WO2013135394A1 - Vorrichtung zum bestimmen der temperatur eines substrats - Google Patents

Vorrichtung zum bestimmen der temperatur eines substrats Download PDF

Info

Publication number
WO2013135394A1
WO2013135394A1 PCT/EP2013/000807 EP2013000807W WO2013135394A1 WO 2013135394 A1 WO2013135394 A1 WO 2013135394A1 EP 2013000807 W EP2013000807 W EP 2013000807W WO 2013135394 A1 WO2013135394 A1 WO 2013135394A1
Authority
WO
WIPO (PCT)
Prior art keywords
radiation
substrate
temperature
radiation source
pyrometer
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2013/000807
Other languages
German (de)
English (en)
French (fr)
Inventor
Hartmut RICK
Wilfried Lerch
Jürgen NIESS
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Centrotherm Thermal Solutions GmbH and Co KG
HQ Dielectrics GmbH
Original Assignee
Centrotherm Thermal Solutions GmbH and Co KG
HQ Dielectrics GmbH
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Centrotherm Thermal Solutions GmbH and Co KG, HQ Dielectrics GmbH filed Critical Centrotherm Thermal Solutions GmbH and Co KG
Priority to US14/384,223 priority Critical patent/US9805993B2/en
Priority to JP2014561330A priority patent/JP6114762B2/ja
Priority to KR1020147029081A priority patent/KR102045393B1/ko
Priority to EP13716726.8A priority patent/EP2825859B1/de
Publication of WO2013135394A1 publication Critical patent/WO2013135394A1/de
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • HELECTRICITY
    • H10SEMICONDUCTOR DEVICES; ELECTRIC SOLID-STATE DEVICES NOT OTHERWISE PROVIDED FOR
    • H10PGENERIC PROCESSES OR APPARATUS FOR THE MANUFACTURE OR TREATMENT OF DEVICES COVERED BY CLASS H10
    • H10P74/00Testing or measuring during manufacture or treatment of wafers, substrates or devices
    • H10P74/20Testing or measuring during manufacture or treatment of wafers, substrates or devices characterised by the properties tested or measured, e.g. structural or electrical properties
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01JMEASUREMENT OF INTENSITY, VELOCITY, SPECTRAL CONTENT, POLARISATION, PHASE OR PULSE CHARACTERISTICS OF INFRARED, VISIBLE OR ULTRAVIOLET LIGHT; COLORIMETRY; RADIATION PYROMETRY
    • G01J5/00Radiation pyrometry, e.g. infrared or optical thermometry
    • G01J5/0003Radiation pyrometry, e.g. infrared or optical thermometry for sensing the radiant heat transfer of samples, e.g. emittance meter
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01JMEASUREMENT OF INTENSITY, VELOCITY, SPECTRAL CONTENT, POLARISATION, PHASE OR PULSE CHARACTERISTICS OF INFRARED, VISIBLE OR ULTRAVIOLET LIGHT; COLORIMETRY; RADIATION PYROMETRY
    • G01J5/00Radiation pyrometry, e.g. infrared or optical thermometry
    • G01J5/0003Radiation pyrometry, e.g. infrared or optical thermometry for sensing the radiant heat transfer of samples, e.g. emittance meter
    • G01J5/0007Radiation pyrometry, e.g. infrared or optical thermometry for sensing the radiant heat transfer of samples, e.g. emittance meter of wafers or semiconductor substrates, e.g. using Rapid Thermal Processing
