WO2013116781A1 - Alk1 antagonists and their uses in treating renal cell carcinoma - Google Patents

Alk1 antagonists and their uses in treating renal cell carcinoma Download PDF

Info

Publication number
WO2013116781A1
WO2013116781A1 PCT/US2013/024510 US2013024510W WO2013116781A1 WO 2013116781 A1 WO2013116781 A1 WO 2013116781A1 US 2013024510 W US2013024510 W US 2013024510W WO 2013116781 A1 WO2013116781 A1 WO 2013116781A1
Authority
WO
WIPO (PCT)
Prior art keywords
alkl
rcc
antibody
polypeptide
seq
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2013/024510
Other languages
English (en)
French (fr)
Inventor
Rupal S. BHATT
Ravindra Kumar
James W. MIER
Robert Pearsall
Matthew Sherman
Nicolas Solban
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Beth Israel Deaconess Medical Center Inc
Acceleron Pharma Inc
Original Assignee
Beth Israel Deaconess Medical Center Inc
Acceleron Pharma Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Beth Israel Deaconess Medical Center Inc, Acceleron Pharma Inc filed Critical Beth Israel Deaconess Medical Center Inc
Priority to AU2013214779A priority Critical patent/AU2013214779A1/en
Priority to RU2014134923A priority patent/RU2633638C2/ru
Priority to EP13744185.3A priority patent/EP2809335A4/en
Priority to MX2014009277A priority patent/MX2014009277A/es
Priority to CA2863188A priority patent/CA2863188A1/en
Priority to BR112014019151A priority patent/BR112014019151A2/pt
Priority to CN201380013788.3A priority patent/CN104321070A/zh
Priority to KR1020147024468A priority patent/KR20140123558A/ko
Priority to JP2014555801A priority patent/JP2015506961A/ja
Publication of WO2013116781A1 publication Critical patent/WO2013116781A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/43Enzymes; Proenzymes; Derivatives thereof
    • A61K38/45Transferases (2)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/40Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil
    • A61K31/403Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil condensed with carbocyclic rings, e.g. carbazole
    • A61K31/404Indoles, e.g. pindolol
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/435Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
    • A61K31/4353Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom ortho- or peri-condensed with heterocyclic ring systems
    • A61K31/436Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom ortho- or peri-condensed with heterocyclic ring systems the heterocyclic ring system containing a six-membered ring having oxygen as a ring hetero atom, e.g. rapamycin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/435Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
    • A61K31/44Non condensed pyridines; Hydrogenated derivatives thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/435Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
    • A61K31/44Non condensed pyridines; Hydrogenated derivatives thereof
    • A61K31/4427Non condensed pyridines; Hydrogenated derivatives thereof containing further heterocyclic ring systems
    • A61K31/4439Non condensed pyridines; Hydrogenated derivatives thereof containing further heterocyclic ring systems containing a five-membered ring with nitrogen as a ring hetero atom, e.g. omeprazole
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/435Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
    • A61K31/47Quinolines; Isoquinolines
    • A61K31/4709Non-condensed quinolines and containing further heterocyclic rings
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/505Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
    • A61K31/506Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim not condensed and containing further heterocyclic rings
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/505Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
    • A61K31/517Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with carbocyclic ring systems, e.g. quinazoline, perimidine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/6811Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • A61P13/12Drugs for disorders of the urinary system of the kidneys
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/04Antineoplastic agents specific for metastasis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/22Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/40Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against enzymes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y207/00Transferases transferring phosphorus-containing groups (2.7)
    • C12Y207/11Protein-serine/threonine kinases (2.7.11)
    • C12Y207/1103Receptor protein serine/threonine kinase (2.7.11.30)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto

Definitions

  • Renal Cell Carcinoma accounts for up to 90% of all malignant kidney tumors and is the eighth most commonly diagnosed cancer in men and women in the U.S.
  • the National Cancer Institute estimates that approximately 65,000 new cases of renal cancer will be diagnosed in the U.S. in 2012 and that approximately 13,600 deaths will result from renal cancer.
  • RCC can often be cured through surgical removal of the tumor or kidney if diagnosed and treated when still localized to the kidney or immediate surrounding tissue.
  • the probability of disease free survival significantly decreases as the cancer becomes vascularized and metastasizes to distant parts of the body.
  • One third of RCC presents as metastatic disease, with a five-year survival rate of less than 10%.
  • mRCC Metastatic RCC
  • IL-2 interleukin 2
  • IFN-a interferon alpha
  • VEGF vascular endothelial growth factor
  • PDGF platelet derived growth factor
  • AKT/ mTOR mimmalian target of rapamycin
  • bevacizumab a humanized antibody that binds VEGF, commonly known as AVASTIN®
  • the approved RCC therapies that target the VEGF pathway are small-molecule ATP -mimetic inhibitor compounds. These small molecule inhibitors act by binding the highly conserved ATP -binding catalytic site of receptor tyrosine kinases such as, VEGFR1, VEGFR2, and VEGFR3, and thereby blocking the intracellular signaling of the bound receptor.
  • receptor tyrosine kinase inhibitors due in part to the highly conserved structure of the ATP-binding catalytic site amongst protein kinases, most small molecule receptor tyrosine kinase inhibitors also bind to and inhibit distinct unintended receptor tyrosine kinases, and sometimes even members of other kinase families. Such "off-target" action of receptor tyrosine kinase inhibitors frequently lead to adverse events and toxicities that limit the therapeutic applications and/or efficacy of the drug.
  • Sunitinib (commonly known as SUTENT®) is a multitarget receptor tyrosine kinase inhibitor that was initially developed as a small molecule inhibitor of the c-Met receptor tyrosine kinase. In addition to c-Met, sunitinib competitively inhibits activity of the VEGFR1, VEGFR2, VEGFR3, PDGFRa, PDGFRb, flt-3, c-KIT (CD117), RET, and CSF-1R receptor tyrosine kinases.
  • Sunitinib received approval as a first line therapy in treating advanced RCC after concluding pivotal trials demonstrating that sunitinib prolonged overall survival in patients with advanced disease by nearly five months compared to interferon-alpha (26.4 months vs. 21.8 months). Although modest, this improvement in patient survival has made sunitinib the new standard of care for treatment-naive patients with advanced RCC. Sunitinib therapy is associated with significant side effects, as demonstrated by the requirement of dose reductions in 50% of the RCC patients in order to manage the significant toxicities associated with sunitinib.
