THP-1 cells.
- Cells were stained with CFSE (cytosol) and either IgG-Alexa647 (A) or MEDI-546-Alexa647 (B). Overlays of CFSE and Alexa647 fluorescent images are shown from a representative experiment.
- FIGS. 9A and 9B show observed and model-predicted MEDI-546 PK profiles in diffuse SSc patients. Patients enrolled in the multiple-dose cohorts received four weekly IV administrations of MEDI-546. Symbols represent observed values. The grey solid lines are the population predictions and the black solid lines are the individual predictions. SD: single- dose, MD: multiple-dose, SID: subject ID. X-axes represent days. Y-axes represent MEDI- 546 concentrations ⁇ g/mL).
- FIGS. 10A and 10B show observed and model-predicted blood type I IFN GS profiles in diffuse SSc patients. Patients enrolled in the multiple-dose cohorts received four weekly IV administrations of MEDI-546. Symbols represent observed values. The grey solid lines are the population predictions and the black solid lines are the individual predictions. SD: single-dose, MD: multiple-dose, SID: subject ID. X-axes represent days. Y-axes represent type I IFN GS scores.
- FIG. 1 1A and 1 1B show observed and model-predicted Target Modulation in peripheral blood from diffuse SSc patients.
- Patients enrolled in the multiple-dose cohorts received four weekly IV administrations of MEDI-546. Symbols represent observed values.
- the grey solid lines are the population predictions and the black solid lines are the individual predictions.
- SD single-dose
- MD multiple-dose
- SID subject ID.
- X-axes represent days.
- Y- axes represent (100% - Target Modulation) (%).
- FIG. 12 shows visual predictive checks of MEDI-546 PK profiles in adult SSc patients. Symbols represent observed serum concentrations of MEDI-546. The solid lines are medians of 1,000 simulated replicates. The dashed lines represent 5th/95th or 10th/90th percentiles from 1 ,000 simulations using the population PK-PD model.
- FIG. 13 shows visual predictive checks of type I IFN GS responses in adult SSc patients following MEDI-546 administration. Symbols represent observed type I IFN GS in peripheral blood. The solid lines are medians of 1,000 simulated replicates. The dashed lines represent 5th/95th or 10th/90th percentiles from 1,000 simulations using the population PK- PD model.
- FIG. 14 shows observed and simulated type I IFN GS scores in skin tissues from
- FIG. 14A Baseline
- FIG. 14B post-dose scores
- MEDI-546 (see U.S. 2011-0059078, herein incorporated by reference in its entirety), a fully human IgGi kappa monoclonal antibody directed against subunit 1 of IFNAR1 that blocks all type I IFNs, was tested in a first-time- in-human trial (FTIH) in diffuse systemic sclerosis (SSc).
- FTIH first-time- in-human trial
- SSc diffuse systemic sclerosis
- a type I IFN Gene Signature (type I IFN GS) shared by systemic lupus erythematous (SLE) and SSc was developed to evaluate the pharmacodynamics, and potentially to predict clinical benefit of MEDI-546.
- autoimmune disease refers to a disorder, disease state or condition associated with the formation of autoantibodies reactive with the patient's own cells to form antigen-antibody complexes.
- the term "autoimmune disease” includes conditions such as, e.g., systemic lupus erythematosus, as well as those disorders which are triggered by a specific external agent, e.g., acute rheumatic fever.
- autoimmune disorders include, but are not limited to, autoimmune hemolytic anemia, autoimmune hepatitis, Berger's disease, chronic fatigue syndrome, Crohn's disease, dermatomyositis, fibromyalgia, Graves' disease, Hashimoto's thyroiditis, idiopathic thrombocytopenia purpura, lichen planus, multiple sclerosis, myasthenia gravis, psoriasis, rheumatic fever, rheumatoid arthritis, scleroderma, Sjogren's syndrome, systemic lupus erythematosus, type 1 diabetes, ulcerative colitis, and vitiligo.
- the autoimmune disease is systemic lupus erythematosus (SLE), scleroderma (SSc), myositis, or lupus nephritis.
- Interferon alpha receptor-1 Interferon alpha receptor-1
- IFNARl Interferon alpha receptor 1
- IFNARl Interferon alpha receptor 1
- IFNARl human antibodies specific for human IFNARl, in certain cases, cross-react with IFNARl from species other than human, or other proteins which are structurally related to human IFNARl (e.g., human IFNARl homologs). In other cases, the antibodies can be completely specific for human IFNARl and not exhibit species or other types of cross-reactivity.
- the complete eDNA sequence of human IFNAR1 has the Genbank accession number NM 000629.
- type I interferon or "type I IFN” as used herein refer to members of the type I interferon family of molecules that are ligands for IFNAR1 (i.e., members of the type I interferon family of molecules that are capable of binding IFNAR1).
- type I interferon ligands are interferon alpha 1, 2a, 2b, 4, 5, 6, 7, S, 10, 14, 16, 17, 21, interferon beta and interferon omega.
- type I IFN-mediated disease or disorder refers to any type I IFN or
- IFNa inducible disease, disorder, or condition that exhibits a type I IFN PD marker expression profile or gene signature type I IFN GS.
- a PD marker expression profile and a gene signature will be understood to be equivalent.
- diseases, disorders, or conditions include those with an autoimmune component such as systemic lupus erythematosus (SLE), scleroderma, lupus nephritis, o myosotis.
- SLE systemic lupus erythematosus
- scleroderma lupus nephritis
- o myosotis o myosotis.
- a type I IFN-mediated disease or disorder can be treated by administering a small molecule or a biological agent, e.g., an antibody or an antigen binding fragment thereof. If the therapeutic agent is a biological agent, it may be an antibody specific for any subtype(s) of type I IFN or IFNa.
- the antibody may be specific for any one of IFNal, IFNa2, IFNa4, IFNa5, IFNao, IFNa7, IFNa8, IFNalO, IFNaW, IFNa 17, IFNa21, IFNp, or IFNco.
- the antibody may be specific for any two, any three, any four, any five, any six, any seven, any eight, any nine, any ten, any eleven, any twelve type I IFN of IFNa subtypes.
- the antibody may be specific for IFNal, IFNa2, IFN a4, IFNa5, IFNa8, IFNalO, and IFNa21; or it may be specific for IFNal, IFNa2, IFNa4, IFNa5, IFNa8, and IFNalO; or it may be specific for IFNal, IFNa2, IFNa4, IFNa5, IFNa8, and IFNa21; or it may be specific for IFNal, IFNa2, IFNa4, IFNa5, IFNalO, and IFNa21.
- a therapeutic agent that modulates IFNa activity may neutralize IFNa activity.
- a type I IFN-mediated disease or disorder can also be treated with antibodies specific for a type I IFN receptor, e.g., IFNAR1.
- anti-IFNARl antibodies can cross-react with IFNAR1 from species other than human.
- the anti-IFNARl antibodies can be specific for IFNAR1 only and not exhibit species or other types of cross-reactivity.
- the anti-IFNARl antibodies exhibit reduced binding affinities for FC ligands and have reduced or ablated effector function (ADCC and/or CDC), reduced or ablated binding to Fc ligands, or reduced or ablated toxicities as compared to an unmodified antibody.
- MEDI-546 refers to an Fc-modified version of the anti-IFNAR 9D4 antibody described in U.S. Patent No. 7,662,381.
- the sequence of MEDI-546 is described in U.S. 2011-0059078.
- MEDI-546 comprises a combination of three mutations: L234F, L235E, and P331S, wherein the numbering is according to the EU index as set forth in Kabat, introduced into the lower hinge and CH2 domain of human IgGl, which cause a decrease in their binding to human FcyRI (CD64), FcyRIIA (CD32A), FcyRIII (CD16) and Clq.
- antibody or antigen-binding fragment thereof that modulates type I IFN activity refers to an antibody (see infra) in its broadest sense capable of modulating type I IFN activity in a patient.
- modulating includes the inhibition or suppression of a type I IFN activity as well as the induction or enhancement of a type I IFN activity.
- the type I IFN activity is IFNa activity.
- the suppression of a type IFN GS is a suppression of a type I IFN activity.
- the antibody or antigen-binding fragment thereof is monoclonal.
- the antibody or antigen-binding fragment thereof that modulates type I IFN activity specifically binds to a type I IFN receptor such as IFNAR1. In some specific aspects, the antibody or antigen- binding fragment thereof specifically binds to subunit 1 of IFNAR1.
- antibody is used herein in its broadest sense and includes, e.g., monoclonal antibodies, polyclonal antibodies, multivalent antibodies, multispecific antibodies, chimeric antibodies, and humanized antibodies.
- the term “antibody” includes whole antibodies.
- antibody also refers to a protein comprising at least two immunoglobulin heavy (H) chains and two immunoglobulin light (L) chains inter-connected by disulfide bonds, or an antigen binding portion thereof.
- Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant region.
- the heavy chain constant region is comprised of three domains, CHI, CH2 and CH3.
- Each light chain is comprised of a light chain variable region (abbreviated herein as VL) and a light chain constant region.
- the light chain constant region is comprised of one domain, CL.
- the VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR).
- CDR complementarity determining regions
- FR framework regions
- Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
- the variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
- the constant regions of the antibodies can mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq) of
- antigen-binding fragment refers to one or more fragments of an antibody that retain the ability to specifically bind to an antigen (e.g., IFNAR). It has been shown that the antigen-binding function of an antibody can be performed by fragments of a full-length antibody.
- binding fragments encompassed within the term "antigen- binding fragment" of an antibody include (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CHI domains; (ii) a F(ab')2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CHI domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a dAb fragment (Ward et al, (1989) Nature 341 :544-546), which consists of a VH domain; and (vi) an isolated complementarity determining region (CDR).
- a Fab fragment a monovalent fragment consisting of the VL, VH, CL and CHI domains
- F(ab')2 fragment a bivalent fragment comprising two Fab fragments linked by a disul
- the two domains of the Fv fragment, VL and VH are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (known as single chain Fv (scFv); see e.g., Bird et al. (1988) Science 242:423-426; and Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883).
- single chain Fv single chain Fv
- Such single chain antibodies are also intended to be encompassed within the term "antigen-binding fragment" of an antibody.
- an "isolated antibody,” as used herein, is intended to refer to an antibody that is substantially free of other antibodies having different antigenic specificities (e.g., an isolated antibody that specifically binds IFNAR is substantially free of antibodies that specifically bind antigens other than IFNAR).
- An isolated antibody that specifically binds IFNAR can, however, have cross-reactivity to other antigens, such as IFNAR molecules from other species.
- an isolated antibody can be substantially free of other cellular material and/or chemicals.
- the term "monoclonal antibody” as used herein refer to a preparation of antibody molecules of single molecular composition.
- a monoclonal antibody displays a single binding specificity and affinity for a particular epitope.
- human antibody is intended to include antibodies having variable regions in which both the framework and CDR regions are derived from human germline immunoglobulin sequences. Furthermore, if the antibody contains a constant region, the constant region also is derived from human germline immunoglobulin sequences.
- the human antibodies of the disclosure can include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site- specific mutagenesis in vitro or by somatic mutation in vivo).
- the term "human antibody”, as used herein is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
- human monoclonal antibody refers to antibodies displaying a single binding specificity which have variable regions in which both the framework and CDR regions are derived from human germline immunoglobulin sequences.
- the human monoclonal antibodies are produced by a hybridoma which includes a B cell obtained from a transgenic nonhuman animal, e.g., a transgenic mouse, having a genome comprising a human heavy chain transgene and a light chain transgene fused to an immortalized cell.