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01JMEASUREMENT OF INTENSITY, VELOCITY, SPECTRAL CONTENT, POLARISATION, PHASE OR PULSE CHARACTERISTICS OF INFRARED, VISIBLE OR ULTRAVIOLET LIGHT; COLORIMETRY; RADIATION PYROMETRY
    • G01J5/00Radiation pyrometry, e.g. infrared or optical thermometry
    • G01J5/02Constructional details
    • G01J5/0275Control or determination of height or distance or angle information for sensors or receivers
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01JMEASUREMENT OF INTENSITY, VELOCITY, SPECTRAL CONTENT, POLARISATION, PHASE OR PULSE CHARACTERISTICS OF INFRARED, VISIBLE OR ULTRAVIOLET LIGHT; COLORIMETRY; RADIATION PYROMETRY
    • G01J5/00Radiation pyrometry, e.g. infrared or optical thermometry
    • G01J5/02Constructional details
    • G01J5/07Arrangements for adjusting the solid angle of collected radiation, e.g. adjusting or orienting field of view, tracking position or encoding angular position
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01JMEASUREMENT OF INTENSITY, VELOCITY, SPECTRAL CONTENT, POLARISATION, PHASE OR PULSE CHARACTERISTICS OF INFRARED, VISIBLE OR ULTRAVIOLET LIGHT; COLORIMETRY; RADIATION PYROMETRY
    • G01J5/00Radiation pyrometry, e.g. infrared or optical thermometry
    • G01J5/02Constructional details
    • G01J5/08Optical arrangements
    • G01J5/0801Means for wavelength selection or discrimination
    • G01J5/0802Optical filters
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01JMEASUREMENT OF INTENSITY, VELOCITY, SPECTRAL CONTENT, POLARISATION, PHASE OR PULSE CHARACTERISTICS OF INFRARED, VISIBLE OR ULTRAVIOLET LIGHT; COLORIMETRY; RADIATION PYROMETRY
    • G01J5/00Radiation pyrometry, e.g. infrared or optical thermometry
    • G01J5/10Radiation pyrometry, e.g. infrared or optical thermometry using electric radiation detectors
    • HELECTRICITY
    • H10SEMICONDUCTOR DEVICES; ELECTRIC SOLID-STATE DEVICES NOT OTHERWISE PROVIDED FOR
    • H10PGENERIC PROCESSES OR APPARATUS FOR THE MANUFACTURE OR TREATMENT OF DEVICES COVERED BY CLASS H10
    • H10P72/00Handling or holding of wafers, substrates or devices during manufacture or treatment thereof
    • H10P72/04Apparatus for manufacture or treatment
    • H10P72/0431Apparatus for thermal treatment
    • H10P72/0436Apparatus for thermal treatment mainly by radiation
    • HELECTRICITY
    • H10SEMICONDUCTOR DEVICES; ELECTRIC SOLID-STATE DEVICES NOT OTHERWISE PROVIDED FOR
    • H10PGENERIC PROCESSES OR APPARATUS FOR THE MANUFACTURE OR TREATMENT OF DEVICES COVERED BY CLASS H10
    • H10P72/00Handling or holding of wafers, substrates or devices during manufacture or treatment thereof
    • H10P72/06Apparatus for monitoring, sorting, marking, testing or measuring
    • H10P72/0602Temperature monitoring
    • HELECTRICITY
    • H10SEMICONDUCTOR DEVICES; ELECTRIC SOLID-STATE DEVICES NOT OTHERWISE PROVIDED FOR
    • H10PGENERIC PROCESSES OR APPARATUS FOR THE MANUFACTURE OR TREATMENT OF DEVICES COVERED BY CLASS H10
    • H10P95/00Generic processes or apparatus for manufacture or treatments not covered by the other groups of this subclass
    • H10P95/90Thermal treatments, e.g. annealing or sintering