  • the present disclosure provides antagonists of the activin-like kinase I (ALK1)- regulatory system and the use of such antagonists to treat renal cell carcinoma (RCC).
  • RCC renal cell carcinoma
  • the RCC is clear cell renal cell carcinoma.
  • the RCC is a TNM (Tumor/Mode/Metastasis classification) stage III disease, in additional aspects, the RCC is a TNM stage IV disease.
  • the RCC is found within the intrarenal veins.
  • the RCC has invaded the renal sinus.
  • the RCC has metastasized to the adrenal gland or to a lymph node.
  • the RCC has metastasized to the lung, intra-abdominal lymph nodes, bone, brain, or liver.
  • ALKl is a receptor for the GDF5 (growth differentiation factor 5) group of ligands, which includes GDF6 and GDF7, and also for the BMP9 (bone morphogenetic protein 5) group of ligands, which includes BMP 10.
  • GDF5 growth differentiation factor 5
  • BMP9 bone morphogenetic protein 5
  • ALKl regulatory system antagonists such as an ALKl-Fc fusion protein
  • ALKl-Fc fusion protein antagonist of ALKl significantly enhances the tumor growth inhibiting activity of sunitinib, a VEGF receptor tyrosine kinase inhibitor, when administered in combination with sunitinib in human RCC xenograft animal models.
  • the disclosure provides antagonists of the ALKl regulatory system, including antagonists of the ALKl receptor or one or more ALKl ligands, for use in treating renal cell carcinoma.
  • the ALKl antagonist is an ALKl-Fc fusion protein (e.g., an ALKl- Fc fusion protein as described herein).
  • the disclosure provides antagonists of the ALKl regulatory system, including antagonists of the ALKl receptor or one or more of the ALKl ligands, for use in treating renal cell carcinoma.
  • the renal cell carcinoma is clear cell renal cell carcinoma.
  • the renal cell carcinoma that is treated has invaded the renal sinus.
  • the RCC is a TNM stage III disease.
  • the RCC is a TNM stage IV disease.
  • the RCC is found within the intrarenal veins.
  • the RCC has invaded the renal sinus.
  • the RCC has metastasized to the adrenal gland or to a lymph node.
  • the RCC has metastasized to the lung, intra-abdominal lymph nodes, bone, brain, or liver.
  • the disclosure provides polypeptides comprising a ligand binding portion of the extracellular domain of ALK1 ("ALK1 ECD polypeptides”) for use in inhibiting angiogenesis.
  • ALK1 ECD polypeptides for use in treating angiogenesis.
  • the disclosure provides polypeptides comprising ALK1 ECD polypeptides for use in treating RCC (e.g., clear cell renal cell carcinoma). While not wishing to be bound to any particular mechanism of action, it is expected that such polypeptides act by binding to ligands of ALK1 and inhibiting the ability of these ligands to interact with ALK1 , as well as other receptors.
  • an ALK1 ECD polypeptide comprises an amino acid sequence that is at least 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence of amino acids 22-1 18 of the human ALK1 sequence of SEQ ID NO: l . In certain embodiments, an ALK1 ECD polypeptide comprises an amino acid sequence that is at least 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence of amino acids 22-120 of the human ALK1 sequence of SEQ ID NO: l .
  • An AL l ECD polypeptide can be used as a small monomeric protein or in a dimerized form (e.g., expressed as an Fc fusion protein).
  • An ALKl ECD can also be fused to a second polypeptide portion to provide improved or desired properties, such as an improved ligand binding affinity, increased half-life or greater ease of production or purification. Fusions to an Fc portion of an immunoglobulin or linkage to a polyoxyethylene moiety (e.g., polyethylene glycol) are particularly useful for increasing the serum half-life of the ALKl ECD polypeptide during systemic administration (e.g., intravenous, intraarterial and intra-peritoneal administration).
  • systemic administration e.g., intravenous, intraarterial and intra-peritoneal administration.
  • a systemically administered ALKl -Fc fusion protein has a potent tumor growth inhibiting effect when administered alone in a human RCC mouse xenograft model and dramatically increases sunitinib RCC tumor growth inhibition when systemically administered with sunitinib in the human RCC mouse xenograft models tested.
  • an ALKl-Fc fusion protein comprises a polypeptide having an amino acid sequence that is at least 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence of amino acids 22-1 18 or 22-120 of SEQ ID NO: l, which polypeptide is fused, either with or without an intervening linker, to an Fc portion of an immunoglobulin, and wherein the ALKl-Fc fusion protein binds to an ALKl ligand selected from GDF5 (e.g. having the sequence recited in Genbank Accession No. CAA56874), GDF6 (e.g., having the sequence recited in Genbank Accession No.
  • the ALKl-Fc fusion protein binds to an ALKl ligand selected from GDF5, GDF7 and BMP9 with a K D of less than 1 x 10 "7 M and binds to TGFp-l with a K D of greater than 1 x 10 "6 M.
  • Fc portions of the Fc fusion protein are selected so as to be appropriate to the organism being treated and so as to exhibit the desired pharmacokinetic and pharmacodymamic properties.
  • the Fc portion is an Fc portion of a human IgGl .
  • the ALKl-Fc fusion protein comprises amino acids 22- 118 or 22-120 of SEQ ID NO:l.
  • the ALKl-Fc fusion protein comprises the amino acid sequence of SEQ ID NO: 3.
  • the ALKl -Fc fusion protein comprises the amino acid sequence of SEQ ID NO: 14.
  • the ALKl-Fc fusion protein is the protein produced by expression of the nucleic acid of SEQ ID NO:4 in a mammalian cell line, particularly a Chinese Hamster Ovary (CHO) cell line.
  • ALKl-ECD polypeptides are formulated as pharmaceutical preparations that are substantially pyrogen free.
  • the pharmaceutical preparation can be prepared for systemic delivery (e.g., intravenous, intraarterial or subcutaneous delivery) or local delivery.
  • the disclosure addresses the difficulties in developing relatively homogeneous preparations of ALKl-Fc fusion protein for use in a therapeutic setting. As described herein, ALKl-Fc fusion proteins tend to aggregate into higher order multimers. The disclosure provides solutions to these difficulties and therefore provides pharmaceutical preparations comprising ALKl-Fc fusion proteins wherein such preparations are composed of at least 85%, 90%, 95%, 96%, 97%, 98%, or 99% dimeric ALKl-Fc fusion protein.