- recombinant human antibody includes all human antibodies that are prepared, expressed, created or isolated by recombinant means, such as (a) antibodies isolated from an animal (e.g., a mouse) that is transgenic or transchromosomal for human immunoglobulin genes or a hybridoma prepared therefrom (described further below), (b) antibodies isolated from a host cell transformed to express the human antibody, e.g., from a transfectoma, (c) antibodies isolated from a recombinant, combinatorial human antibody library, and (d) antibodies prepared, expressed, created or isolated by any other means that involve splicing of human immunoglobulin gene sequences to other DNA sequences.
- Such recombinant human antibodies have variable regions in which the framework and CDR regions are derived from human germline immunoglobulin sequences.
- such recombinant human antibodies can be subjected to in vitro mutagenesis (or, when an animal transgenic for human Ig sequences is used, in vivo somatic mutagenesis) and thus the amino acid sequences of the VH and VL regions of the recombinant antibodies are sequences that, while derived from and related to human germline VH and VL sequences, may not naturally exist within the human antibody germline repertoire in vivo.
- antibody as used herein also includes “chimeric” antibodies in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (U.S. Patent No. 4,816,567; and Morrison et al, Proc. Natl. Acad. Sci. USA 57:6851-6855 (1984)).
- CDR complementarity determining region
- Kabat et al. also defined a numbering system for variable domain sequences that is applicable to any antibody.
- One of ordinary skill in the art can unambiguously assign this system of "Kabat numbering" to any variable domain sequence, without reliance on any experimental data beyond the sequence itself.
- Kabat numbering refers to the numbering system set forth by Kabat et al. (1983) U.S. Dept. of Health and Human Services, "Sequence of Proteins of Immunological Interest.” Unless otherwise specified, references to the numbering of specific amino acid residue positions in an anti-IFNAR antibody or antigen-binding fragment, variant, or derivative thereof of the present disclosure are according to the Kabat numbering system.
- the terms “treat” or “treatment” refer to both therapeutic treatment and prophylactic or preventative measures, wherein the object is to prevent or slow down (lessen) an undesired physiological change or disorder, such as the progression of an autoimmune condition, e.g., a rheumatic condition.
- Beneficial or desired clinical results include, but are not limited to, alleviation of symptoms, diminishment of extent of disease, stabilized (i.e., not worsening) state of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, and remission (whether partial or total), whether detectable or undetectable.
- Treatment can also mean prolonging survival as compared to expected survival if not receiving treatment.
- Those in need of treatment include those already with the condition or disorder as well as those prone to have the condition or disorder or those in which the condition or disorder is to be prevented.
- subject or “patient” is meant any subject, particularly a mammalian subject, for whom diagnosis, prognosis, or therapy is desired.
- the terms “subject” or “patient” include any human or nonhuman animal.
- nonhuman animal includes all vertebrates, e.g., mammals and non-mammals, such as nonhuman primates, sheep, dogs, cats, horses, cows, bears, chickens, amphibians, reptiles, etc.
- phrases such as "a patient having a type I IFN-mediated disease or disorder” includes subjects, such as mammalian subjects, that would benefit from the administration of an antibody or antigen- binding fragment thereof that modulates type I IFN activity, e.g. , for detection, imaging, or other diagnostic procedure, and/or from treatment, i.e., palliation or prevention of a disease, with such antibody or antigen-binding thereof.
- Terms such as “treating” or “treatment” or “to treat” refer to both (1) therapeutic measures that cure, slow down, lessen symptoms of, and/or halt progression of a diagnosed pathologic condition or disorder and (2) prophylactic or preventative measures that prevent and/or slow the development of a targeted pathologic condition or disorder.
- those in need of treatment include those already with the disorder; those prone to have the disorder; and those in whom the disorder is to be prevented.
- the PK/PD model was adjusted to account for the magnitude of differences in the type I IFN GS between SSc and SLE patients, and stochastic PK-PD simulations were performed to predict type I IFN GS responses in blood and skin specimens upon multiple MEDI-546 administrations in virtual SLE patients.
- This approach facilitated a rapid progression of MEDI-546 clinical development and the optimal design of a Phase 2 study in SLE.
- Stochastic simulations predicted that once-every-four-week intravenous administrations of MEDI-546 at lOOmg, 300mg or lOOOmg fixed doses could suppress the type I IFN GS in the blood of SLE patients to the level of healthy normal subjects (mean ⁇ 2 standard).
- the present disclosure provides a pharmacokinetic/pharmacodynamic
- the PK/PD stochastic model for type I IFN-mediated diseases or disorders.
- the PK/PD stochastic model comprises two compartments. These two compartments can be a central compartment and a peripheral compartment.
- the PK/PD stochastic model can comprises additional compartments, e.g., a skin compartment.
- the PK/PD stochastic model comprises can also comprise at least one elimination pathway.
- the PK/PD stochastic model comprises two elimination pathways.
- the two elimination pathways are a clearance pathway and a target-mediated disposition pathway.
- the clearance pathway in the PK/PD stochastic model is a reticuloendothelial system pathway.
- the PK/PD stochastic model can be used, for example for translational purposes.
- PK/PD data corresponding a first type I IFN-mediated disease or disorder can be used to generate the PK/PD stochastic model, and then the PK/PD stochastic model can be adjusted using inputted PK/PD data from the second type I IFN-mediated disease or disorder.
- This adjusted model can be used in turn to conduct simulation and infer information corresponding to the second type I IFN-mediated disease or disorder such as determining optimal dosage regimens, determining whether a candidate therapeutic agent should be selected to treat a patient, select a candidate patient for therapy, or design a personalized therapy.
- the adjusted model can be used, for example, to select candidate subjects for a clinical study.
- the PK/PD data for the first or second type I IFN-mediated disease or disorder can comprise binding affinity data.
- the binding affinity data can correspond to the binding of an antibody or antigen binding fragment thereof to a type I IFN receptor.
- the antibody or antigen binding fragment thereof is MEDI-546.
- the type I IFN receptor is IFNAR1.
- the first type I IFN-mediated disease or disorder is SSc and the second type I IFN-mediated disease or disorder is SLE. In some other aspects, the first type I IFN-mediated disease or disorder SSc and the second type I IFN-mediated disease or disorder is myositis. In some aspects, the first type I IFN-mediated disease or disorder is SSc and the second type I IFN-mediated disease or disorder is lupus nephritis. In general, the first and second type I IFN-mediated diseases or disorders can be rheumatic diseases. One skilled in the art will appreciate that other pairs of type I IFN-mediated related diseases or disorders can be used.
- the PK/PD data corresponding the first or second type I IFN- mediated disease or disorder comprise kinetics data, e.g., internalization kinetics of an antigen-antibody complex by cells.
- the antigen is IFNAR1.
- the antibody is MEDI-546.
- the cells are THP-1 cells.
- antibodies, antigens, and cell lines can be used.
- the PK/PD data corresponding to the first or second type I IFN- mediated disease or disorder comprise type I IFN GS suppression data (e.g., full suppression or partial suppression).
- the type I IFN GS comprises up-regulated expression or activity of genes IFI27, IFI44, IFI44L, and RSAD2.
- the type I IFN GS further comprises IFI6.
- IFI6 One skilled in the art would appreciate that other type I IFN GS can be used, as discussed below.
- the present disclosure provides a method of treating a patient having a type I IFN- mediated disease or disorder comprising administering a fixed dose of an antibody or antibody fragment thereof that modulates type I IFN activity, wherein the dose is effective to treat the disorder.
- the antibody is an anti IFNAR antibody.
- the antibody is an anti-IFNARl antibody, e.g., MED 1-546.
- a "fixed dose” as used herein refers to a dose that is administered to a patient without regard for the weight (WT) or body surface area (BSA) of the patient.
- the fixed dose of antibody or antibody fragment thereof that modulates type I IFN activity, e.g., MED 1-546, is therefore not provided as a mg/kg dose or mg/m2 dose, but rather as an absolute amount of the therapeutic agent.
- an antibody or antibody fragment thereof that modulates type I is provided.
- IFN activity is administered as a fixed dose ranging from about 100 mg to about 1000 mg. In other aspects, the fixed dose is from about 300 mg to about 1000 mg. In some aspects, the fixed dose is lower than about 300 mg. In some specific aspects, the antibody or antibody fragment thereof that modulates type I IFN activity is MEDI-546.
- an antibody or antibody fragment thereof that modulates type I is provided.
- IFN activity is administered at a fixed dose of about 10 mg, or about 20 mg, or about 30 mg, or about 40 mg, or about 50 mg, or about 60 mg, or about 70 mg, or about 80 mg, or about 90 mg, or about 100 mg.
- an antibody or antibody fragment thereof that modulates type I IFN activity is administered at a fixed dose of about 100 mg, or about 150 mg, about 200 mg, or about 300 mg, or about 400 mg, or about 500 mg, or about 600 mg, or about 700 mg, or about 800 mg, or about 900 mg, or about 1000 mg, or about 1100 mg, or about 1200 mg, or about 1300 mg, or about 1400 mg, or about 1500 mg, or about 1600 mg, or about 1700 mg, or about 1800 mg, or about 1900 mg, or about 2000 mg.
- the fixed dose is about 100 mg.
- the fixed dose is about 300 mg.
- the fixed dose is about 1000 mg.
- the antibody or antibody fragment thereof that modulates type I is provided.
- IFN activity can be administered intravenously, intramuscularly, subcutaneously, or a combination thereof.
- the antibody or antibody fragment thereof that modulates type I IFN activity can also be administered by any means known in the art.
- the antibody or antibody fragment thereof that modulates type I IFN activity is administered intravenously at a fixed dosage about 100 mg, or about 300 mg, or about 1000 mg.
- the antibody or antibody fragment thereof that modulates type I IFN activity is administered subcutaneously at a fixed dosage of about 100 mg, or about 300 mg, or about 1000 mg.
- a loading dose of the antibody or antibody fragment thereof that modulates type I IFN activity is administered.
- the antibody or antibody fragment thereof that modulates type I IFN activity is administered intravenously at a fixed dosage about 100 mg, or about 300 mg, or about 1000 mg once per month. In some aspects, the antibody or antibody fragment thereof that modulates type I IFN activity can be administered subcutaneously.
- a series of fixed doses of an antibody or antibody fragment thereof that modulates type I IFN activity are administered, these doses can, for example, be administered approximately every week, approximately every 2 weeks, approximately every 3, or about every 4 weeks.
- fixed doses of an antibody or antibody fragment thereof that modulates type I IFN activity are administered approximately every day, approximately every two days, approximately every three days, approximately every 4 days, approximately every 5 days, approximately every 6 days, or approximately every seven days.
- the fixed dose of antibody or antibody fragment thereof that modulates type I IFN activity is a 100 mg dose administered monthly. In another specific aspect, the fixed dose of antibody or antibody fragment thereof that modulates type I IFN activity is a 300 mg dose administered monthly. In a specific aspect, the fixed dose of antibody or antibody fragment thereof that modulates type I IFN activity is a 1000 mg dose administered monthly. In specific aspects, the fixed dose of antibody or antibody fragment thereof that modulates type I IFN activity is a 100 mg, 300 mg, or 1000 mg monthly dose of MEDI-546.
- fixed doses of antibody or antibody fragment thereof that modulates type I IFN activity can be administered every month. Successive doses can be administered in successive months. These fixed doses can be administered, for example, for about 1 month, or about 2 months, or about 3 months, or about 4 months, or about 5 months, or about 6 months. Such fixed doses can, for example, continue to be administered until disease progression, adverse event, or other parameter occurs as determined by a healthcare provider, e.g., suppression or lack of suppression of a type I IFN GS.
- patients can be administered at least one, at least 2, at least
- fixed doses of antibody or antibody fragment thereof that modulates type I IFN activity are administered at equal time intervals. In other embodiment, fixed doses of antibody or antibody fragment thereof that modulates type I IFN activity are administered at varying intervals. In some aspects, all administered fixed doses are essentially identical. In other aspects, at least one fixed dose is different with respect to the other doses, e.g., in volume, concentration, route of administration, formulation, etc.