Definitions

  • the present invention relates to a device for determining the temperature of a substrate, in particular of a semiconductor substrate, and to an apparatus and a method for the thermal treatment of substrates, in particular semiconductor substrates.
  • one known method for thermally treating semiconductor wafers provides for heating by means of electromagnetic radiation emanating from lamps, for example tungsten halogen lamps.
  • lamps for example tungsten halogen lamps.
  • the radiation meter generally not only detects radiation emitted by the semiconductor wafer but also radiation reflected on the semiconductor wafer and, if appropriate, radiation passing through the semiconductor wafer, it is necessary to distinguish between these radiation components for temperature determination.
  • the invention is therefore based on the object to provide an apparatus and a method for the thermal treatment of substrates, which or regardless of the emissivity of the substrate allows a radiation-based temperature determination.
  • this object is achieved by a device for determining the temperature of substrates according to claim 1 and a method for the thermal treatment of substrates according to claim 10. Further embodiments of the invention will become apparent from the respective dependent claims and the description.
  • the use of two radiation detectors enables a direct determination of the temperature of the substrate on the basis of the detected radiation and without knowledge of the emissivity of the substrate.
  • the first and second radiation detectors may be formed by a single detector which is alternately supplied with radiation from the substrate having a first portion of radiation reflected from the substrate and radiation originating from the substrate with a second portion of radiation reflected from the substrate can go to zero.
  • At least one third radiation detector is provided which is directed to at least one first radiation source in order to determine the radiation intensity of the first radiation source.
  • the first and second surface areas lie substantially on a common turning circle to a center of the substrate.
  • the term substantially comprises that the areas overlap at least in the region of the common turning circle, even if they are not centered with respect to the turning circle. This is to ensure that the surface areas have substantially the same temperature. This can also be achieved by virtue of the fact that the first and second surface regions lie directly adjacent to one another or overlap at least partially.
  • the device has at least one optical element which influences the proportion of the radiation of the at least one radiation source reflected on the substrate, wherein the at least one optical element can be, for example, a diaphragm and / or a filter.
  • At least one optical element can be assigned to each radiation detector, wherein the optical elements form different aperture angles for a field of view of the radiation detector and / or are positioned at different distances from the substrate, by the proportion of the radiation of the at least one radiation source reflected at the substrate at the respective radiation detector to influence.
  • the device may comprise at least one filter which is arranged between at least one radiation source of a plurality of first radiation sources and the substrate in order to filter out of the radiation of the at least one radiation source the radiation which is in the region of
  • Measuring wavelength of the radiation detector is before the radiation of the at least one radiation source falls on the substrate.
  • the at least one first radiation source is a lamp, in particular a flashlight.
  • the method according to the invention for the thermal treatment of substrates comprises heating the substrate with at least one first radiation emanating from at least one first radiation source, radiation of the first radiation source being directed to a first side of the substrate and at least partly reflected in it.
  • a first radiation coming from a first surface region of the first side of the substrate is detected, wherein the detected first radiation has at least a first substrate radiation component and a first reflection radiation component, wherein the first substrate radiation component originates from the substrate the temperature of the emitted radiation and the first reflection radiation component consists of radiation reflected by the substrate of the at least one first radiation source.
  • a second radiation coming from a second surface region of the first side of the substrate is detected, wherein the detected second radiation has at least a second substrate radiation component and a second reflection radiation component, wherein the second substrate radiation component consists of radiation emitted by the substrate due to the intrinsic temperature and the second reflection radiation portion consists of radiation of the at least one first radiation source reflected on the substrate, wherein the first and the second surface area are areas of substantially equal temperature of the substrate and wherein the first and second reflection radiation portions differ.
  • the temperature of the substrate is determined. This in turn is possible directly from the previously mentioned values without prior determination of substrate emissivity.
  • the first and second radiations are detected with different radiation detectors to enable a simultaneous detection. But they can also be detected alternately with the same radiation detector.
  • the substrate is rotated about an axis substantially perpendicular to the first side, and the first and second surface areas are substantially on a common turning circle to a center of the substrate.
  • the first and second surface regions lie directly adjacent to one another or overlap at least partially.
  • the first and / or second reflection radiation component is influenced by at least one optical element between the substrate and a radiation detector for detecting the detected radiation.
  • the radiation in the range of the measuring wavelength of the radiation detector which lies in the range of the measuring wavelength of the radiation detector before the radiation of the at least one radiation source falls onto the substrate is filtered out thereby affecting the detected reflection radiation component.