  • an ALKl-Fc fusion protein comprising: a polypeptide having an amino acid sequence that is at least 90%, 95%, 96% or 97% identical to the sequence of amino acids 22-118 or 22-120 of SEQ ID NO:l, which polypeptide is fused to an Fc portion of an immunoglobulin, and wherein the ALKl-Fc fusion protein binds to a ligand selected from GDF5, GDF6, GDF7, BMP9 and BMP 10.
  • the ALKl -Fc fusion protein binds GDF5, GDF7 and BMP9 with a KD of less than 1 x 10 "7 M and binds to TGFp-l with a K D of greater than 1 x 10 "6 M and wherein at least 85%, 90%, 95%, 96%, 97%, 98%, or 99% of the ALKl-Fc fusion protein is present in a dimeric form.
  • the Fc portion of the ALKl -Fc fusion protein can be an Fc portion of a human
  • the ALKl-Fc fusion protein comprises the amino acid sequence of SEQ ID NO:3. In other aspects the ALKl -Fc fusion protein comprises the amino acid sequence of SEQ ID NO: 14. In further aspects, the ALKl-Fc fusion protein is produced by the expression of the nucleic acid of SEQ ID NO:4 in a mammalian cell line, such as a Chinese Hamster Ovary (CHO) cell line. Such pharmaceutical preparations can be formulated with the objective of optimizing the desired properties of the ALKl -Fc fusion protein using known techniques and reagents.
  • the pharmaceutical preparations of the invention can be used for a variety of therapeutic purposes described herein, including inhibiting angiogenesis and treating RCC.
  • the pharmaceutical preparations are used to treat clear cell renal cell carcinoma.
  • the pharmaceutical preparations are used to treat RCC in a mammal having previously received an RCC therapeutic agent.
  • the pharmaceutical preparations are used to treat a mammal that has RCC and that has undergone or is preparing to undergo a medical procedure to treat RCC.
  • the pharmaceutical preparations of the invention are used to treat advanced (metastatic) RCC.
  • the pharmaceutical preparations of the invention are used to inhibit angiogenesis and/or to treat a disease or disorder in which inhibiting angiogenesis is desirable.
  • the ALKl-Fc pharmaceutical preparations and preparations comprising antibodies directed to ALK1 or one or more ligands of ALK1 (e.g., BMP9 and/or BMP 10) are used in conjunction with an agent that inhibits angiogenesis.
  • ALK1 e.g., BMP9 and/or BMP 10
  • the ALKl-Fc pharmaceutical preparations and preparations comprising antibodies directed to ALK1 or one or more ligands of ALK1 (e.g., BMP9 and/or BMP 10) are used in conjunction with a VEGF signaling pathway antagonist (e.g., an antibody that binds VEGF (e.g., AVASTIN®), a VEGF receptor (e.g., VEGFR1, VEGFR2, and VEGFR3) and a VEGF receptor trap).
  • a VEGF signaling pathway antagonist e.g., an antibody that binds VEGF (e.g., AVASTIN®), a VEGF receptor (e.g., VEGFR1, VEGFR2, and VEGFR3) and a VEGF receptor trap).
  • the pharmaceutical preparations comprise a VEGF receptor tyrosine kinase inhibitor.
  • VEGF receptor tyrosine kinase inhibitor is an agent selected from sunitinib (SUTENT®), sorafenib (NEXAVAR®), pazopanib (VOTRIENT®), axitinib (INLYTA®), tivozanib and vandetanib.
  • the disclosure provides methods for treating renal cell carcinoma in a mammal by administering to a mammal having RCC, an ALK1 ECD polypeptide.
  • the disclosure provides a method of treating RCC in a mammal, comprising administering to a mammal that has RCC an effective amount of an activin-like kinase I (ALKl)-Fc fusion protein and a VEGF receptor tyrosine kinase inhibitor.
  • the RCC to be treated is a clear cell renal cell carcinoma.
  • the RCC to be treated has invaded the renal sinus.
  • the RCC is a TNM stage III disease.
  • the RCC is a TNM stage IV disease. In additional aspects, the RCC is found within the intrarenal veins. In further aspects, the RCC has metastasized to the adrenal gland or to a lymph node. In further aspects, the RCC has metastasized to the lung, intra-abdominal lymph nodes, bone, brain, or liver.
  • the ALKl-Fc fusion protein administered according to a method of the invention comprises a polypeptide having an amino acid sequence that is at least 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of amino acids 22-1 18 or 22-120 of SEQ ID NO:l, which polypeptide is fused to an Fc portion of an immunoglobulin, and wherein the ALKl-Fc fusion protein binds to an ALK-ligand selected from GDF5, GDF6, GDF7, BMP9 and BMP 10.
  • the ALKl-Fc fusion protein binds TGFP-l with a K D of greater than 1 x 10 "6 M.
  • the ALKl- Fc fusion protein has a sequence of SEQ ID NO: 3.
  • the ALKl-Fc fusion protein has a sequence of SEQ ID NO: 14.
  • the ALK1 ECD polypeptide may be delivered locally or systemically (e.g., intravenously, intraarterially or subcutaneously).
  • the VEGF receptor tyrosine kinase inhibitor administered with the ALKl-Fc fusion protein is an agent selected from sunitinib (SUTENT®), sorafenib (NEXAVAR®), pazopanib (VOTRIENT®), axitinib (INLYTA®), tivozanib and vandetanib.
  • the disclosure provides a method of treating RCC in a mammal, comprising administering to a mammal that has RCC an effective amount of an activin- like kinase I (ALKl)-Fc, a VEGF receptor tyrosine kinase inhibitor, and a mammalian target of rapamycin (mTOR) inhibitor.
  • ALKl-Fc fusion protein and VEGF receptor tyrosine kinase inhibitor are administered with the mTOR-targeted inhibitor everolimus or temsirolimus.
  • the mTOR inhibitor is an agent selected from: WYE354, YE132 (Pfizer), PP30 and PP242, AZD8055, OSI-027, Torinl, BEZ235, XL765, GDC-0980, PF-04691502 and PF-05212384.
  • the RCC to be treated is a clear cell renal cell carcinoma. In another aspect, the RCC to be treated has invaded the renal sinus. In some aspects, the RCC is a TNM stage III disease. In additional aspects, the RCC is a TNM stage IV disease. In additional aspects, the RCC is found within the intrarenal veins. In further aspects, the RCC has metastasized to the adrenal gland or to a lymph node. In further aspects, the RCC has metastasized to the lung, intra-abdominal lymph nodes, bone, brain, or liver.