- autoimmune diseases e.g., SLE, SSc, myositis, or lupus nephritis
- type I IFN activity e.g., MEDI-546
- the fixed dose of antibody or antibody fragment thereof that modulates type I IFN activity will depend, for example, on the type of disease to be treated, as defined above, the severity and course of the disease, whether the antibody is administered for preventive or therapeutic purposes, previous therapy, the patient's clinical history and response to the antibody, and the discretion of the attending physician.
- the disclosure provides a method of treating a type I
- IFN-mediated disease or disorder such as an autoimmune disorder (e.g., SLE, SSc, lupus nephritis, myositis) in a patient comprising administering at least one intravenous or subcutaneous fixed dose of an anti-IFNAR antibody such as MEDI-546 to the patient, wherein the fixed dose is about 100 mg, about 300 mg, or about 1000 mg.
- an autoimmune disorder e.g., SLE, SSc, lupus nephritis, myositis
- an anti-IFNAR antibody such as MEDI-546
- IFN GS Interferon Gene Signature
- the present disclosure also provides a type I Interferon Gene Signature (type I).
- IFN GS that can be specifically suppressed when a patient suffering from a type I IFN- mediated disease or disorder is treated with a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity.
- the type I IFN GS that can be suppressed with a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity is a subset of the 21 genes used as pharmacodynamics (PD) markers for sifalimumab, an anti-IFN-a monoclonal therapy in SLE described previously (Yao et al, Arthritis Rheum. 60: 1785-1796 (2009); Yao et al, Hum. Genomics Proteomics 2009:374312 (2009); Yao et al, Arthritis Res. Ther. 12 (Suppl 1):S6 (2010)).
- PD pharmacodynamics
- these 21 genes are: IFI27 (interferon alpha inducible protein 27) (SEQ ID NO:3), IFI44 (interferon-induced protein 44) (SEQ ID NO:4), IFI44L (interferon induced protein 44, like) (SEQ ID NO:5), RSAD2 (radical S-adenosyl methionine domain containing 2) (SEQ ID NO: 6), IFI6 (interferon, alpha inducible protein 6) (SEQ ID NO: 7), MX1 (myxo virus (influenza virus) resistance 1, interferon-inducible protein p78) (SEQ ID NO: 8), IFIT1 (interferon- induced protein with tetratricopeptide repeats 1) (SEQ ID NO:9), HERC5 (hect domain and RLD 5) (SEQ ID NO:10), ISG15 (ISG15 ubiquitin-like modifier) (SEQ ID NO: 11), LAMP
- IFI27 sp 1 P403051 IFI27 HU MEASALTSSAVTSVAKVVRVASGSAWLPLARIATVVIGGWA
- PADPTWNVGHGSWELLAQEAAALGMQACFLSRDGTSVQPWDVM PALLYQTPAGDLDKFISEFLQPNRQFL
- the type I IFN GS that can be suppressed with a fixed dose of of an antibody or antigen-binding fragment thereof that modulates type I IFN activity comprises up-regulated expression or activity of at least 4 PD markers. In some aspects, the type I IFN GS comprises up-regulated expression or activity of at least 5 PD markers. In some aspects, the type I IFN GS comprises up-regulated expression or activity of genes IFI27, IFI44, IFI44L, and RSAD2. In some aspects, the type I IFN GS further comprises up-regulated expression or activity of gene IFI6.
- the genes in a type I IFN GS that can be suppressed with a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity are selected based on three primary criteria: (i) prevalence and magnitude of over-expression in patients compared to healthy controls; (ii) ability to be induced in whole blood from healthy donors ex vivo by type I IFN; and, (iii) the ability to be substantially suppressed by an antibody or antigen-binding fragment thereof that modulates type I IFN activity, e.g., MEDI- 546 ex vivo in healthy donor peripheral blood mononuclear cells after stimulation by SLE serum (see. e.g., Yao et ah, Hum. Genomics Proteomics 2009:374312 (2009)).
- a type I IFN GS score corresponding to up-regulated expression of the type I IFN GS in blood and lesional skin of patients can be calculated from the expression level of the genes in the type I IFN GS.
- the type I IFN GS score and its suppression after treatment can be measured, for example, in whole blood (e.g., in peripheral blood) or skin samples from a patient.
- a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity can suppress or neutralize a type I IFN GS of the present disclosure.
- This suppression can be a reduction in the expression levels in at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least 10, at least 1 1, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20 or at least 21 up-regulated genes in the type I IFN GS.
- the suppression is a reduction in the expression levels of 4 up-regulated genes in the type I IFN GS.
- the suppression is a reduction in the expression levels of 5 up-regulated genes in the type I IFN GS.
- Suppression can be partial suppression or full suppression of the expression of the genes in the type I IFN GS.
- Suppression of the up-regulated expression of the type I IFN GS can be a reduction of at least 2%, at least 3%, at least 4%, at least 5%, at least 7%, at least 8%, at least 10%, at least 15%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, or at least 90% of any of the at least one, at least two, at least three, at least five, at least seven, at least eight, at least 10, at least 1 1, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20 or at least 21 up-regulated genes in a type I IFN GS.
- suppression of the up-regulated expression of the type I IFN GS refers to a reduction of expression levels of at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20 or at least 21 genes, of at most 50%, at most 45%, at most 40%, at most 35%, at most 30%, at most 25%, at most 20%, at most 15%, at most 10%, at most 5%, at most 4%, at most 3%, at most 2%, or at most 1% of the expression levels of those genes in a control or reference.
- the antibody or antigen-binding fragment thereof that modulates type I IFN activity e.g., an anti-IFNAR antibody such as MEDI-546 can neutralize the type I IFN GS at fixed doses of about 100 mg, about 300 mg, or about 1000 mg.
- a number of controls or reference samples can be used to determine the degree of suppression of a type I IFN GS prior to treatment or after treatment with a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity.
- a type I IFN GS after treatment with a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity agent can be compared to the type I IFN GS of the subject prior to the administration of the fixed dose.
- a type I IFN GS after treatment with a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity can be compared to the type I IFN GS of the patient analyzed prior to the administration of the fixed dose.
- other references such as the average type I IFN GS in a population, the type I IFN GS in a non-responsive patient, or the type I IFN GS in a relapsed patient can be used for comparison.
- IFN GS can be determined by any means known in the art. For example, up- or down- regulation of gene expression can be detected by determining mRNA levels. mRNA expression may be determined, for exampler, by northern blotting, slot blotting, quantitative reverse transcriptase polymerase chain reaction, or gene chip hybridization techniques. See, e.g., U.S. Pat. Nos. 5,744,305 and 5, 143,854 for examples of making nucleic acid arrays for gene chip hybridization techniques. See also Hrovat et al, Cell. Mol. Biol. Lett. 1 : 55-69 (2010), Svec et al, Int. J. Exp. Pathol. 1 : 44-53 (2010), and Kurokawa et al, Cancer Chemother. Pharmacol. 3: 427-436 (2010), for examples of how to use the TAQMAN® method for measuring gene expression.
- Primers that selectively bind to targets in polymerase chain reactions can be chosen based on empirically determining primers that hybridize in a PCR reaction and produce sufficient signal to detect the target over background, or can be predicted using the melting temperature of the primentarget duplex as described in Maniatis et al. Molecular Cloning, Second Edition, Section 11.46 (1989).
- nucleic acid probes for detecting PCR products in a TAQMAN® or related method can be empirically chosen or predicted.
- Such nucleic acid primers and probes may be between 10 and 30 nucleotides or greater in length.
- IFN GS can also be determined by detecting protein levels. Methods for detecting protein expression levels include, for example, immuno-based assays such as enzyme-linked immunosorbant assays, western blotting, protein arrays, and silver staining. Up- or down- regulation of gene expression or activity of the PD markers in the type I IFN GS can be also determined by detecting activity of proteins including, but not limited to, detectable phosphorylation activity, de-phosphorylation activity, or cleavage activity. Furthermore, up- or down-regulation of gene expression or activity of PD markers in the type I IFN GS may be determined by detecting any combination of these gene expression levels or activities. Any combination of decreased number and decrease level of PD markers in the type IFN GS can indicate efficacy.
- immuno-based assays such as enzyme-linked immunosorbant assays, western blotting, protein arrays, and silver staining.
- Up- or down- regulation of gene expression or activity of the PD markers in the type I IFN GS can be also determined
- a type I IFN GS can be suppressed by measuring the type I IFN GS score in a sample taken from a patient having a type I IFN-mediated disease or disorder, relative to a baseline type I IFN GS score; and, subsequently administering to the patient a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity if the patient's type I IFN GS score is elevated, wherein the administration of the antibody or antigen-binding fragment thereof suppresses the IFN GS of the patient.
- a type I IFN GS can also be suppressed by administering to a patient having a type I IFN-mediated disease or disorder a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity; measuring the patient's type I IFN GS score relative to a baseline IFN GS score; and, then increasing the amount or frequency of subsequent fixed doses if the patient's type I IFN GS score is elevated; wherein the administration of the antibody or antigen-binding fragment thereof suppresses the IFN GS of the patient.
- a type I IFN GS can be suppressed by submitting a sample taken from a patient with a type I IFN-mediated disease or disorder for measurement of an type I IFN GS score; determining from the results of the measurement whether the patient's type I IFN GS score is elevated relative to a baseline type I IFN GS score; and, administering to the patient a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity if the patient's IFN GS score is elevated; wherein the administration of the antibody or antigen-binding fragment thereof suppresses the IFN GS of the patient.
- Another way of suppressing a type I IFN GS in a patient comprises administering to a patient having a type I IFN-mediated disease or disorder a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity; submitting a sample taken from the patient for measurement of a type I IFN GS score; determining from the results of the measurement whether the patient's type I IFN GS score is elevated relative to a baseline type I IFN GS score; and, increasing the amount or frequency of subsequent fixed doses if the patient's type I IFN GS score is elevated; wherein the administration of the antibody or antigen-binding fragment thereof suppresses the type I IFN GS of the patient.
- a type I IFN GS can be suppressed by submitting a sample taken from a patient with a type I IFN-mediated disease or disorder for measurement of a type I IFN GS score and comparison to a baseline type I IFN GS score; and administering to the patient a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity if the patient's type I IFN GS score is elevated; wherein the administration of the antibody or antigen-binding fragment thereof suppresses the type I IFN GS of the patient.
- a type I IFN GS can be suppressed by administering to a patient having a type I IFN-mediated disease or disorder a fixed dose of an antibody or antigen- binding fragment thereof that modulates type I IFN activity; submitting a sample taken from the patient for measurement of a type I IFN GS score and comparison to a baseline type I IFN GS score; and, increasing the amount or frequency of subsequent fixed doses if the patient's type I IFN GS score is elevated; wherein the administration of the antibody or antigen- binding fragment thereof suppresses the type I IFN GS of the patient.
- a method of suppressing a type I IFN GS in a patient comprises measuring a type I IFN GS score from a sample taken from a patient having a type I IFN- mediated disease or disorder; determining whether the patient's type I IFN GS score is elevated relative to a baseline type I IFN GS score; and, instructing a healthcare provider to administer a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity if the patient's type I IFN GS score is elevated; wherein the administration of the antibody or antigen-binding fragment thereof suppresses the type I IFN GS of the patient.
- a method of suppressing a type I IFN GS in a patient comprises obtaining a sample from a patient having a type I IFN- mediated disease or disorder, where the patent has received a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity; measuring an type I IFN GS score from the sample; determining whether the patient's type I IFN GS score is elevated relative to a baseline type I IFN GS score; and, instructing a healthcare provider to increase the amount or frequency of subsequent fixed doses if the patient's type I IFN GS score is elevated; wherein the administration of the antibody or antigen-binding fragment thereof suppresses the type I IFN GS of the patient.