  • the radiation intensity coming from the at least one radiation source is detected, the result of this detection being used to determine the temperature of the substrate.
  • FIG. 1 shows a schematic side sectional view through an apparatus for the thermal treatment of semiconductor wafers.
  • FIG. 2 is a schematic plan view of a semiconductor wafer
  • Fig. 4 (a) is a graph showing the expected course of a pyrometer signal in response to the temperature radiation of the wafer
  • Fig. 4 (b) is a curve showing the expected course of a pyrometer signal in response to the driving power of heating lamps whose emitted radiation passes through a reflection on a wafer in the pyrometer;
  • Figures 5 (a) and 5 (b) show a graph showing the expected shape of a pyrometer signal versus temperature of a wafer, the pyrometer detecting both temperature radiation of the wafer and wafer-reflected radiation from heating lamps having constant lamp power be detected, wherein Fig. 5 (a) shows the expected Fig. 5 (b) shows the expected course of the pyrometer signal at a lamp power of 50%;
  • Fig. 6 is a graph showing expected operating temperatures of a pyrometer as a function of lamp power.
  • the device 1 shows a schematic side sectional view of a device 1 for the thermal treatment of semiconductor wafers W.
  • the device 1 has a housing 2 with an inner space which, inter alia, forms a process chamber 3.
  • the process chamber 3 is bounded on its top and bottom by wall elements 5 and 6 and laterally through the housing 2.
  • a lamp chamber 7 is provided in the housing 2, which can be mirrored and in which a heating source in the Form of several lamps 8 is provided.
  • a lamp chamber 9 similar to the chamber 7 is also provided, in which a heating source in the form of a plurality of lamps 10 is provided.
  • the side walls of the process chamber 3 can also have a certain mirror effect for at least part of the existing in the process chamber 3 have electromagnetic radiation. Further, at least one of the side walls of the process chamber 3 includes a process chamber door, not shown, to allow insertion and removal of the semiconductor wafer W. Furthermore, gas inlets and gas outlets, not shown, may be provided for the process chamber 3.
  • a substrate holder 12 is provided with supports 13, on which the semiconductor wafer W is stored.
  • the substrate holder 12 is connected to a rotating mechanism for rotating a picked-up semiconductor wafer W about an axis substantially perpendicular to the upper surface of the semiconductor wafer W.
  • a compensation of temperature differences on the semiconductor wafer is to be achieved.
  • a compensation ring radially surrounding the semiconductor wafer in its plane can be provided, as is known in the art in RTP systems.
  • the lamps 8 and 10 may be so-called flash lamps, which are usually operated in flash mode, or tungsten halogen lamps, which are usually operated in continuous operation.
  • these lamps can also be arranged differently and in particular it is also possible to combine the lamp types with each other or with other lamp types.
  • the apparatus 1 furthermore has a first pyrometer, which is directed onto the upper side of the semiconductor wafer W and is subsequently referred to as the first substrate pyrogen. 20, and a second pyrometer directed at the upper side of the semiconductor wafer W, which is referred to below as the second substrate pyrometer 21. Furthermore, a third pyrometer, which is directed to at least one of the lamps 8, is also referred to below as the lamp pyrometer 25.
  • a pyrometer directed onto the back side of the semiconductor wafer W ie a pyrometer, which is directed onto a side of the semiconductor wafer W opposite the lamps 8, can also be provided in order to be able to take into account a transmission of the semiconductor wafer W.
  • the first substrate pyrometer 20 and the second substrate pyrometer 21 are directed onto the upper surface of the semiconductor wafer W so as to be directed to surface regions 20a, 21a having the same temperature.
  • the first and second surface regions 20a, 21a may lie substantially on a common turning circle relative to a center point of the semiconductor wafer W.
  • the term should essentially comprise an at least partial overlapping of the surface regions 20a, 21a in the direction of rotation.
  • the surface regions 20a, 21a could also be arranged directly adjacent or overlapping one another and thereby ensure that the semiconductor wafer W has the same temperature in the surface regions 20a, 21a.
  • the first substrate pyrometer 20 and the second substrate pyrometer 21 are shown so that they extend into the upper lamp chamber and are directed perpendicularly from above onto the semiconductor wafer W.
  • the first and second substrate pyrometers 20, 21 could also be directed to the top of the semiconductor wafer W via an optical fiber extending in a shielded manner into or through the lamp chamber 7 and a corresponding opening in the top wall 5.
  • the first and second substrate pyrometers 20, 21 are thus able to detect radiation coming from the semiconductor wafer W.
  • This radiation coming from the substrate contains radiation emitted by the substrate, which is referred to below as substrate radiation, as well as, as a rule, radiation originating from the lamps 8 and reflected at the semiconductor wafer W, which is referred to below as reflection radiation.
  • the radiation detected at the respective first and second substrate pyrometers 20, 21 differs with respect to the composition of the portions of the substrate radiation and the reflection radiation. This can be achieved in different ways, as will be explained in more detail below with reference to FIG. 3. It is possible that the proportion of the reflection radiation measured at one of the substrate pyrometers 20, 21 is zero, or goes to zero.
  • the lamp pyrometer 25 is shown so that it extends into the upper lamp chamber and is directed perpendicularly from above onto one of the lamps 8 of the upper lamp bank. However, it would also be possible to attach the lamp pyrometer 25 laterally to the housing 2 and to direct it from the side onto one of the lamps 8.
  • FIGS. 3a to c show schematic side views of different arrangement variants of the substrate pyrometers 20, 21 and the lamp pyrometer 25 with respect to the semiconductor wafer W and the lamps 8 of the upper lamp bank.