  • the disclosure provides a method of treating renal cell carcinoma in a mammal having previously received an RCC therapeutic agent, the method comprising administering to the mammal an effective amount of an activin-like kinase I (ALKl)-Fc fusion protein.
  • the previously received therapeutic agent is a VEGF receptor tyrosine kinase inhibitor.
  • the VEGF receptor tyrosine kinase inhibitor is an agent selected from: sunitinib, sorafenib, pazopanib, axitinib, tivozanib and vandetanib.
  • the previously received therapeutic agent is a mammalian target of rapamycin (mTOR)-targeted inhibitor.
  • the mTOR-targeted inhibitor is an agent selected from: everolimus and temsirolimus.
  • the mTOR-targeted inhibitor is an agent selected from: WYE354, YE132 (Pfizer), PP30 and PP242, AZD8055, OSI-027, Torinl, BEZ235, XL765, GDC-0980, PF- 04691502 and PF-05212384.
  • the previously received therapeutic agent is a systemic cytokine therapy.
  • the systemic cytokine therapy is interferon alpha (IFN-a) or interleukin-2 (IL-2).
  • the treated RCC is a clear cell renal cell carcinoma.
  • the treated RCC has invaded the renal sinus.
  • the RCC is a TNM stage III disease.
  • the RCC is a TNM stage IV disease.
  • the RCC is found within the intrarenal veins.
  • the RCC has metastasized to the adrenal gland or to a lymph node.
  • the RCC has metastasized to the lung, intra-abdominal lymph nodes, bone, brain, or liver.
  • the disclosure provides a method of treating renal cell carcinoma in a mammal having previously received an RCC therapeutic agent, the method comprising administering to the mammal an effective amount of an activin-like kinase I (ALKl)-Fc fusion protein and a VEGF receptor tyrosine kinase inhibitor.
  • the VEGF receptor tyrosine kinase inhibitor is an agent selected from: sunitinib, sorafenib, pazopanib, axitinib, tivozanib and vandetanib.
  • the treated RCC has invaded the renal sinus.
  • the RCC is a clear cell renal cell carcinoma.
  • the treated RCC has invaded the renal sinus.
  • the RCC is a TNM stage III disease.
  • the RCC is a TNM stage IV disease.
  • the RCC is found within the intrarenal veins.
  • the RCC has metastasized to the adrenal gland or to a lymph node.
  • the RCC has metastasized to the lung, intra-abdominal lymph nodes, bone, brain, or liver.
  • the disclosure provides a method of treating renal cell carcinoma in a mammal having previously received an RCC therapeutic agent, the method comprising administering to the mammal an effective amount of an activin-like kinase I (ALKl)-Fc fusion protein and an antibody that binds a receptor tyrosine kinase.
  • the antibody binds a receptor tyrosine kinase selected from: VEGF, VEGFR1, VEGFR2, VEGFR3, PDGFRa, PDGFRb, c-KIT, MET FAK, RET, beta FGF, TiE-1, Tie-2 and EGFR.
  • the administered antibody is bevacizumab.
  • the RCC is a clear cell renal cell carcinoma.
  • the treated RCC has invaded the renal sinus.
  • the RCC is a TNM stage III disease.
  • the RCC is a TNM stage IV disease.
  • the RCC is found within the intrarenal veins.
  • the RCC has metastasized to the adrenal gland or to a lymph node.
  • the RCC has metastasized to the lung, intra-abdominal lymph nodes, bone, brain, or liver.
  • the disclosure provides a method of treating renal cell carcinoma in a mammal having previously received an RCC therapeutic agent wherein the method comprises administering to the mammal an effective amount of an activin-like kinase I (ALKl)-Fc fusion protein and an mTOR-targeted inhibitor.
  • mTOR-targeted inhibitor is an agent selected from: everolimus and temsirolimus.
  • the mTOR inhibitor is an agent selected from: WYE354, YE132 (Pfizer), PP30 and PP242, AZD8055, OSI-027, Torinl, BEZ235, XL765, GDC-0980, PF-04691502 and PF-05212384.
  • the RCC is a clear cell renal cell carcinoma.
  • the treated RCC has invaded the renal sinus.
  • the RCC is a TNM stage HI disease.
  • the RCC is a TNM stage IV disease.
  • the RCC is found within the intrarenal veins.
  • the RCC has metastasized to the adrenal gland or to a lymph node.
  • the RCC has metastasized to the lung, intra-abdominal lymph nodes, bone, brain, or liver.
  • the disclosure provides a method of treating renal cell carcinoma in a mammal having previously received an RCC therapeutic agent wherein the method comprises administering to the mammal an effective amount of an activin-like kinase I (ALKl )-Fc fusion protein and an immunostimulatory cytokine.
  • the administered immunostimulatory cytokine is IFN-a or IL-2.
  • the treated RCC is a clear cell renal cell carcinoma.
  • the treated RCC has invaded the renal sinus.
  • the RCC is a TNM stage ⁇ disease.
  • the RCC is a TNM stage IV disease.
  • the RCC is found within the intrarenal veins.
  • the RCC has metastasized to the adrenal gland or to a lymph node.
  • the RCC has metastasized to the lung, intra-abdominal lymph nodes, bone, brain, or liver.
  • the disclosure provides a method of treating RCC in a mammal, which comprises administering to a mammal that has RCC and that has undergone or is preparing to undergo a medical procedure to treat RCC, an effective amount of an activin-like kinase I (ALKl)-Fc fusion protein.
  • the medical procedure is selected from: nephron-sparing surgery, a partial nephrectomy, a complete nephrectomy and thermal ablation.
  • the RCC is a clear cell renal cell carcinoma.
  • the RCC has invaded the renal sinus.
  • the RCC is a TNM stage III disease.
  • the RCC is a TNM stage IV disease. In additional aspects, the RCC is found within the intrarenal veins. In further aspects, the RCC has metastasized to the adrenal gland or to a lymph node. In further aspects, the RCC has metastasized to the lung, intra-abdominal lymph nodes, bone, brain, or liver.
  • the ALKl-Fc fusion protein administered the mammal that has
  • RCC and that has undergone or is preparing to undergo a medical procedure to treat RCC comprises a polypeptide having an amino acid sequence that is at least 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of amino acids 22-1 18 or 22-120 of SEQ ID NO:l, and wherein the ALKl-Fc fusion protein binds to an ALKl ligand selected from GDF5, GDF6, GDF7, BMP9 and BMP 10.