- samples can be obtained by different methods known in the art, that the samples can be obtained from different tissues, that samples can be obtained at different times, and that different individuals and entities can perform the different steps in the methods disclosed above, as it is discussed in the following sections.
- the present disclosure also provides methods of treatment with an antibody or antigen-binding fragment thereof that modulates type I IFN activity and can suppress a type I IFN GS at fixed doses, thus resulting in a decrease in one or more symptoms of the type I IFN-mediated disease or disorder.
- Treatment with the antibody or antigen-binding fragment thereof that modulates type I IFN activity can result in fewer flare-ups related to the type I IFN-mediated disease or disorder, improve prognosis for the patient having the type I IFN-mediated disease or disorder, provide a higher quality of life for the patient, alleviate the need to co-administer second therapeutic agents (e.g., steroids), lessen the dosage of administration of a second agent to the patient, or reduces the number of hospitalizations of the patient that are related to the type I IFN-mediated disease or disorder.
- second therapeutic agents e.g., steroids
- samples from the patient can be obtained before or after the administration of an antibody or antigen-binding fragment thereof that modulates type I IFN activity.
- successive samples can be obtained from the patient after treatment has commenced or after treatment has ceased.
- Samples can, e.g., be requested by a healthcare provider (e.g., a doctor) or healthcare benefits provider, obtained and/or processed by the same or a different healthcare provider (e.g., a nurse, a hospital) or a clinical laboratory, and after processing, the results can be forwarded to yet another healthcare provider, healthcare benefits provider or the patient.
- a healthcare provider e.g., a doctor
- healthcare benefits provider obtained and/or processed by the same or a different healthcare provider (e.g., a nurse, a hospital) or a clinical laboratory, and after processing, the results can be forwarded to yet another healthcare provider, healthcare benefits provider or the patient.
- the measuring/determination of type I IFN GS scores, comparisons between type IFN GS scores can be, evaluation of the type
- healthcare provider refers individuals or institutions which directly interact and administer to living subjects, e.g., human patients.
- Non-limiting examples of healthcare providers include doctors, nurses, technicians, therapist, pharmacists, counselors, alternative medicine practitioners, medical facilities, doctor's offices, hospitals, emergency rooms, clinics, urgent care centers, alternative medicine clinics/facilities, and any other entity providing general and/or specialized treatment, assessment, maintenance, therapy, medication, and/or advice relating to all, or any portion of, a patient's state of health, including but not limited to general medical, specialized medical, surgical, and/or any other type of treatment, assessment, maintenance, therapy, medication and/or advice.
- the term "clinical laboratory” refers to a facility for the examination or processing of materials derived from a living subject, e.g., a human being.
- processing include biological, biochemical, serological, chemical, immunohematological, hematological, biophysical, cytological, pathological, genetic, or other examination of materials derived from the human body for the purpose of providing information, e.g., for the diagnosis, prevention, or treatment of any disease or impairment of, or the assessment of the health of living subjects, e.g., human beings.
- These examinations can also include procedures to collect or otherwise obtain a sample, prepare, determine, measure, or otherwise describe the presence or absence of various substances in the body of a living subject, e.g., a human being, or a sample obtained from the body of a living subject, e.g., a human being.
- healthcare benefits provider encompasses individual parties, organizations, or groups providing, presenting, offering, paying for in whole or in part, or being otherwise associated with giving a patient access to one or more healthcare benefits, benefit plans, health insurance, and/or healthcare expense account programs.
- a healthcare provider can administer or instruct another healthcare provider to administer an antibody or antigen-binding fragment thereof that modulates type I IFN activity.
- a healthcare provider can implement or instruct another healthcare provider or patient to perform the following actions: obtain a sample, process a sample, submit a sample, receive a sample, transfer a sample, analyze or measure a sample, quantify a sample, provide the results obtained after analyzing/measuring/quantifying a sample, receive the results obtained after analyzing/measuring/quantifying a sample, compare/score the results obtained after analyzing/measuring/quantifying one or more samples, provide the comparison/score from one or more samples, obtain the comparison/score from one or more samples, administer a therapeutic agent (e.g., an antibody or antigen-binding fragment thereof that modulates type I IFN activity), commence the administration of a therapeutic agent, cease the administration of a therapeutic agent, continue the administration of a therapeutic agent, temporarily interrupt the administration of a therapeutic agent, increase the amount of administered therapeutic agent,
- a healthcare benefits provider can authorize or deny, for example, collection of a sample, processing of a sample, submission of a sample, receipt of a sample, transfer of a sample, analysis or measurement a sample, quantification a sample, provision of results obtained after analyzing/measuring/quantifying a sample, transfer of results obtained after analyzing/measuring/quantifying a sample, comparison/scoring of results obtained after analyzing/measuring/quantifying one or more samples, transfer of the comparison/score from one or more samples, administration a therapeutic agent, commencement of the administration of a therapeutic agent, cessation of the administration of a therapeutic agent, continuation of the administration of a therapeutic agent, temporary interruption of the administration of a therapeutic agent, increase of the amount of administered therapeutic agent, decrease of the amount of administered therapeutic agent, continuation of the administration of an amount of a therapeutic agent, increase in the frequency of administration of a therapeutic agent, decrease in the frequency of administration of a therapeutic agent, maintain the same dosing frequency on a therapeutic agent
- a clinical laboratory can, for example, collect or obtain a sample, process a sample, submit a sample, receive a sample, transfer a sample, analyze or measure a sample, quantify a sample, provide the results obtained after analyzing/measuring/quantifying a sample, receive the results obtained after analyzing/measuring/quantifying a sample, compare/score the results obtained after analyzing/measuring/quantifying one or more samples, provide the comparison/score from one or more samples, obtain the comparison/score from one or more samples,
- the above enumerated actions can be performed by a healthcare provider, healthcare benefits provider, or patient automatically using a computer-implemented method (e.g., via a web service or stand-alone computer system).
- Patient samples include any biological fluid or issue, such as whole blood, serum, muscle, saliva
- Samples include any biological fluid or tissue, such as whole blood, serum, muscle, saliva, urine, synovial fluid, bone marrow, cerebrospinal fluid, nasal secretions, sputum, amniotic fluid, bronchoalveolar lavage fluid, peripheral blood mononuclear cells, total white blood cells, lymph node cells, spleen cells, tonsil cells, or skin.
- that patient sample is blood or a fraction thereof, muscle, skin, or a combination thereof.
- Patient samples can be obtained by any means known in the art.
- the present disclosure provides a method of treating a patient having a type I IFN-mediated disease or disorder comprising measuring a type I IFN GS score in a sample taken from a patient having a type I IFN- mediated disease or disorder, relative to a baseline IFN GS score; and administering to the patient a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity if the patient's type I IFN GS score is elevated; wherein the fixed dose of the antibody or fragment thereof effectively treats the disease or disorder.
- Also provided is a method of treating a patient having a type I IFN-mediated disease or disorder comprising administering to a patient having a type I IFN- mediated disease or disorder a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity; measuring the patient's type I IFN GS score relative to a baseline IFN GS score; and increasing the amount or frequency of subsequent fixed doses if the patient's IFN GS score is elevated; wherein suppression of the type I IFN GS of the patient is indicative of treatment efficacy.
- the present disclosure provides a method of treating a patient having a type I IFN-mediated disease or disorder comprising: submitting a sample taken from a patient with a type I IFN-mediated disease or disorder for measurement of a type I IFN GS score; determining from the results of the measurement whether the patient's type I IFN GS score is elevated relative to a baseline type I IFN GS score; and, administering to the patient a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity if the patient's type I IFN GS score is elevated; wherein the fixed dose of the antibody or fragment thereof effectively treats the disease or disorder.
- a method of treating a patient having a type I IFN-mediated disease or disorder comprises administering to a patient having a type I IFN-mediated disease or disorder a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity; submitting a sample taken from the patient for measurement of an IFN GS score; determining from the results of the measurement whether the patient's type I IFN GS score is elevated relative to a baseline type I IFN GS score; and, increasing the amount or frequency of subsequent fixed doses if the patient's type I IFN GS score is elevated; wherein suppression of the type I IFN GS of the patient is indicative of treatment efficacy.
- the method of treating a patient having a type I IFN-mediated disease or disorder comprises submitting a sample taken from a patient with a type I IFN- mediated disease or disorder for measurement of a type I IFN GS score and comparison to a baseline IFN GS score; and administering to the patient a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity if the patient's type I IFN GS score is elevated; wherein the fixed dose of the antibody or fragment thereof effectively treats the disease or disorder.
- the method of treating a patient having a type I IFN-mediated disease or disorder comprises administering to a patient having a type I IFN- mediated disease or disorder a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity; submitting a sample taken from the patient for measurement of a type I IFN GS score and comparison to a baseline type I IFN GS score; and increasing the amount or frequency of subsequent fixed doses if the patient's type I IFN GS score is elevated; wherein suppression of the type I IFN GS of the patient is indicative of treatment efficacy.
- the method of treating a patient having a type I IFN-mediated disease or disorder comprises measuring a type I IFN GS score from a sample taken from a patient having a type I IFN-mediated disease or disorder; determining whether the patient's IFN GS score is elevated relative to a baseline type I IFN GS score; instructing a healthcare provider to administer a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity if the patient's type I IFN GS score is elevated; wherein the fixed dose of the antibody or fragment thereof effectively treats the disease or disorder.
- the method of treating a patient having a type I IFN-mediated disease or disorder comprises obtaining a sample from a patient having a type I IFN- mediated disease or disorder, where the patent has received a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity; measuring a type I IFN GS score from the sample; determining whether the patient's type I IFN GS score is elevated relative to a baseline type I IFN GS score; instructing a healthcare provider to increase the amount or frequency of subsequent fixed doses if the patient's type I IFN GS score is elevated; wherein suppression of the type I IFN GS of the patient is indicative of treatment efficacy.
- samples from the patient may be obtained before or after administration of a therapeutic agent.
- the therapeutic agent can be a different antibody or other biologic (e.g., fusion protein or conjugate) or small molecule.
- the methods provided in the present disclosure can be applied to a patient undergoing a first therapy, determining a type I IFN GS score, and determining according to that type I IFN GS score whether to continue or discontinue the first therapy.
- the methods provided in the present disclosure can be applied to a patient undergoing a first therapy, determining a type I IFN GS score, and determining according to that type I IFN GS score whether to replace or combine the first therapy with the administration of a fixed dose of an antibody or antigen-binding fragment thereof or small molecule that modulates type I IFN activity.
- the sample obtained from the patient may be obtained prior to a first administration of a therapeutic agent, e.g., antibody or antigen-binding fragment thereof or small molecule that modulates type I IFN activity.
- a therapeutic agent e.g., antibody or antigen-binding fragment thereof or small molecule that modulates type I IFN activity.
- the patient is naive to the antibody or antigen-binding fragment thereof that modulates type I IFN activity.
- the sample obtained from the patient can occur after administration of a fixed dose of the antibody or antigen-binding fragment thereof that modulates type I IFN activity in the course of treatment.
- the therapeutic agent can be administered prior to the initiation of the monitoring protocol. Following administration a fixed dose of the antibody or antigen-binding fragment thereof that modulates type I IFN activity, additional samples can be obtained from the patient and type I IFN GS measurement be compared.
- each sample obtained can be a blood sample, or each sample obtained can be a skin or muscle sample.
- the type I IFN GS detected in each sample can be the same, can overlap substantially, or can be similar.
- the sample can be obtained at any time before or after the administration of a fixed dose of the antibody or antigen-binding fragment thereof that modulates type I IFN activity.