  • the substrate pyrometers 20, 21 are directed between adjacent lamps 8 of the upper bank of lamps on the upper side of the semiconductor wafer W.
  • the substrate pyrometers 20, 21 are each arranged so that they can detect substantially no radiation coming directly from the lamps 8, which can be achieved, for example, via a corresponding opening of a diaphragm of the substrate pyrometers 20, 21. that can.
  • the field of view of the substrate pyrometers 20, 21 is indicated by dashed lines.
  • the lamp pyrometer 25 is directed toward a lamp 8, namely adjacent to the substrate pyrometer 20, so that the lamp pyrometer 25 can detect the radiation of a lamp 8, which is also detected by the substrate pyrometer via reflection, as will be described in more detail below is explained.
  • the substrate pyrometer 20 has a field of view on the semiconductor wafer W, which is defined by an opening angle ⁇ and the distance of the substrate pyrometer 20 from the semiconductor wafer W.
  • the opening angle ⁇ is selected at the position of the substrate pyrometer 20 such that a simply reflected radiation of the lamps 8, which are arranged adjacent to the substrate pyrometer 20, falls into the substrate pyrometer 20 and is thereby detected.
  • the substrate pyrometer 21 has a field of view on the semiconductor wafer W, which is defined by an opening angle ⁇ and the distance of the substrate pyrometer 21 to the semiconductor wafer W.
  • the opening angle ⁇ is chosen so that at the position of the Substratpyrometers 21 no radiation of the lamps 8 can be incident by means of simple reflection in the Substratpyrometer 21.
  • only single reflections of the lamp radiation were considered.
  • each of the substrate pyrometers 20, 21 can be incident (multiple) lamp radiation into the corresponding substrate pyrometer 20, 21 by multiple reflections. However, these can essentially be neglected below since the corresponding proportion of the radiation which falls into the substrate pyrometer 20 or 21 via multiple reflections is relatively small.
  • the substrate pyrometers 20, 21 each have a field of view on the semiconductor wafer W which is defined by an identical opening angle ⁇ and distances of the substrate pyrometers 20, 21 to the semiconductor wafer W.
  • the substrate pyrometer 20 is arranged at a greater distance with respect to the surface of the semiconductor wafer W than the substrate pyrometer 21.
  • the substrate pyrometers 20, 21 each have a field of view on the half-further wafer W, which is defined by equal opening angle ⁇ and equal distances of the substrate pyrometers 20, 21 to the semiconductor wafer.
  • the lamps 8 are surrounded by a filter element that filters out the lamp radiation in the range of the measuring wavelength of the substrate pyrometer 21.
  • this radiation lies outside the measuring wave range of the substrate pyrometer 21, so that the substrate pyrometer 21 detects a different proportion of reflection radiation than the substrate pyrometer 20.
  • a connected to the substrate pyrometer 20, 21 and the lamp pyrometer, not shown in detail from the evaluation detected radiation directly determine the temperature of the semiconductor wafer W, as will be explained in more detail below. Furthermore, the emissivity of the semiconductor wafer W can also be determined from the detected radiation.
  • the substrate pyrometers 20, 21 detect the radiation coming from the semiconductor wafer W which, as explained above, contains the substrate radiation and optionally the reflection radiation. In addition, transmission components can also be contained in the detected radiation, but these are not taken into account in the following description.
  • the lamp pyrometer 25 detects the lamp radiation of at least one lamp 8. This lamp radiation may optionally have a modulation in a known manner in order to be able to distinguish it from substrate radiation. Such modulation is not essential for temperature determination, but may provide additional information as appropriate.
  • the usual pyrometric temperature measurement is based on the measurement of the intensity of the thermal radiation of an object at a predetermined wavelength.
  • the thermal radiation power P bb which is radiated by the surface element dA in the wavelength range between ⁇ and ⁇ + d ⁇ in the entire half-space, given by the Planck formula:
  • the radiation is smaller than that of a blackbody: t ⁇ ( ⁇ , ⁇ ) dP h ⁇ T, X)
  • ⁇ with 0 ⁇ ⁇ 1 represents the emissivity of the object. This depends on the wavelength and the angle of view and often changes with the temperature of the object. In addition, it is also situation-dependent, for example, the emissivity of an object in a reflective chamber is higher than in free space.
  • the emissivity of the object at the wavelength and the viewing angle to the object must usually be known.
  • the direct emissivity at one wavelength is the same as the direct absorption at the wavelength, so that ⁇ -1-p- ⁇ , where p is the reflectivity and ⁇ is the transmissivity.
  • substrate radiation as well as reflection radiation are measured on the substrate pyrometer 20. Assuming that no direct lamp radiation can enter the substrate pyrometer, multiple reflections are not taken into account and no transmission occurs at the measuring wavelength of the substrate pyrometer 20, then the signal S 20 of the substrate pyrometer 20 can be represented as follows:
  • P bb (T) is the blackbody radiation corresponding to the wafer temperature T according to Planck's formula
  • is the emissivity of the wafer surface
  • L (P) is the lamp radiation at the measurement wavelength when the P is the reflectivity of the wafer surface
  • a and b are constants that depend on the field of view of the pyrometer, chamber geometry, and other parameters.
  • the reflectivity ⁇ 1 - ⁇ , so that the pyrometer signal can be represented as follows:
  • FIGS. 4 (a) and 4 (b) show the course in each case for different emissivities ⁇ of a semiconductor wafer W.
  • FIGS. 5 (a) and 5 (b) show the expected shape of the pyrometer signal as a function of the temperature of the wafer with both the substrate radiation and the reflection radiation.
  • 5 (a) shows the expected course of the pyrometer signal at a lamp power of 5%