  • the Fc portion of the ALKl-Fc fusion protein is an Fc portion of a human IgGl immunoglobulin.
  • the ALKl-Fc fusion protein comprises the amino acid sequence of SEQ ID NO:3 or SEQ ID NO: 14
  • the disclosure provides a method of treating RCC in a mammal that has undergone or is preparing to undergo a medical procedure to treat RCC, wherein the method comprises administering to the mammal an effective amount of an activin-like kinase I (ALKl)-Fc fusion protein and a VEGF receptor tyrosine kinase inhibitor.
  • the VEGF receptor tyrosine kinase inhibitor is an agent selected from sunitinib, sorafenib, pazopanib, axitinib, tivozanib and vandetanib.
  • the disclosure provides a method of treating RCC in a mammal that has undergone or is preparing to undergo a medical procedure to treat RCC, wherein the method comprises administering to the mammal an effective amount of an ALKl-Fc fusion protein, a VEGF receptor tyrosine kinase inhibitor and an mTOR-targeted inhibitor.
  • the mTOR-targeted inhibitor is an agent selected from: everolimus and temsirolimus.
  • the mTOR inhibitor is an agent selected from: WYH354.
  • the disclosure provides a method of treating RCC in a mammal that has undergone or is preparing to undergo a medical procedure to treat RCC, wherein the method comprises administering to the mammal an effective amount of an ALKl-Fc fusion protein, a VEGF receptor tyrosine kinase inhibitor and an immunostimulatory cytokine.
  • administered immunostimulary cytokine is IFN- alpha or IL-2.
  • the disclosure provides method of treating RCC in a mammal that has undergone or is preparing to undergo a medical procedure to treat RCC wherein the method comprises administering to the mammal an antibody that binds to an ALKl ligand and inhibits the binding of the ALKl ligand to ALKl.
  • the antibody binds to the ALKl ligand with a KD of less than 5 x 10 " M.
  • the antibody inhibits angiogenesis stimulated by the ALKl ligand.
  • the antibody binds to ALKl in the extracellular domain, amino acids 22- 118 or 22-120 of SEQ ID NO:l and inhibit the binding of ALKl to at least one ALKl ligand selected from the group consisting of: GDF5, GDF6, GDF7, BMP9 and BMP 10. Based on the affinity of these ligands for ALKl, an antibody may bind with a KD of less than 5 x 10 "8 M, and optionally between 5 x 10 "8 M and 1 x 10 " '° M. An antibody with affinity within this range would be expected to inhibit signaling by one or more of GDF5, GFD6 and GFD7 while having less effect on signaling by BMP9 and BMP 10.
  • Such an antibody preferably inhibits angiogenesis stimulated by at least one ALKl ligand selected from the group consisting of: GDF5, GDF6 and GDF7. While not wishing to be bound to a particular mechanism, it is expected that such antibodies will act by inhibiting ALKl activity directly, which should be contrasted to the activity of an ALKl -Fc fusion protein, which is expected to inhibit the activity of ALKl ligands.
  • An anti-ALKl antibody is not expected to interfere with the ability of GDF5, GDF6, GDF7, BMP9 or BMP 10 to signal through alternative receptor systems, such as the BMPRla, BMPRlb and BMPRII complexes.
  • an anti-ALKl antibody is expected to interfere with the ability of low affinity ligands for ALKl (e.g. , TGF- ⁇ , which is generally recognized as triggering significant signaling events through ALKl even though binding is relatively weak) to signal through ALKl, even though an ALKl ECD may not bind to or inhibit such low affinity ligands.
  • ALKl e.g. , TGF- ⁇ , which is generally recognized as triggering significant signaling events through ALKl even though binding is relatively weak
  • an ALKl ECD may not bind to or inhibit such low affinity ligands.
  • An antibody with affinity within this range would be expected to inhibit signaling by BMP9 or BMP 10.
  • Such an antibody preferably inhibits binding of BMP9 and BMP10 to ALKl .
  • an antibody that binds to an ALKl ligand and inhibits the ligand to ALKl is an antibody that binds at or near the type I receptor binding site of the ligand.
  • an antibody that, binds relatively poorly to ALKl may inhibit TGFP binding to ALKl while failing to inhibit the tighter binding ligands such as GDF5 or BMP9.
  • the antibodies described herein are preferably recombinant antibodies, meaning an antibody expressed from a nucleic acid that has been constructed using the techniques of molecular biology, such as a humanized antibody or a fully human antibody developed from a single chain antibody. Fv, Fab and single chain antibodies are also included within the term "recombinant antibody.”
  • Antibodies may also be polyclonal or non-recombinant monoclonal antibodies (including human or murine forms, as well as human antibodies obtained from transgenic mice).
  • Antibodies and ALKl -ECD polypeptides can readily be formulated as a pharmaceutical preparation that is substantially pyrogen free.
  • the pharmaceutical preparation can be prepared for systemic delivery (e.g., intravenous, intraarterial or subcutaneous delivery) or local delivery.
  • Antibodies described in Intl. Appl. Publ. No. WO 2007/040912 may be useful in the various methods described herein.
  • the disclosure provides methods for treating renal cell carcinoma in a mammal by administering to a mammal an effective amount of an antibody that binds to an ALKl polypeptide, described herein either generally or specifically.
  • the renal cell carcinoma is a clear cell renal cell carcinoma.
  • the RCC has invaded the renal sinus.
  • the RCC is a TNM stage III disease.
  • the RCC is a TNM stage IV disease.
  • the RCC is found within the intrarenal veins.
  • the RCC has metastasized to the adrenal gland or to a lymph node.
  • the RCC has metastasized to the lung, intra-abdominal lymph nodes, bone, brain, or liver.
  • An antibody useful for this purpose binds to the extracellular domain of ALKl
  • the antibody binds to a polypeptide consisting of amino acids 22-1 18 of SEQ ID NO: l and another portion of ALKl .
  • the antibody binds to a polypeptide consisting of amino acids 22-1 18 of SEQ ID NO: l and inhibits the binding of at least one ALKl ligand selected from the group consisting of: GDF5, GDF6, GDF7, BMP9 and BMP 10.
  • the antibody binds to the ALKl polypeptide with a KD of less than 5 x 10 "8 M, and optionally between 5 x 10 "8 M and 1 x 10 "10 M.