- the sample obtained after the administration of the fixed dose of the antibody or antigen-binding fragment thereof that modulates type I IFN activity can be obtained at least
- the sample obtained after administration of the fixed dose of antibody or antigen- binding fragment thereof that modulates type I IFN activity can be obtained at least 2, at least
- the sample obtained after administration of the fixed dose of antibody or antigen-binding fragment thereof that modulates type I IFN activity can be obtained at least 2, at least 3, at least 4, at least 5, or at least 6 months following administration.
- Additional samples can be obtained from the patient following administration of a fixed dose of the antibody or antigen-binding fragment thereof that modulates type I IFN activity. At least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 12, at least 15, at least 20, at least 25 samples can be obtained from the patient to monitor progression or regression of the type I IFN-mediated disease or disorder over time.
- Progression of the type I IFN-mediated disease or disorder can be monitored over a time period of at least 1 week, at least 2 weeks, at least 3 weeks, at least 4 weeks, at least 5 weeks, at least 6 weeks, at least 7 weeks, at least 2 months, at least 3 months, at least 4 months, at least 5 months, at least 6 months, at least 1 year, at least 2 years, at least 3 years, at least 4 years, at least 5 years, at least 10 years, or over the lifetime of the patient.
- Additional samples can be obtained from the patient at regular intervals such as at monthly, bi-monthly, once a quarter year, twice a year, or yearly intervals.
- the samples can be obtained from the patient following administration of a fixed dose of the antibody or antigen-binding fragment thereof that modulates type I IFN activity at regular intervals.
- the samples can be obtained from the patient at one week, or at two weeks, or at three weeks, or at one month, or at two months following each administration of the fixed dose of antibody or antigen-binding fragment thereof that modulates type I IFN activity.
- multiple samples may be obtained from the patient following each administration.
- Disease progression in a patient can similarly be monitored in the absence of administration of a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity.
- Samples can periodically be obtained from the patient having the disease or disorder.
- Disease progression can be identified if the type I IFN GS score increases in a later-obtained sample relative to an earlier obtained sample.
- the type I IFN GS score can increase by at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, or at least 10.
- Disease progression can be identified if the type IFN GS score increases by at least 10%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%.
- Disease progression may be identified if level of any given PD marker in the type I IFN GS increases by at least 10%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%.
- the number of up-regulated PD markers in the type I IFN GS with increased levels may be at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 15, or at least 20. Any combination of increased number and increased level of up-regulated in the type I IFN GS can indicate disease progression.
- Disease regression can also be identified in a patient having a disease or disorder, not treated by a therapeutic agent.
- regression can be identified if the type I IFN GS score decreases in a later-obtained sample relative to an earlier obtained sample.
- Disease regression can be identified if the level of any given up-regulated PD marker in the type I IFN GS decreases by at least 10%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%.
- the number of up-regulated PD markers in the type I IFN GS with decreased levels may be at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 15, or at least 20.
- Disease progression or disease regression can be monitored by obtaining samples over any period of time and at any interval.
- Disease progression or disease regression can be monitored by obtaining samples over the course of at least 1 week, at least 2 weeks, at least 3 weeks, at least 4 weeks, at least 5 weeks, at least 6 weeks, at least 7 weeks, at least 2 months, at least 3 months, at least 4 months, at least 5 months, at least 6 months, at least 1 year, at least 2 years, at least 3 years, at least 4 years, at least 5 years, at least 10 years, or over the lifetime of the patient.
- Disease progression or disease regression can be monitored by obtaining samples at least monthly, bimonthly, once a quarter year, twice a year, or yearly. The samples need not be obtained at strict intervals.
- Variance in the type I IFN GS scores among the samples after administration of a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity can guide treatment strategy of the type I IFN-mediated disease or disorder.
- Treatment strategy can be, for example, increase or decrease in dosage of a particular therapeutic, increase or decrease the frequency of administration of a particular therapeutic, removal or addition of particular therapeutics administered to a patient, commencement or suspension or treatment, etc.
- the present disclosure provides specific methods to monitor therapeutic efficacy of an antibody or antigen-binding fragment thereof that modulates type I IFN activity in a patient having a type I IFN-mediated disease or disorder.
- the method of monitoring therapeutic efficacy of a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity in a patient having a type I IFN-mediated disease or disorder comprises measuring a first type I IFN GS score in a sample taken from a patient having a type I IFN-mediated disease or disorder; administering to the patient a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity; measuring a second type I IFN GS score in a sample taken from the patient following antibody administration; and comparing the second type I IFN GS score to the first type I IFN GS score; wherein a decrease between the first and second type I IFN GS scores indicates efficacy or good prognosis.
- the method of monitoring therapeutic efficacy of a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity in a patient having a type I IFN-mediated disease or disorder comprises submitting a sample taken from a patient with a type I IFN-mediated disease or disorder for measurement of a first type I IFN GS score; administering to the patient a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity; submitting a sample taken from a patient with a type I IFN-mediated disease or disorder for measurement of a second type I IFN GS score; and comparing the second type I IFN GS score to the first type I IFN GS score; wherein a decrease between the first and second IFN GS scores indicates efficacy or good prognosis.
- the method of monitoring therapeutic efficacy of a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity in a patient having a type I IFN-mediated disease or disorder comprises measuring a first type I IFN GS score from a sample taken from a patient having a type I IFN-mediated disease or disorder; instructing a healthcare provider to administer a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity; measuring a second type I IFN GS score in a sample taken from the patient following antibody administration; and comparing the second type I IFN GS score to the first type I IFN GS score; wherein a decrease between the first and second type I IFN GS scores indicates efficacy or good prognosis.
- the method of monitoring therapeutic efficacy further comprises, for example: (a) measuring the patient's type I IFN GS score relative to a baseline IFN GS score, relative to the patient's earlier IFN GS score, or both, after the administration of the fixed dose;
- the method of monitoring therapeutic efficacy further comprises, for example:
- kits for detecting a type I IFN genetic signature can comprise containers filled with nucleic acid probes (e.g., oligonucleotides) capable of hybridizing nucleic acids (e.g., mRNA) encoding the PD markers disclosed herein or fragments thereof.
- nucleic acid probes e.g., oligonucleotides
- nucleic acids e.g., mRNA
- the present disclosure provides a kit for detecting a type I IFN genetic signature (type I IFN GS) common to two diseases, e.g., SSc and SLE, whose pathogeneses are mediated by type I IFN comprising a set of diagnostic assays capable of measuring differentially regulated pharmacodynamic (PD) marker genes in a patient sample, wherein the type I IFN GS is suppressed by the administration of a fixed dose of an antibody or antigen-binding fragment thereof that modulates type I IFN activity.
- a kit for detecting a type I IFN genetic signature (type I IFN GS) common to two diseases, e.g., SSc and SLE, whose pathogeneses are mediated by type I IFN comprising a set of diagnostic assays capable of measuring differentially regulated pharmacodynamic (PD) marker genes in a patient sample, wherein the type I IFN GS is suppressed by the administration of a fixed dose of an antibody or antigen-binding fragment thereof that modulates
- the kit comprises oligonucleotide probes for at least one PD marker gene selected from the group consisting of IFI6, RSAD2, IFI44, IFI44L, IFI27, MX1, IFIT1, HERC5, ISG15, LAMP3, OAS3, OAS1, EPST1, IFIT3, LY6E, OAS2, PLSCR1, SIGLECl, USP18, RTP4, and DNAPTP6.
- the kit can comprise 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15, 16, 17, 18, 19, 20, or 21 oligonucleotide probes capable of detecting the PD marker genes described above.
- a PD marker genes can be detected by two or more oligonucleotide probes.
- Oligonucleotide probes can be labeled by any method known in the art, e.g., using fluorescent or radioactive labels.
- Oligonucleotide probes in the kit can be unlabeled.
- the kit also contains controls and/or calibration standards.
- the kit comprises oligonucleotide probes for at least five of the
- the kit also comprises oligonucleotide probes for IFI6.
- the kit can be used for diagnostic or investigational purposes on patient samples such as blood or a fraction thereof, muscle, skin, or a combination thereof.
- the kit can comprise oligonucleotide capable of hybridizing to DNA and/or RNA.
- DNA and/or RNA can be a full gene nucleic acid, or correspond to a fragment or degradation product.
- the kit can be used the PD markers disclosed herein or fragments thereof, preferably in a purified form.
- kits's container(s) can be a notice in the form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals or biological products, which notice reflects approval by the agency of manufacture, use or sale for human administration.
- the present disclosure also provides computer-implemented a method for predicting an optimal dosage regimen with an antibody or antigen-binding fragment thereof that modulates type I IFN activity, a method for identifying an antibody or antigen-binding fragment thereof that modulates type I IFN activity as a candidate therapeutic agent for treating a type I IFN-mediated disease or disorder, a method for identifying a patient as a candidate for therapy with an antibody or antigen-binding fragment thereof that modulates type I IFN activity, and a method of designing a personalized therapy for treating a type I IFN-mediated disease or disorder with an antibody or antigen binding fragment thereof that modulates type I IFN activity.
- PK/PD data from a second type I IFN-mediated disease or disorder is inputted into a computer system comprising a pharmacokinetic -pharmacodynamic (PK/PD) stochastic model based on PK/PD data corresponding a first type I IFN-mediated disease or disorder, wherein the inputted PK/PD data from the second type I IFN-mediated disease or disorder is used to adjust the PK/PD stochastic model.
- the adjusted PK/PD stochastic model can be applied to the inputted PK/PD data from the second type I IFN- mediated disease or disorder. Based on the application of the adjusted PK/PD stochastic model to the inputted PK/PD from the second type I IFN-mediated disease or disorder, an optimal dosage regimen, a candidate therapeutic agent, a candidate patient for therapy, or a personalized therapy can be identified.
- the present disclosure also provides a computer-readable medium containing program instructions for predicting an optimal dosage regimen with an antibody or antigen- binding fragment thereof that modulates type I IFN activity, program instructions for identifying an antibody or antigen-binding fragment thereof that modulates type I IFN activity as a candidate therapeutic agent for treating a type I IFN-mediated disease or disorder, instructions for identifying a patient as a candidate for therapy with an antibody or antigen-binding fragment thereof that modulates type I IFN activity, and instructions for designing a personalized therapy for treating a type I IFN-mediated disease or disorder with an antibody or antigen binding fragment thereof that modulates type I IFN activity.
- the execution of the program instructions by one or more processors of a computer system causes the one or more processors to carry out the steps of (a) processing inputted PK/PD data from a second type I IFN-mediated disease or disorder; (b) adjusting a PK/PD stochastic model based on PK/PD data corresponding a first type I IFN-mediated disease or disorder with the processed PK/PD data from the second type I IFN-mediated disease or disorder; and, (c) executing a stochastic simulation applying the adjusted PK/PD stochastic model to the inputted PK/PD data from the second type I IFN-mediated disease or disorder.
- the output of the simulation identifies, e.g., an optimal dosage of the antibody or antigen-binding fragment thereof that modulates type I IFN activity in the second type I IFN-mediated disease or disorder, an antibody or antigen-binding fragment thereof that modulates type I IFN activity as a candidate therapeutic agent for treating the second type I IFN-mediated disease or disorder, a patient with the second type I IFN-mediated disease as a candidate for therapy with an antibody or antigen-binding fragment thereof that modulates type I IFN activity, or a personalized therapy for treating the second type I IFN-mediated disease or disorder with an antibody or antigen binding fragment thereof that modulates type I IFN activity.
- the computer implemented methods and computer-readable media disclosed herein can be implemented as a tool to be used by healthcare providers, either as a standalone tool or via a server.
- the tool can include computer-readable components, an input/output system, and one or more processing units.
- the input/output system can be any suitable interface between user and computer system, for input and output of data and other information, and for operable interaction with the one or more processing units.