  • FIG. 5 (b) shows the expected course of the pyrometer signal at a lamp power of 50%, in each case for different emissivities ⁇ of a semiconductor wafer W.
  • FIGS. 5 (a) and 5 (b) shows a wafer temperature at which the pyrometer signal is independent of the emissivity ⁇ of the semiconductor wafer W.
  • the pyrometer signal is:
  • Fig. 6 now shows a graph of operating temperatures of a pyrometer as a function of lamp power. Each time the wafer temperature crosses this curve at a corresponding lamp power P, the temperature is directly known without knowledge of the emissivity ⁇ of the semiconductor wafer.
  • the lamp power P is not the one that keeps the semiconductor wafer W at a constant temperature T p .
  • different lamp powers would be expedient for a process control on the one hand and a measurement on the other hand. So it would be possible to quickly change the lamp power for a measurement continuously.
  • the point could be determined at which the lamp power and the pyrometer signal with the line of FIG. 6 match, which allows a direct Temperaturbe- mood.
  • the lamp power could be regulated again for normal process control. If such a change in the lamp power is possible quickly enough, without affecting the temperature of the semiconductor wafer, a direct temperature measurement with only one substrate pyrometer would be possible.
  • both of the above-described substrate pyrometers 20, 21 are preferably used for a temperature measurement, the different allow parts of measured reflection radiation to directly measure the temperature, as described below.
  • FIG. 7 shows different curves of the working temperature (corresponding to FIG. 6) of a pyrometer for different proportions of the reflection radiation with constant substrate radiation.
  • the uppermost curve shows the working temperature for the normal expected reflection radiation.
  • the lower curves correspond to a reduction of the expected reflection radiation by a factor of 2, 5 and 10, respectively.
  • Two substrate pyrometers which detect different amounts of reflection radiation while the substrate radiation remains the same, allow direct temperature determination on the different curves of the corresponding operating temperatures. Further, a weighted sum of two pyrometer signals containing different amounts of reflection radiation in a known manner may be used to emulate a virtual pyrometer having an operating point at the current wafer temperature.
  • the pyrometer signals of the substrate pyrometers 20, 21 can be expressed as follows:
  • the pyrometer of Substratpyrometers 20 a 20, a constant that takes account of a gain of the wafer radiation at Substratpyrometer 20, and b 20 is a constant that takes into account an influence of the reflection radiation at Substratpyrometer 20th
  • S 21 the pyrometer of the substrate pyrometer 21
  • a 2X is a constant that takes into account an amplification factor of the wafer radiation on the substrate pyrometer
  • b 2l is a constant that takes into account an influence of the reflection radiation on the substrate pyrometer 21.
  • the influence of the reflection Radiation is determined by the proportions of substrate radiation and reflection radiation, which are known to differ in the substrate pyrometers.
  • the calculated emissivity is an in-situ emissivity that only applies within the chamber and within the linear model.
  • the simple relationship between lamp power and expected lamp radiation is not necessarily accurate with rapidly changing lamp power. Therefore, it may be appropriate to determine the lamp radiation directly, which can be achieved via the lamp pyrometer 25. Instead of the lamp power, the measuring
  • the working temperature curves of FIG. 6 are based on a simple model, and the actual curves will depend on the illustrated ones. soft. Instead of improving the model, it may be useful to determine the curves as part of a calibration routine. This requires different calibration runs with at least two wafers with different emissivities.
  • a calibration run consists of a sequence of different constant lamp powers or preferably constant lamp radiation which is measured by the lamp pyrometer.
  • Constant lamp power / radiation results in the wafer approaching an equilibrium temperature asymptotically. This is higher than the working temperature of the pyrometer for high lamp power / radiation and lower than the operating temperature of the pyrometer for lower lamp powerA radiation. Now, if one starts at low wafer temperature with high lamp power / radiation, then the wafer temperature will cross the curve of FIG. A reduction of the lamp power / radiation now leads to the fact that the wafer temperature drops below the curve according to FIG. 6. A sequence can be set in which the temperature crosses the curve several times at different positions to obtain the entire curve. If this sequence is run with both wafers (with different emissivities), the true position of the curve of the working temperatures can be determined.
  • This calibration can be done for both substrate pyrometers if they have different operating temperatures. As mentioned earlier, the actual temperature of a wafer will rarely be on any of the calibrated operating temperature curves, but a virtual pyrometer S v may be emulated from a weighted sum of the two pyrometer signals:
  • more than two substrate pyrometers could be used or a single substrate pyrometer could be used, for example, via a movable diaphragm constantly in a known manner, the field of view on the semiconductor wafer and thus the proportion of a reflection radiation that falls in the substrate pyrometer is changed , As a result, two pyrometers are simulated with different proportions of reflection radiation.
  • the two surface areas of the substrate can match exactly in the case, so that in any case it is ensured that they both have the same temperature and the same emissivity, even without rotation.
  • one of the pyrometers could be directed towards the substrate through a tube, which may optionally be at least partially reflective, whereby the tube may extend to just before the substrate surface. With a suitable (narrow) opening angle of the pyrometer, the pyrometer is thus moved closer to the substrate optically.
  • a device can also be Det, the arrangement variants of the substrate pyrometer combined with different opening angles, different distances to the wafer and / or filters.