  • the antibody inhibits angiogenesis stimulated by at least one ALKl ligand selected from the group consisting of: GDF5, GDF6 and GDF7.
  • an antibody that selectively inhibits signaling mediated by GDF5, GDF6 or GDF7 relative to signaling by BMP9 or BMP 10 is used as a selective inhibitor of angiogenesis that occurs in tissues where GDF5, GDF6 or GDF7 are localized: primarily bone or joints.
  • the antibody binds to ALKl polypeptide with a KD of less than 1 x 10 "10 M.
  • the antibody inhibits the binding of ALKl to an ALKl ligand, wherein the ALKl ligand is selected from the group consisting of: BMP9 and BMP 10.
  • the anti-ALKl antibody may be delivered locally or systemically (e.g., intravenously, intraarterially or subcutaneously).
  • the disclosure provides a method for treating advanced renal cell carcinoma of a mammal by administering an anti-ALKl antibody.
  • the disclosure provides a method for treating a mammal having renal cell carcinoma by administering an anti-ALKl antibody and a VEGF receptor tyrosine kinase inhibitor as described herein.
  • the disclosure provides a method for treating a mammal having clear cell renal cell carcinoma by administering an anti-ALKl antibody and a VEGF receptor tyrosine kinase inhibitor to a mammal having RCC.
  • the RCC is a clear cell renal cell carcinoma.
  • the RCC 1 . to be treated has invaded the renal sinus.
  • the RCC is a TNM stage III disease.
  • the RCC is a TNM stage IV disease.
  • the RCC is found within the intrarenal veins. In further aspects, the RCC has metastasized to the adrenal gland or to a lymph node. In further aspects, the RCC has metastasized to the lung, intra-abdominal lymph nodes, bone, brain, or liver.
  • a neutralizing anti- BMP9 antibody inhibits angiogenesis in vivo.
  • BMP- 10 stimulates angiogenesis while an antagonist of BMP- 10 inhibits angiogenesis.
  • the antibody may bind to the ALKl ligand with a KD of less than 1 x 10 "10 M.
  • Such antibodies are preferably recombinant antibodies, and may be formulated as a pharmaceutical preparation that is substantially pyrogen free.
  • the pharmaceutical preparation may be prepared for systemic delivery (e.g., intravenous, intraarterial or subcutaneous delivery) or local delivery.
  • the disclosure provides methods for treating renal cell carcinoma in a mammal, the method comprising, administering to the mamma! an effective amount of a receptor tyrosine kinase inhibitor (RTKI) and an antibody that binds to an ALKl ligand and inhibits the binding of the ALKl ligand to ALKl, wherein the ALKl ligand is selected from the group consisting of GDF5, GDF6, GDF7, BMP9 and BMP 10.
  • the antibody may inhibit angiogenesis stimulated by at least one ALKl ligand selected from the group consisting of: GDF5, GDF6 and GDF7.
  • the treated renal cell carcinoma has metastasized to a lymph node.
  • the treated renal cell carcinoma is clear cell renal cell carcinoma.
  • the disclosure provides methods for treating renal cell carcinoma in a mammal by administering to a mammal having RCC an effective amount of a VEGF receptor tyrosine kinase inhibitor and an inhibitor of the ALKl signaling system, including but not limited to, nucleic acids (e.g., antisense or RNAi constructs) that decrease the production of ALKl , GDF5, GDF6, GDF7, BMP9 or BMP10.
  • nucleic acids e.g., antisense or RNAi constructs
  • the RCC to be treated has invaded the renal sinus.
  • the RCC is a TNM stage III disease.
  • the RCC is a TNM stage IV disease.
  • the RCC is found within the intrarenal veins.
  • the RCC has metastasized to the adrenal gland or to a lymph node. In further aspects, the RCC has metastasized to the lung, intra-abdominal lymph nodes, bone, brain, or liver.
  • inhibitors of ALKl signaling include but are not limited to, affinity binding reagents such as aptamers, random peptides, and protein scaffolds that can be modified to allow binding to selected targets (examples of such scaffolds include anticalins and FNIII domains). These binding reagents can be used to identify and select affinity binding reagents that disrupt the ALKl regulatory system, either by disrupting the ALKl -ligand interaction or by inhibiting the signaling that occurs after binding.
  • the RCC treated according to this method is a clear cell renal cell carcinoma.
  • the RCC to be treated has invaded the renal sinus.
  • the RCC is a TNM stage III disease.
  • the RCC is a TNM stage IV disease.
  • the RCC is found within the intrarenal veins.
  • the RCC has metastasized to the adrenal gland or to a lymph node.
  • the RCC has metastasized to the lung, intra-abdominal lymph nodes, bone, brain, or liver.
  • a method of treating renal cell carcinoma in a mammal comprises administering to a mammal having RCC an effective amount of an antagonist of BMP9 and/or BMP 10 and a VEGF receptor tyrosine kinase inhibitor.
  • the antagonist is an antibody that binds to BMP9 and/or BMP 10.
  • the antibody can be a polyclonal, monoclonal, and chimeric or a humanized antibody.
  • the antagonist can be an Fd, Fv, Fab, F(ab'), F(ab) 2 , or F(ab') 2 fragment, single chain Fv (scFv), diabody, triabody, tetrabody, minibody or a peptibody.
  • the antagonist is an aptamer (peptide or nucleic acid).
  • an ALKl antagonist that binds both BMP9 and BMP10 is an ALKl -Fc fusion protein which binds to both BMP9 and BMP 10 and inhibits the activities of both ligands.
  • the method further comprises administering to the mammal an effective amount of an mTOR-targeted inhibitor.
  • the antagonist inhibits BMP9 and/or BMP10 expression.
  • the antagonist is a nucleic acid that inhibits BMP9 and/or BMP10 expression.
  • the nucleic acid is an antisense or RNAi nucleic acid.
  • the antagonist is a protein other than an antibody, that binds to BMP9 and/or BMP10.
  • the antagonist is a member of a GDF Trap family.
  • GDF Trap family include, but are not limited to, follistatin, FLRG, noggin and gremlin.
  • the antagonist is a polypeptide that comprises an amino acid sequence selected from a library of amino acid sequences by a method that includes a step that detects amino acid sequences that bind to BMP9 and BMP10.
  • the disclosure provides a method for treating metastatic renal cell carcinoma in a mammal.