- data to be inputted into the tool can be derived from in vitro or in vivo sources.
- the user can evaluate alternatives by changing one or more of the parameters and constants of the system.
- the user can predict absorption, individual parameters of absorption, as well as one or more other bioavailability parameters of a compound from relatively few input variables. Additionally, the user can evaluate alternatives by changing any of the parameters and constants of the system, and observe the ripple effect of the change in one or more parameters on all other parameters. For instance, the user can evaluate alternative absorption profiles using "What if analysis with any parameter of the system.
- a backward mode of operation the user can specify one or more objective parameters of a formulation of interest and the tool and method of the disclosure would generate alternatives to satisfy the objective.
- the user can also vary input dosing and formulation parameters for "What if analysis. Simulated absorption profiles can then be utilized for preparing suitable formulations and/or dosing regimens. Solubility, permeability, bioavailability, doses and the like also may be estimated in the backward mode of operation.
- the input/output system may provide direct input form measuring equipment.
- the input/output system preferably provides an interface for a standalone computer or integrated multi-component computer system having a data processor, a memory, and a display. Data may be entered numerically, as a mathematical expression or as a graph that represents a physiological or pharmacokinetic parameter.
- All patents and publications referred to herein are expressly incorporated by reference in their entireties.
- a total of 34 adult diffuse SSc patients who had skin thickening in an area suitable for repeat biopsy were enrolled to receive single (0.1, 0.3, 1.0, 3.0, 10.0, or 20.0 mg/kg) or multiple doses (0.3, 1.0, or 5.0 mg/kg weekly x 4) of MEDI-546, which was administered as an intravenous (IV) infusion over at least 30 minutes.
- the starting dose of 0.1 mg/kg was based on the human equivalence dose (HED) of primate pharmacologically active dose (PAD) and the predicted short duration of IFNAR occupancy by MEDI-546 in humans from translational simulations.
- HED human equivalence dose
- PAD primate pharmacologically active dose
- Cohort designation, patient demographics, and baseline type I IFN GS status are summarized in TABLE 4.
- Serum PK samples were obtained from all patients pre-dose and at pre-designated timepoints up to Day 84 (single-dose cohorts) or Day 105 (multiple-dose cohorts) for the measurement of MEDI-546 concentrations using a validated electrochemiluminescence (ECL) assay on the Meso Scale Discovery (MSD) platform.
- ECL electrochemiluminescence
- MSD Meso Scale Discovery
- MEDI-546 was captured by biotinylated soluble interferon alpha receptor (sIFNARl) bound to streptavidin- coated MSD plates.
- the captured MEDI-546 was detected with a sulfo-TAG labeled monoclonal antibody specifically targeting distinct amino acids within the Fc region of MEDI-546, which was mutated to eliminate antibody-dependent cell-mediated cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).
- An MSD read buffer was added and the plates were placed on a MSD SectorTM Imager Model 6000 reader for the generation and measurement of ECL signals.
- the assay had a measurement range of 20 to 1,280 ng/mL of MEDI-546 in human serum.
- the type I IFN GS score a quantity used to express the amount of type I IFN activity present in an individual, was measured in the whole blood or skin.
- the type I IFN GS score was calculated using a set of five genes (IFI27, IFI44, IFI44L, RSAD2, and IFI6) for each subject. On a log2 scale, the arithmetic means were calculated for each gene in a set of 24 normal control samples and the difference for each gene was calculated between each individual disease subject and the mean vector of the normal control samples.
- FC fold change
- Target modulation was then calculated as the ratio of the type I IFN GS score post dose to the type I IFN GS score pre-dose (GSo). This quantity was represented as a percentage and for each dose cohort, scaled to the GSo value. Then this quantity was subtracted from 100% to indicate the remaining percentage of type I IFN GS, so all patients at day 0 (pre-dose) started with 100% target modulation.
- MEDI-546 upon binding to IFNAR1 was assessed using live-cell confocal fluorescent imaging technology.
- MEDI-546 and an isotype control IgG were fluorescently tagged with Alexa647 using a dye-conjugation kit (A-20186) from Invitrogen (Life Technologies Corp, Carlsbad, CA). Reaction mixtures were purified from unincorporated fluorescent molecules using size-exclusion mini-columns provided in the kit.
- IFNARl-expressing THP-1 cells were maintained in suspension using RPMI growth medium containing 10% FBS, and seeded in a fresh growth medium at 2x105 cells/mL overnight prior to the experiments. On the day of experiments, THP-1 cells were washed and resuspended to a concentration of 3xl0 6 cells/mL.
- Invitrogen (Life Technologies Corp, Carlsbad, CA) in a CO 2 incubator at 37°C. Excess CFSE was removed by two washes with IxPBS. Cells were then pre-chilled, blocked with FcR blockers to prevent FcR-mediated binding, and stained on ice with 1 ⁇ g/mL of MEDI-546- Alexa647 or IgG-Alexa647 for 1-2 hours. Following the removal of unincorporated antibodies by centrifugation, cells were resuspended to initial volumes, and dispensed into the wells of 384-well imaging plates.
- a 2-compartment PK model with parallel first-order and IFNAR-mediated elimination pathways was developed to describe the observed serum concentration profiles of MEDI-546 in SSc patients (FIG. 4).
- the first-order elimination pathway represented the clearance of MEDI-546 by the reticulo-endothelial system (CLres), in the same way as for an endogenous IgG.
- CLres reticulo-endothelial system
- the nonlinear elimination pathway was presumably associated with the IFNAR-mediated clearance (antigen-sink effect).
- R represented the target receptor (IFNAR1) and AbR was the antibody-receptor complex.
- MEDI-546 bound to the receptor (k on , k 0ff ), and the antibody-receptor complex was subsequently internalized and degraded (ki nt ) inside the cells.
- Parameters k syn and ka eg represented the endogenous production and degradation of IFNAR1, respectively.
- Axissue amount of MEDI-546 in the peripheral tissue compartment
- RC concentration of the drug-receptor complex (Ab-R);
- Rt o t concentration of the total (free and bound) receptors, R + Ab-R;
- kdeg degradation (elimination of the free receptor) rate constant
- K s steady-state rate constant
- kserumTissue, krissueSerum rate constant for inter-compartmental transfer between central
- Input intravenous infusion rate
- V central distribution volume of MEDI-546.
- Equation 6 Change of free drug concentrations in central and peripheral compartments over time was expressed by Equations 6 and 7. Equation 8 expressed the change of total receptor concentration over time in terms of free drug and R to t.
- rate constants j e g and ki nt were assumed the same and fixed to a value experimentally determined by confocal imaging studies.
- MEDI-546 The partitioning of MEDI-546 from the central compartment to skin was characterized by a skin-to-blood rate constant (k s b) of 0.27 d "1 , which corresponds to the estimated absorption rate of CAT-354, a monoclonal antibody against IL-13, in healthy volunteers (Oh et al, Br. J. Clin. Pharmacol. 69:645-655 (2010)), and a distribution rate constant (blood to skin, kb s ) of 0.2543 ⁇ 4,.
- the kb s rate constant was scaled to reflect a 0.25 skin:serum MEDI-546 concentration ratio at equilibrium. In this model, no mass loss in the central compartment was assumed due to MEDI-546 partitioning to the skin.
- MEDI-546 blocked the interaction of interferons with IFNAR1 and inhibited the production of type I IFN genes (ki n ) according to the formula: dGS , ,. ( x / max * C t
- GS Type I IFN gene signature score
- IC5 0 Potency, MEDI-546 concentration corresponding to half-maximum inhibition of GS production
- IFN genes were locally produced and suppressed by MEDI-546 in a similar manner.
- the production rate of skin IFN gene signature (kin, s ki n ) was adjusted to reflect a baseline value lower than or equal to the type I IFN GS in whole blood.
- NONMEM (Version 7.1, ICON Development Solutions, Elliott City, Maryland).
- the model development was based on the NONMEM objective function value (-2 times the log of the likelihood) and the randomness of weighted residuals.
- the first-order conditional estimation with interaction (FOCEI) method was used for model development.
- the total dose that each subject received was calculated according to the weight-based dosage (mg/kg) and recorded body weight of that subject.
- Interindividual variability was modeled as a multiplicative random effect: ⁇ ' ⁇ ( ⁇ ), where ⁇ represented a typical value of a structural parameter and ⁇ was an individual-specific normally distributed random effect.
- the residual variability was modeled as:
- Model stability and performance were assessed by a visual predictive check procedure (Holford, in 14th meeting of the Population Approach Group in Europe. (Pamplona, Spain, 2005)) and bootstrap resampling technique (Ette, J. Clin. Pharmacol. 37:486-495 (1997)) using the PsN-Toolkit (Lindbom et al, Comput Methods Programs Biomed. 79:241-257 (2005)).
- VPC the final fixed- and random-effect model parameters, along with original dataset as the simulation template, were used to generate the 90% intervals of 1,000 simulated profiles. Median, 5th, 10th, 90th, and 95th percentiles of the simulated concentrations at each time point were calculated and plotted.
- IFN GS and target modulation profiles in SLE patients upon multiple MEDI-546 administrations were added to the PK- PD model. It was assumed that PK of MEDI-546 in patients with SLE was the same as in SSc patients. The production rate (kin) of IFN-related GS score was increased for SLE patients to reflect a higher baseline value than in SSc patients. Stochastic simulations were performed using resampled actual observed baseline GS scores and body weight of patients with SLE enrolled in a prior clinical study for an anti-IFNa mAb (Higgs et al, Ann. Rheum. Dis. 70:2029-2036 (201 1); Yao et al, Arthritis Rheum.
- a composite PD biomarker was developed using a five gene type I IFN GS shared by SLE and SSc, both in blood and in disease tissue (skin).
- the five gene type I IFN GS is a reliable surrogate of type I IFN activity in the blood as well as a correlate with baseline disease activity in SLE and SSc.
- There is also a strong concordance in this GS score between blood and skin specimens from SLE or SSc patients Higgs et al, Ann. Rheum. Dis. 70:2029- 2036 (201 1), allowing the use of this type I IFN signature in blood as a PD biomarker to measure pharmacological effect of MEDI-546.
- the five type I IFN-inducible genes (IFI27, IFI44, IFI44L, RSAD2, and IFI6) used to measure the PD of MEDI-546 are a subset of the 21 genes used as PD markers for sifalimumab, an anti-IFN-a mAb therapy in SLE described previously (Yao et al, Arthritis Rheum. 60: 1785-1796 (2009); Yao et al, Hum. Genomics Proteomics 2009:374312 (2009); Yao et al, Arthritis Res. Ther. 12 (Suppl 1):S6 (2010)).
- IFI6 interferon, alpha inducible protein 6
- RSAD2 radical S-adenosyl methionine domain containing 2
- IFI44 interferon-induced protein 44
- IFI44L interferon induced protein 44, like
- IFI27 interferon alpha inducible protein 27
- MX1 myxovirus (influenza virus) resistance 1, interferon-inducible protein p78
- IFIT1 interferon-induced protein with tetratricopeptide repeats 1
- HERC5 hect domain and RLD 5
- ISG15 ISG15 ubiquitin-like modifier
- LAMP3 lysosomal-associated membrane protein 3
- OAS3 (2'-5'-oligoadenylate synthetase 3, lOOkDa
- OAS1 (2'-5'-oligoadenylate synthetase 1, 40/60kDa
- EPST1 epidermal stromal interaction 1
- the 21 type I IFN gene signature (GS) was shown to be neutralized in a dose-dependent manner following treatment with sifalimumab in mild-to-moderate SLE patients in a Phase la clinical trial (Yao et al, Arthritis Rheum. 60: 1785-1796 (2009); Merrill et al, Ann. Rheum. Dis. 70: 1905-1913 (2011)). There was a strong correlation between the five and 21 gene type I IFN gene signatures in SLE (Higgs et al, Ann. Rheum. Dis. 70:2029-2036 (201 1)).