Landscapes

  • Physics & Mathematics (AREA)
  • General Physics & Mathematics (AREA)
  • Spectroscopy & Molecular Physics (AREA)
  • Radiation Pyrometers (AREA)
  • Testing Or Measuring Of Semiconductors Or The Like (AREA)
  • Engineering & Computer Science (AREA)
  • Manufacturing & Machinery (AREA)
  • Health & Medical Sciences (AREA)
  • Toxicology (AREA)
PCT/EP2013/000807 2012-03-16 2013-03-15 Vorrichtung zum bestimmen der temperatur eines substrats Ceased WO2013135394A1 (de)

Priority Applications (4)

Application Number Priority Date Filing Date Title
US14/384,223 US9805993B2 (en) 2012-03-16 2013-03-15 Device for determining the temperature of a substrate
JP2014561330A JP6114762B2 (ja) 2012-03-16 2013-03-15 基板の温度を測定する装置
KR1020147029081A KR102045393B1 (ko) 2012-03-16 2013-03-15 기판의 온도를 판정하기 위한 장치 및 기판을 열처리하기 위한 방법
EP13716726.8A EP2825859B1 (de) 2012-03-16 2013-03-15 Vorrichtung zum bestimmen der temperatur eines substrats

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
DE102012005428.9 2012-03-16
DE102012005428.9A DE102012005428B4 (de) 2012-03-16 2012-03-16 Vorrichtung zum Bestimmen der Temperatur eines Substrats

Publications (1)

Publication Number Publication Date
WO2013135394A1 true WO2013135394A1 (de) 2013-09-19

Family

ID=48128252

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2013/000807 Ceased WO2013135394A1 (de) 2012-03-16 2013-03-15 Vorrichtung zum bestimmen der temperatur eines substrats

Country Status (6)

Country Link
US (1) US9805993B2 (https=)
EP (1) EP2825859B1 (https=)
JP (1) JP6114762B2 (https=)
KR (1) KR102045393B1 (https=)
DE (1) DE102012005428B4 (https=)
WO (1) WO2013135394A1 (https=)

Families Citing this family (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10636934B2 (en) 2015-09-23 2020-04-28 centrotherm international AG Method and device for passivating defects in semiconductor substrates
WO2020005366A1 (en) 2018-06-26 2020-01-02 Applied Materials, Inc. Method and apparatus for measuring temperature
WO2020068338A1 (en) * 2018-09-24 2020-04-02 Applied Materials, Inc. Atomic oxygen and ozone device for cleaning and surface treatment
CN110124837B (zh) * 2019-05-17 2021-04-23 西安奕斯伟硅片技术有限公司 一种硅晶体的破碎方法及热处理装置
JP7370763B2 (ja) * 2019-08-22 2023-10-30 株式会社Screenホールディングス 熱処理方法および熱処理装置
JP7338441B2 (ja) * 2019-12-13 2023-09-05 ウシオ電機株式会社 光加熱装置

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5318362A (en) 1990-04-10 1994-06-07 Luxtron Corporation Non-contact techniques for measuring temperature of radiation-heated objects
WO2000047962A1 (de) * 1999-02-10 2000-08-17 Steag Rtp Systems Gmbh Vorrichtung und verfahren zum messen der temperatur von substraten
US20020066859A1 (en) * 1998-03-19 2002-06-06 Tomomi Ino Temperature measuring method and apparatus, measuring mehtod for the thickness of the formed film, measuring apparatus for the thickness of the formed film thermometer for wafers
WO2008003080A2 (en) * 2006-06-29 2008-01-03 Mattson Technology, Inc. Methods for determining wafer temperature

Family Cites Families (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JPH01124726A (ja) * 1987-11-09 1989-05-17 Toshiba Corp 加熱装置
US4919542A (en) * 1988-04-27 1990-04-24 Ag Processing Technologies, Inc. Emissivity correction apparatus and method
KR940703996A (ko) * 1992-11-03 1994-12-12 알.밴 오버스트래텐 가열챔버내 물체의 가열 조정방법 및 그 장치(System For The Controlled Heating Of An Object)
US5624590A (en) * 1993-04-02 1997-04-29 Lucent Technologies, Inc. Semiconductor processing technique, including pyrometric measurement of radiantly heated bodies and an apparatus for practicing this technique
US6179466B1 (en) * 1994-12-19 2001-01-30 Applied Materials, Inc. Method and apparatus for measuring substrate temperatures
US5660472A (en) * 1994-12-19 1997-08-26 Applied Materials, Inc. Method and apparatus for measuring substrate temperatures
US6183130B1 (en) * 1998-02-20 2001-02-06 Applied Materials, Inc. Apparatus for substrate temperature measurement using a reflecting cavity and detector
JP2000105152A (ja) * 1998-09-29 2000-04-11 Toshiba Corp 温度測定方法及びその装置
JP2002015982A (ja) * 2000-06-30 2002-01-18 Ibiden Co Ltd 赤外線温度センサ付きホットプレート
DE10032465A1 (de) * 2000-07-04 2002-01-31 Steag Rtp Systems Gmbh Verfahren und Vorrichtung zum thermischen Behandeln von Objekten
US6849831B2 (en) * 2002-03-29 2005-02-01 Mattson Technology, Inc. Pulsed processing semiconductor heating methods using combinations of heating sources
US7734439B2 (en) * 2002-06-24 2010-06-08 Mattson Technology, Inc. System and process for calibrating pyrometers in thermal processing chambers
US6835914B2 (en) * 2002-11-05 2004-12-28 Mattson Technology, Inc. Apparatus and method for reducing stray light in substrate processing chambers
US7642205B2 (en) * 2005-04-08 2010-01-05 Mattson Technology, Inc. Rapid thermal processing using energy transfer layers
JP4864396B2 (ja) * 2005-09-13 2012-02-01 株式会社東芝 半導体素子の製造方法、及び、半導体素子の製造装置