  • a method may comprise administering to a mammal that has metastatic renal cell carcinoma an effective amount of an RTKI and an agent selected from the group consisting of: an ALKl ECD protein; an antibody that binds to an ALKl ligand and inhibits the binding of the ALKl ligand to ALKl , wherein the ALKl ligand is selected from the group consisting of GDF5, GDF6, GDF7, BMP9 and BMP10; an antibody that binds to an ALKl polypeptide consisting of amino acids 22-1 18 of SEQ ID NO: l and inhibits the binding of at least one ALKl ligand selected from the group consisting of: GDF5, GDF6, GDF7, BMP9 and BMPIO.
  • an agent described herein may be administered in conjunction with an additional agent that inhibits angiogenesis.
  • the invention provides methods for inhibiting angiogenesis in a mammal comprising administering to a mammal in need thereof, an effective amount of an inhibitor of the ALK1 signaling system (e.g., ALKl-Fc).
  • an inhibitor of the ALK1 signaling system e.g., ALKl-Fc
  • the agent is optionally administered in conjunction with a second agent that has an anti-cancer effect, such as a chemotherapeutic agent or a biologic anti-cancer agent.
  • the agent is administered with an MTOR (mammalian target of rapamycin) inhibitor.
  • the methods of the invention are used to treat and angiogenesis related disease selected from the group consisting of a tumor, a tumor that is resistant to anti-VEGF therapy, a multiple myeloma tumor, and a tumor that has metastasized to the lung, intra-abdominal lymph nodes, bone, brain, or liver.
  • Figure 1 shows the amino acid sequence for the human Activin Like Kinase 1,
  • ALK1 (SEQ ID NO:l). Single underlining shows the predicted extracellular domain.
  • Double underlining shows the intracellular domain.
  • the signal peptide and the transmembrane domain are not underlined.
  • Figure 2 shows the nucleic acid sequence of a human ALK1 cDNA (SEQ ID NO:
  • the coding sequence is underlined.
  • the portion encoding the extracellular domain is double underlined.
  • Figures 3A and 3B show examples of fusions of the extracellular domain of human ALK1 to an Fc domain (SEQ ID NO:3) and (SEQ ID NO: 14).
  • the hALKl-Fc protein includes amino acids 22-120 of the human ALK1 protein, fused at the C-terminus to a linker (underlined) and an IgGl Fc region.
  • Figure 4 shows the nucleic acid sequence for expression of the hALKl-Fc polypeptide of SEQ ID NO:3.
  • the encoded amino acid sequence is also shown.
  • the leader sequence is cleaved such that Asp 22 is the N-terminal amino acid of the secreted protein.
  • Figure 5 shows the anti-angiogenic effect of murine ALKl-Fc (“RAP”) and human ALKl-Fc (“ACE”) in an endothelial cell tube forming assay. All concentrations of RAP and ACE reduced the level of tube formation in response to Endothelial Cell Growth Supplement (ECGF) to a greater degree than the positive control, Endostatin.
  • Figure 6 shows the angiogenic effect of GDF7 in a chick chorioallantoic membrane (CAM) assay. The GDF7 effect is comparable to thai of VEGF.
  • Figure 7 shows the anti-angiogenic effect of the human AL l-Fc fusion in the
  • liALKl-Fc inhibits angiogenesis stimulated by VEGF, FGF and GDF7.
  • Figure 8 shows comparative anti-angiogenic effects of murine ALKl -Fc
  • mALKl -Fc mALKl -Fc
  • hALKl-Fc a commercially available anti-ALKl monoclonal antibody
  • Anti-ALKl mAb a commercially available anti-VEGF monoclonal antibody
  • the anti-angiogenic effect of the ALKl -Fc constructs is comparable to the effects of the anti-VEGF antibody.
  • Figure 9 shows the anti-angiogenic effects of hALKl -Fc and the anti-VEGF antibody in vivo, hALKl -Fc and anti-VEGF had comparable effects on angiogenesis in the eye as measured by the mouse corneal mieropocket assay.
  • Figure 10 shows the effects of mALKl-Fc in the murine collagen-induced arthritis
  • CIA CIA model of rheumatoid arthritis.
  • the graph shows mean group arthritic scores determined during the 42 day observation period in the collagen-induced male DB /1 arthritic mice.
  • RAP-041 is mALKl-Fc
  • Avastin 3 *1 is the anti-VEGF antibody bevacizumab.
  • Figure 11 shows resolution of hALKl -Fc (SEQ ID NO: 3) and an hALKl -Fc fusion protein from R&D Systems (Minneapolis, MN) by Superose 12 10/300 GL Size Exclusion column (Amersham Biosciences, Piscataway, NJ), The .
  • R&D Systems material contains approximately 13% aggregated protein, as shown by the peaks on the left hand side of the graph, as well as some lower molecular weight species.
  • the material of SEQ ID NO:3 is greater than 99% composed of dimers of the appropriate molecular size
  • Figure 12 shows fluorescent signal from luciferase-expressing Lewis lung cancer
  • Figure 13 shows the effect of recombinant human BMP9 (“rhB9”) and a commercially available anti-BMP9 monoclonal antibody (“mabB9”) on VEGF-mediated angiogenesis in the CAM assay. Intriguingly, both BMP9 and anti-BMP9 treatment inhibit VEGF-mediated angiogenesis.
  • rhB9 recombinant human BMP9
  • mabB9 anti-BMP9 monoclonal antibody
  • Figure 14 shows the effects of mALKl-Fc on an orthotopic xenograft model using the MDA-MB-231 cell line, a cell line derived from ER- breast cancer cells.
  • the mALKl-Fc has a significant growth-delaying effect on the xenograft tumor.
  • Figure 1 5 shows the effects of hALKI-Fc on an orthotopic xenograft model using the MCF7 cell line, a cell line derived from estrogen receptor positive (ER+) breast cancer cells.
  • the hALKI-Fc has a significant growth- delaying effect on the xenograft tumor.
  • Figure 16 shows the ability of hALKI-Fc to inhibit by more than 80% the transcriptional reporter activity induced by BMP 10 in a cell-based assay.
  • Figure 17 shows an alignment of the mature portions of the human BMP9 (SEQ ID NO: 1
  • Figure 18 shows the ability of hALKI-Fc to enhance tumor growth inhibition by sunitinib in a 786-0 human RCC xenograft model. hALKI-Fc additional trended toward inhibiting tumor growth as a single agent.