- Type I IFN GS status as determined by type I IFN GS score for SSc patients enrolled in the FTIH study (MI-CP 180) before they received MEDI-546 treatment (GSo; baseline; pretreatment).
- the cutoffs for type I IFN GS positivity in blood and skin of SSc patients were GSo>2.9 and GSo>1.8, respectively.
- These type I IFN GS thresholds represented the upper boundary of mean ⁇ 2 standard deviations of the distribution of the type I IFN GS in the blood and skin of 54 and 30 healthy donors (1.2 ⁇ 1.7 in blood, 1.0 ⁇ 0.8 in skin; FIG. 1).
- the median observed type I IFN GS score for each single- or multiple-dose cohort was calculated and plotted across time for all SSc patients that were positive for type I IFN GS score at baseline in both blood and skin (FIG. 2).
- Those dose cohorts with type I IFN GS modulated to or below values of mean for blood and skin in healthy donors respectively during the study period achieved complete suppression of the type I IFN GS.
- a dose-dependent target modulation (see Methods, supra) of the type I IFN GS with MEDI-546 (i.e., PD effect) in SSc patients was observed in both whole blood and skin.
- MEDI-546-associated fluorescence was predominantly localized on the cell surface (FIG. 3A)
- MEDI-546-Alexa647 signals were seen in punctuated spots located in the cytoplasm (FIG. 3B).
- Kinetic images recorded over the time course were analyzed using a quantitative algorithm.
- a time course of MEDI-546-Alexa647 internalization into cytoplasm was constructed from the data obtained from four independent experiments (FIG. 3C). The internalization half-life was estimated to be 12.9 ⁇ 1.2 (standard deviations) minutes.
- a mechanistic PK-PD model for MEDI-546 was generated (see FIG. 4).
- MEDI-546 (Ab) bound to IFNARl (R) and the antibody-receptor complex was subsequently internalized and degraded (k int ) inside the cells.
- the PD of MEDI-546 (type I IFN GS score) was best described by an indirect response model, in which the type I IFN-inducible gene production (kin) was inhibited by MEDI-546.
- CLRES MEDI-546 clearance corresponding to the first-order elimination pathway
- V c central distribution volume
- Q inter-compartmental clearance corresponding to the transfer of mdressimumab between central serum compartment and peripheral tissue compartment
- V p peripheral distribution volume
- K ss steady-state constant, apparent equilibrium dissociation constant
- Ro baseline IFNAR1 level
- kjn t internalization rate constant
- I max maximum fractional extent of inhibition
- IC 50 Potency, MEDI-546 concentration corresponding to half-maximum inhibition of GS production
- GSo baseline type I IFN GS
- k G s GS elimination (degradation) rate constant
- GSFLOOR theoretical lower limit of GS measurement.
- the central distribution volume (V c , 3.46 L) was slightly greater than the serum volume in humans, while the smaller peripheral distribution volume (V p , 2.52 L) suggested restricted extravascular distribution of MEDI-546, as expected for a monoclonal antibody.
- the internalization rate of the MEDI-546/IFNAR1 complex (ki nt ) was fixed to a value determined from in vitro confocal imaging experiments.
- the elimination constant of type I IFN GS score (k out ) was 1.92 d " 1 , corresponding to a half-life of 8.7 hours for IFNAR-associated mRNAs in whole blood.
- the floor parameter fcs (0.764) represented the theoretical analytical lower boundary of the PD assay.
- FIG. 5 The PK and PD profiles from four representative patients (two from the single- dose cohorts and two from the multiple-dose cohorts) are presented in FIG. 5.
- the solid circles represent PK or type I IFN GS scores observed in peripheral blood, while the solid lines represent the population (gray line) and individual (black line) model predictions, respectively. All the observed and model-predicted individual PK and PD profiles are shown in FIGS. 9A, 9B, 10A and 10B.
- Target modulation was calculated from model-predicted type I IFN GS scores, and compared with the observed values (FIGS. 11A and 1 1B). Doses greater than or equal to 1.0 mg/kg achieved complete target modulation in SSc patients. The duration of target modulation response was dose-dependent: higher doses prolonged the duration of complete target modulation.
- the PK-PD model was subsequently used to simulate the PK and PD profiles of MEDI-546 in SLE.
- the observed upper boundary (mean + 2 standard deviations) of type I IFN GS was 1.8 in skin.
- the antigen of MEDI-546 is a cell-membrane associated receptor (IFNAR1), which is widely expressed on most nucleated cells.
- MEDI-546 dosing was switched from weight-based (mg/kg) to fixed-dose (mg) based on translational simulations. Although from stochastic simulations a 300 mg monthly fixed-dose could maintain the suppression of peripheral-blood GS to the normal level ( ⁇ 2.9) in a typical SLE subject (FIG. 6A, median), a higher dose (1000 mg) was also recommended for the PoC trial to ensure adequate drug exposure and GS suppression in skin especially for SLE patients with substantially elevated type I IFN GS at baseline.
- the virtual SLE patients were generated by repetitive sampling from recorded type I IFN GS at baseline and body weight of SLE patients previously enrolled in a study for sifalimumab, an anti-IFNa mAb.
- the median baseline whole blood GS score was 37 in SLE patients (GSo range: 3 to 86; FIG. 1).
- the median body weight of SLE patients was 74 kg, with a range of 39.4 to 141 kg.
- FIGS. 6A and 6B show the median (solid line), lower and upper quartiles (dotted lines) of simulated type I IFN GS responses in these patients.
- the whole-blood type I IFN GS scores in SLE patients could be neutralized to the range of 1 to 5 (median 2 to 3) with monthly MEDI-546 dosing. This represented approximately 94% suppression of the type I IFN signature from the baseline level at steady-state of MEDI-546 treatment.
- the higher dose (1,000 mg) would allow for increased MEDI-546 tissue exposure, resulting in more substantial type I IFN GS suppression in skin tissues than the lower dose (300 mg).
- the simulated type I IFN GS responses in both whole blood and skin tissues fluctuated with the 300 mg monthly dose administration, while remaining relatively flat for the 1000 mg dose during the treatment period.
- Translational simulations are used to identify effective dosages and to design dosage regimens to treat SLE, myositis or lupus nephritis patients based on SSc clinical data.
- Type I IFN GS signatures are identified that are common to SSc and SLE, SSc and myositis, or SSc and lupus nephritis.
- PK/PD models based on SSc data are generated as described above and adjusted based on PK/PD data corresponding to SLE, myositis, or lupus nephritis.
- Stochastic simulations on virtual patients are conducted on the adjusted SSc/SLE, SSc/myositis, or SSc/lupus nephritis PK/PD models.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Life Sciences & Earth Sciences (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Public Health (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Physics & Mathematics (AREA)
- Biomedical Technology (AREA)
- Medical Informatics (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Epidemiology (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Pathology (AREA)
- Data Mining & Analysis (AREA)
- Microbiology (AREA)
- Analytical Chemistry (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- General Engineering & Computer Science (AREA)
- General Physics & Mathematics (AREA)
- Theoretical Computer Science (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Databases & Information Systems (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Primary Health Care (AREA)
- Mycology (AREA)
- Biotechnology (AREA)
- Mathematical Physics (AREA)
- Computing Systems (AREA)
Priority Applications (12)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP13803921.9A EP2861621A4 (en) | 2012-06-13 | 2013-06-12 | SOLID DOSAGE SCHEDULES FOR ANTI-TYPE-1 INTERFERON RECEPTOR (IFNAR) ANTIBODY |
| KR1020147037151A KR102185237B1 (ko) | 2012-06-13 | 2013-06-12 | 항-i형 인터페론 수용체(ifnar) 항체에 대한 고정 투여 계획 |
| CA2876636A CA2876636C (en) | 2012-06-13 | 2013-06-12 | Fixed dosage regimens for anti-type i interferon receptor (ifnar) antibodies |
| KR1020207033413A KR102320059B1 (ko) | 2012-06-13 | 2013-06-12 | 항-i형 인터페론 수용체(ifnar) 항체에 대한 고정 투여 계획 |
| US14/407,156 US9493570B2 (en) | 2012-06-13 | 2013-06-12 | Fixed dosage regimens for anti-type I interferon receptor (IFNAR) antibodies |
| CN201380043349.7A CN104603152A (zh) | 2012-06-13 | 2013-06-12 | 针对抗i型干扰素受体(ifnar)抗体的固定剂量方案 |
| JP2015517382A JP2015526391A (ja) | 2012-06-13 | 2013-06-12 | 抗i型インターフェロン受容体(ifnar)抗体のための固定用量レジメン |
| AU2013274389A AU2013274389A1 (en) | 2012-06-13 | 2013-06-12 | Fixed dosage regimens for anti-type I interferon receptor (IFNAR) antibodies |
| KR1020217034200A KR20210130270A (ko) | 2012-06-13 | 2013-06-12 | 항-i형 인터페론 수용체(ifnar) 항체에 대한 고정 투여 계획 |
| HK15110286.5A HK1209758A1 (en) | 2012-06-13 | 2013-06-12 | Fixed dosage regimens for anti-type i interferon receptor (ifnar) antibodies |
| AU2018206851A AU2018206851C1 (en) | 2012-06-13 | 2018-07-23 | Fixed dosage regimens for anti-type i interferon receptor (ifnar) antibodies |
| AU2020204613A AU2020204613B2 (en) | 2012-06-13 | 2020-07-10 | Fixed dosage regimens for anti-type i interferon receptor (ifnar) antibodies |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201261659138P | 2012-06-13 | 2012-06-13 | |
| US61/659,138 | 2012-06-13 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2013188494A1 true WO2013188494A1 (en) | 2013-12-19 |
Family
ID=49758685
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2013/045327 Ceased WO2013188494A1 (en) | 2012-06-13 | 2013-06-12 | Fixed dosage regimens for anti-type i interferon receptor (ifnar) antibodies |
Country Status (9)
| Country | Link |
|---|---|
| US (1) | US9493570B2 (enExample) |
| EP (1) | EP2861621A4 (enExample) |
| JP (5) | JP2015526391A (enExample) |
| KR (3) | KR102185237B1 (enExample) |
| CN (3) | CN111494624A (enExample) |
| AU (3) | AU2013274389A1 (enExample) |
| CA (1) | CA2876636C (enExample) |
| HK (1) | HK1209758A1 (enExample) |