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5318362A (en) 1990-04-10 1994-06-07 Luxtron Corporation Non-contact techniques for measuring temperature of radiation-heated objects
US20020066859A1 (en) * 1998-03-19 2002-06-06 Tomomi Ino Temperature measuring method and apparatus, measuring mehtod for the thickness of the formed film, measuring apparatus for the thickness of the formed film thermometer for wafers
WO2000047962A1 (de) * 1999-02-10 2000-08-17 Steag Rtp Systems Gmbh Vorrichtung und verfahren zum messen der temperatur von substraten
WO2008003080A2 (en) * 2006-06-29 2008-01-03 Mattson Technology, Inc. Methods for determining wafer temperature

Also Published As

Publication number Publication date
KR102045393B1 (ko) 2019-11-15
US9805993B2 (en) 2017-10-31
DE102012005428A1 (de) 2013-09-19
DE102012005428B4 (de) 2014-10-16
KR20140140081A (ko) 2014-12-08
JP2015513094A (ja) 2015-04-30
JP6114762B2 (ja) 2017-04-12
US20150087085A1 (en) 2015-03-26
EP2825859B1 (de) 2022-10-19
EP2825859A1 (de) 2015-01-21

Similar Documents

Publication Publication Date Title
EP0143282B1 (de) Verfahren zur berührungslosen, emissionsgradunabhängigen Strahlungsmessung der Temperatur eines Objektes
DE112011103113B4 (de) Reflektivitätsmessverfahren, Membrandickenmessvorrichtung und Membrandickenmessverfahren
DE102012005428B4 (de) Vorrichtung zum Bestimmen der Temperatur eines Substrats
EP0795121B1 (de) Verfahren und vorrichtung zur messung von lichtbündeln
DE112018005533T5 (de) Detektion und messung der dimensionen asymmetrischer strukturen
EP0701686A1 (de) Gleichzeitiges bestimmen von schichtdicke und substrattemperatur während des beschichtens
WO2009044303A2 (de) Kalibrationssubstrat und -verfahren
DE112010004023T5 (de) Filmdickenmessvorrichtung und Filmdickenmessverfahren
EP2856096B1 (de) Optisches messsystem mit polarisationskompensation, sowie entsprechendes verfahren
DE102011050030A1 (de) Positionsdetektor und Lichtablenkvorrichtung
DE102020203192A1 (de) Wachstumsgeschwindigkeits -detektionsvorrichtung, aufdampfvorrichtung und aufdampfgeschwindigkeits-detektionsverfahren
DE112015006195T5 (de) Spektral programmierbarer Memristor
WO2004059271A1 (de) Verfahren zum bestimmen der temperatur eines halbleiterwafers in einer schnelheizanlage
DE102019114167A1 (de) Optische Messvorrichtung und Verfahren
EP0153313B1 (de) Mehrstrahl-messanordnung
DE10329107B4 (de) Verfahren zum Bestimmung wenigstens einer Zustandsvariablen aus einem Modell eines RTP-Systems
DE3880748T2 (de) Verfahren und vorrichtung zur messung oder bestimmung einer oder mehrerer eigenschaften oder der identitaet einer probe.
EP0443702A2 (de) Messverfahren zur Bestimmung kleiner Lichtabsorptionen
EP2237025A2 (de) Verfahren und Vorrichtung zur Charakterisierung einer dünnen Siliziumschicht auf einem lichtdurchlässigen Substrat
DE69918661T2 (de) Verfahren und Vorrichtung zum Messen von Musterstrukturen
EP1888293A1 (de) Optisches element sowie verfahren zur erfassung von strahlparametern, mit einem als pixels-matrix ausgebildeten temperatursensor
WO2000029808A1 (de) Verfahren zum bestimmen der dicke einer vielfach-dünnschichtstruktur
DE3737426A1 (de) Interferometer
EP3324161B1 (de) Spektrometer und verfahren zur justierung eines filterarrays
DE102020114734B4 (de) Verfahren und Vorrichtung zur in-situ Bestimmung der Temperatur einer Probe

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 13716726

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 14384223

Country of ref document: US

ENP Entry into the national phase

Ref document number: 2014561330

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2013716726

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 20147029081

Country of ref document: KR

Kind code of ref document: A