| WO (1) | WO2013188494A1 (enExample) |
Cited By (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2017060912A1 (en) | 2015-10-09 | 2017-04-13 | Genefron Ltd. | METHODS AND KITS FOR PREDICTION AND DIAGNOSIS OF HUMAN CYTOMEGALOVIRUS CONGENITAL (hCMV) TRANSMISSION |
| WO2018172957A1 (en) | 2017-03-21 | 2018-09-27 | Austrianni Gmbh | Type 1 interferon receptor antagonists for use in methods of treating tuberculosis and other infectious diseases |
| EP3873523A4 (en) * | 2018-10-26 | 2022-08-10 | Janssen Biotech, Inc. | TYPE I INTERFERON SIGNATURES AND METHODS OF USE |
| WO2022223714A1 (en) | 2021-04-23 | 2022-10-27 | Astrazeneca Ab | Anti-ifnar1 dosing regime for subcutaneous injection |
| WO2022223771A1 (en) | 2021-04-23 | 2022-10-27 | Astrazeneca Ab | Treatment of lupus nephritis with anti-type i inf receptor antibody anifrolumab |
| WO2025022280A1 (en) | 2023-07-21 | 2025-01-30 | Astrazeneca Ab | Treatment of neurodegenerative diseases |
| WO2025181717A1 (en) * | 2024-02-28 | 2025-09-04 | Astrazeneca Ab | Treatment of chronic kidney disease |
Families Citing this family (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP5160887B2 (ja) * | 2004-06-21 | 2013-03-13 | メダレックス インコーポレイテッド | インターフェロンアルファレセプター1抗体及びその使用法 |
| KR100680048B1 (ko) * | 2006-01-23 | 2007-02-08 | 쌍용자동차 주식회사 | 자동차 도장용 크레인의 구조 |
| DK3478830T3 (da) | 2016-07-01 | 2024-05-21 | Resolve Therapeutics Llc | Optimerede binucleasefusioner og metoder |
| CN106243226B (zh) * | 2016-08-05 | 2019-02-12 | 北京智仁美博生物科技有限公司 | 抗人ifnar1的抗体及其用途 |
| MX2020002070A (es) | 2017-08-22 | 2020-03-24 | Sanabio Llc | Receptores solubles de interferon y usos de los mismos. |
| US11139051B2 (en) * | 2018-10-02 | 2021-10-05 | Origent Data Sciences, Inc. | Systems and methods for designing clinical trials |
| CN113728006B (zh) * | 2019-01-31 | 2022-10-14 | 广东旋玉健康生物科技有限公司 | 新型抗ifnar1抗体 |
| CN111892653A (zh) * | 2019-07-03 | 2020-11-06 | 长春恒晓生物科技有限责任公司 | 制备粘病毒抗性蛋白1抗体及建立检测mx1方法 |
Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20080113011A1 (en) * | 2002-06-28 | 2008-05-15 | Nastech Pharmaceutical Company Inc. | Compositions and methods for enhanced mucosal delivery of interferon beta |
| US20110008365A1 (en) * | 2007-11-05 | 2011-01-13 | Anthony Coyle | Methods of treating scleroderma |
| WO2011028933A1 (en) * | 2009-09-03 | 2011-03-10 | Medimmune, Llc | Type 1 interferon diagnostic |
| US20110083866A1 (en) * | 2005-06-03 | 2011-04-14 | John Arthur Notaras | Tiller |
| US20110159513A1 (en) * | 2008-08-15 | 2011-06-30 | Merrimack Pharmaceuticals, Inc. | Methods and systems for predicting response of cells to a therapeutic agent |
| US20110250168A1 (en) * | 2006-05-11 | 2011-10-13 | Universiteit Gent | Sialoadhesin-related compositions and methods |
| US20110287022A1 (en) * | 2008-06-20 | 2011-11-24 | Medlmmune, Llc | Interferon alpha-induced pharmacodynamic markers |
Family Cites Families (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AU2002250236A1 (en) * | 2001-03-02 | 2002-09-19 | Medimmune, Inc. | Cd2 antagonists for treatment of autoimmune or inflammatory disease |
| JP5160887B2 (ja) * | 2004-06-21 | 2013-03-13 | メダレックス インコーポレイテッド | インターフェロンアルファレセプター1抗体及びその使用法 |
| WO2006138275A2 (en) | 2005-06-13 | 2006-12-28 | The Regents Of The University Of Michigan | Compositions and methods for treating and diagnosing cancer |
| CN101594882A (zh) * | 2006-12-06 | 2009-12-02 | 米迪缪尼有限公司 | 干扰素α诱导的药代动力学标记物 |
| RU2527068C2 (ru) * | 2006-12-06 | 2014-08-27 | Медиммун, Ллк | Фармакодинамические маркеры, индуцированные интерфероном альфа |
| PL2250279T3 (pl) * | 2008-02-08 | 2016-11-30 | Przeciwciała anty-ifnar1 o zmniejszonym powinowactwie do liganda fc |
-
2013
- 2013-06-12 JP JP2015517382A patent/JP2015526391A/ja active Pending
- 2013-06-12 KR KR1020147037151A patent/KR102185237B1/ko active Active
- 2013-06-12 CN CN202010333445.7A patent/CN111494624A/zh active Pending
- 2013-06-12 KR KR1020207033413A patent/KR102320059B1/ko active Active
- 2013-06-12 CA CA2876636A patent/CA2876636C/en active Active
- 2013-06-12 WO PCT/US2013/045327 patent/WO2013188494A1/en not_active Ceased
- 2013-06-12 HK HK15110286.5A patent/HK1209758A1/xx unknown
- 2013-06-12 AU AU2013274389A patent/AU2013274389A1/en not_active Abandoned
- 2013-06-12 CN CN201810164604.8A patent/CN108310375A/zh active Pending
- 2013-06-12 CN CN201380043349.7A patent/CN104603152A/zh active Pending
- 2013-06-12 KR KR1020217034200A patent/KR20210130270A/ko not_active Ceased
- 2013-06-12 US US14/407,156 patent/US9493570B2/en active Active
- 2013-06-12 EP EP13803921.9A patent/EP2861621A4/en not_active Withdrawn
-
2017
- 2017-12-01 JP JP2017231307A patent/JP2018065845A/ja active Pending
-
2018
- 2018-07-23 AU AU2018206851A patent/AU2018206851C1/en active Active
-
2019
- 2019-02-27 JP JP2019033979A patent/JP6814238B2/ja active Active
-
2020
- 2020-07-10 AU AU2020204613A patent/AU2020204613B2/en active Active
- 2020-10-16 JP JP2020174325A patent/JP2021042208A/ja not_active Ceased
-
2021
- 2021-07-07 JP JP2021112707A patent/JP7123225B2/ja active Active
Patent Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20080113011A1 (en) * | 2002-06-28 | 2008-05-15 | Nastech Pharmaceutical Company Inc. | Compositions and methods for enhanced mucosal delivery of interferon beta |
| US20110083866A1 (en) * | 2005-06-03 | 2011-04-14 | John Arthur Notaras | Tiller |
| US20110250168A1 (en) * | 2006-05-11 | 2011-10-13 | Universiteit Gent | Sialoadhesin-related compositions and methods |
| US20110008365A1 (en) * | 2007-11-05 | 2011-01-13 | Anthony Coyle | Methods of treating scleroderma |
| US20110287022A1 (en) * | 2008-06-20 | 2011-11-24 | Medlmmune, Llc | Interferon alpha-induced pharmacodynamic markers |
| US20110159513A1 (en) * | 2008-08-15 | 2011-06-30 | Merrimack Pharmaceuticals, Inc. | Methods and systems for predicting response of cells to a therapeutic agent |
| WO2011028933A1 (en) * | 2009-09-03 | 2011-03-10 | Medimmune, Llc | Type 1 interferon diagnostic |
Non-Patent Citations (1)
| Title |
|---|
| See also references of EP2861621A4 * |
Cited By (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2017060912A1 (en) | 2015-10-09 | 2017-04-13 | Genefron Ltd. | METHODS AND KITS FOR PREDICTION AND DIAGNOSIS OF HUMAN CYTOMEGALOVIRUS CONGENITAL (hCMV) TRANSMISSION |
| WO2018172957A1 (en) | 2017-03-21 | 2018-09-27 | Austrianni Gmbh | Type 1 interferon receptor antagonists for use in methods of treating tuberculosis and other infectious diseases |
| EP3873523A4 (en) * | 2018-10-26 | 2022-08-10 | Janssen Biotech, Inc. | TYPE I INTERFERON SIGNATURES AND METHODS OF USE |
| US12009079B2 (en) | 2018-10-26 | 2024-06-11 | Janssen Biotech, Inc. | Type I interferon signatures and methods of use |
| WO2022223714A1 (en) | 2021-04-23 | 2022-10-27 | Astrazeneca Ab | Anti-ifnar1 dosing regime for subcutaneous injection |
| WO2022223771A1 (en) | 2021-04-23 | 2022-10-27 | Astrazeneca Ab | Treatment of lupus nephritis with anti-type i inf receptor antibody anifrolumab |
| EP4306541A2 (en) | 2021-04-23 | 2024-01-17 | Astrazeneca AB | Anti-ifnar1 dosing regime for subcutaneous injection |
| EP4595996A2 (en) | 2021-04-23 | 2025-08-06 | Astrazeneca AB | Treatment of lupus nephritis |
| EP4595996A3 (en) * | 2021-04-23 | 2025-12-03 | Astrazeneca AB | Treatment of lupus nephritis |
| WO2025022280A1 (en) | 2023-07-21 | 2025-01-30 | Astrazeneca Ab | Treatment of neurodegenerative diseases |
| WO2025181717A1 (en) * | 2024-02-28 | 2025-09-04 | Astrazeneca Ab | Treatment of chronic kidney disease |
Also Published As
| Publication number | Publication date |
|---|---|
| CN111494624A (zh) | 2020-08-07 |
| AU2013274389A1 (en) | 2015-01-22 |
| US9493570B2 (en) | 2016-11-15 |
| CA2876636A1 (en) | 2013-12-19 |
| JP2018065845A (ja) | 2018-04-26 |
| AU2018206851A1 (en) | 2018-08-09 |
| CA2876636C (en) | 2022-09-13 |
| AU2018206851B2 (en) | 2020-07-30 |
| AU2018206851C1 (en) | 2021-11-25 |
| KR102185237B9 (ko) | 2021-08-06 |
| EP2861621A1 (en) | 2015-04-22 |
| JP2015526391A (ja) | 2015-09-10 |
| JP2021167336A (ja) | 2021-10-21 |
| KR102185237B1 (ko) | 2020-12-02 |
| KR20200133395A (ko) | 2020-11-27 |
| CN104603152A (zh) | 2015-05-06 |
| HK1209758A1 (en) | 2016-04-08 |
| JP2019112429A (ja) | 2019-07-11 |
| JP6814238B2 (ja) | 2021-01-13 |
| US20150158949A1 (en) | 2015-06-11 |
| CN108310375A (zh) | 2018-07-24 |
| KR20210130270A (ko) | 2021-10-29 |
| JP7123225B2 (ja) | 2022-08-22 |
| JP2021042208A (ja) | 2021-03-18 |
| AU2020204613A1 (en) | 2020-07-30 |
| AU2020204613B2 (en) | 2021-10-07 |
| KR102320059B1 (ko) | 2021-11-01 |
| KR20150035825A (ko) | 2015-04-07 |
| EP2861621A4 (en) | 2016-01-20 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| AU2020204613B2 (en) | Fixed dosage regimens for anti-type i interferon receptor (ifnar) antibodies | |
| JP2021170017A (ja) | Il23経路バイオマーカーを使用するil23アンタゴニストに対する臨床応答の予測 | |
| CN104011223A (zh) | 使用il-17拮抗剂及psa应答或非应答等位基因治疗银屑病性关节炎(psa)的方法 | |
| MX2013005532A (es) | Anticuerpos anti-ligando de quimiocina cc 20 (ccl20) neutralizantes. | |
| EP3359688B1 (en) | Molecular signatures for use in diagnosis and response to treatment analysis of autoimmune diseases | |
| CA2836926A1 (en) | Methods of treating systemic lupus erythematosus, scleroderma, and myositis with an antibody against interferon-alpha | |
| KR20180096633A (ko) | Il23-길항제에 대한 임상적 반응의 예측인자로서의 ccl20 | |
| JP2025520063A (ja) | ヒトccr8に結合する抗体 | |
| TWI826839B (zh) | CD1a抗體及其用途 | |
| HK40034632A (en) | Fixed dosage regimens for anti-type i interferon receptor (ifnar) antibodies | |
| WO2020181080A1 (en) | Biomarkers for treatment of cancer | |
| AU2012258819A1 (en) | Methods of treating systemic lupus erythematosus, scleroderma, and myositis with an antibody against interferon-alpha |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 13803921 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2015517382 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 14407156 Country of ref document: US |
|
| ENP | Entry into the national phase |
Ref document number: 2876636 Country of ref document: CA |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 20147037151 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2013274389 Country of ref document: AU Date of ref document: 20130612 Kind code of ref document: A |