  • Figure 19 shows the ability of hALKI-Fc to inhibit tumor growth as a single agent in an A498 human RCC xenograft model.
  • Figure 20 shows the ability of hALKI-Fc to enhance tumor growth inhibition by sunitinib in an A498 human RCC xenograft model .
  • Renal cell carcinoma is the most common type of kidney cancer in adults and arises when cancer cells form in the lining of tubules in the kidney.
  • RCC is characterized by a lack of early warning signs, diverse clinical manifestations and resistance to chemotherapy and radiation.
  • Most RCC tumors present in patients between 50 and 70 years of age and the incidence of the disease is two to three times higher in men.
  • Certain genetic conditions are associated with an increased incidence of RCC including von Hippel-Lindau (VHL) syndrome, hereditary papillary renal carcinoma, familial renal oncocytoma associated with Birt-Hogg-Dube syndrome and hereditary renal carcinoma.
  • VHL von Hippel-Lindau
  • hereditary papillary renal carcinoma familial renal oncocytoma associated with Birt-Hogg-Dube syndrome
  • hereditary renal carcinoma 30% of patients present at advance stages of RCC, having either metastatic or unresectable disease, and the 2-year overall survival of this cohort is ⁇ 10%. Reeves et al, Cancer Chem
  • RCC Radiotherapy
  • papillary type I and type II
  • chromophobe collecting duct
  • unclassified RCC unclassified RCC
  • anatomical criteria has been traditionally used to differentiate the distinct stages of RCC.
  • the tumor, nodes and metastases (TMN) classification system is based on the primary size of the tumor, the degree of tumor spread to the lymph nodes, and the presence of metastasis to differentiate the stages of RCC.
  • Tumor stage is the most important factor predictive of survival in RCC. Koul et al, Am. J. Cancer Research 2011; l(2):240-254. More than 50% of patients with early stage RCC are cured.
  • nephrectomy is also indicated to treat locally advanced RCC and metastatic RCC. 23%) of patients with clinically localized disease develop metastatic disease after nephrectomy.
  • stage III and stage IV diseases which are characterized by for example, the presence of the tumor in the major veins or adrenal gland, or lymph node involvement (stage III) and the presence of disease outside of the kidney (IV).
  • Clear cell renal cell carcinoma typically arises within the renal cortex from epithelial cells of the proximal convoluted tubules of the nephron and tends to spread through vascular invasion, with malignant cells found within intrarenal veins in 18-29% of organ-confined tumors. Delahunt et al, Clin. Lab. Med. 2005; 25(2):231-46; and Bonsib et al, Mod. Pathol. 2006; 19(5):746-53. Extensive pathologic examinations of 120 clear cell renal cell carcinomas have indicated renal sinus invasion in approximately half of the tumors studied.
  • RCC most commonly metastasizes to the lung (33-72%), intraabdominal lymph nodes (3-35%), bone (21-25%), brain (7-13%) and liver (5-10%). See, e.g., Klatte et al, Urol. Oncol. 2008; 26(6):604-9.
  • Small tumors localized to or within the kidney are frequently removed by partial nephrectomy (also known as "nephron-sparing surgery"). Additional surgical procedures for localized tumors include tissue ablation treatments (e.g., cryosurgery and radiofrequency ablation (RFA).
  • RFA radiofrequency ablation
  • nephrectomy i.e., the removal of the entire kidney with or without the nearby adrenal gland and the fatty tissue around the kidney. This surgery is the traditional standard intervention for kidney cancer. Under certain circumstances radical nephrectomy is also indicated to treat locally advanced RCC and metastatic RCC. 23% of patients with clinically localized disease develop metastatic disease after nephrectomy. Koul et al, Am J Cancer Research 2011; l(2):240-254.
  • Immunotherapy with immunostimulatory cytokines such as interleukin-2 (IL-2) and interferon-a (IFN-a) is the mainstay systematic therapy for RCC.
  • IL-2 interleukin-2
  • IFN-a interferon-a
  • High-dose intravenous IL-2 has been reported to produce a 15-20% response rate, 6-8% complete remission rate, and approximately 5% cure rate.
  • Koul et al Am J Cancer Research 2011; l(2):240-254.
  • the regime is fairly toxic.
  • IFN-a produced a more modest survival benefit but has a more favorable toxicity profile
  • ALK1 is a type I cell-surface receptor for the TGF- ⁇ superfamily of ligands and is also known as ACVRL1 and ACVRLK1.
  • ALK1 has been implicated as a receptor for TGF- ⁇ , TGF-p3 and BMP-9 (Marchuk et al, 2003; Hum. Mol. Genet. 12:R97-R112 and Brown et al, 2005; J. Biol. Chem. 280(26):251 1 1-8).
  • mice loss-of-function mutations in ALK1 lead to a variety of abnormalities in the developing vasculature (Oh et al, 2000; Proc. Natl. Acad. Sci. USA 97:2626-31 and Urness et al, 2000; Nat. Genet. 26:328-31).
  • HHT hereditary hemorrhagic telangiectasia
  • Typical symptoms of patients with HHT include recurrent epistaxis, gastrointestinal hemorrhage, cutaneous and mucocutaneous telangiectases, and arteriovenous malformations (AVM) in the pulmonary, cerebral, or hepatic vasculature.
  • ALM arteriovenous malformations
  • the disclosure relates to the discovery that polypeptides comprising a portion of the extracellular domain of ALKl (“ALKl ECD polypeptides”) can inhibit RCC cancer growth in vivo. More particularly, as discussed below, the disclosure describes the use of ALKl ECD antagonists to demonstrate the involvement of ALKl in influencing both VEGF-independent angiogenesis and angiogenesis that is mediated by multiple angiogenic factors, including VEGF, FGF and PDGF.
  • the disclosure also relates to the surprising discovery that ALKl ECD antagonists, such as ALKl-Fc are able to inhibit RCC tumor growth in a human RCC xenograft model in vivo and also to dramatically improve tumor inhibiting activity of the sunitinib in human RCC xenograft models.
  • ALKl ECD antagonists such as ALKl-Fc are able to inhibit RCC tumor growth in a human RCC xenograft model in vivo and also to dramatically improve tumor inhibiting activity of the sunitinib in human RCC xenograft models.
  • the disclosure additionally relates to the discovery that polypeptides comprising a portion of the extracellular domain of ALKl (“ALKl ECD polypeptides”) may be used to inhibit angiogenesis in vivo, including both VEGF-independent angiogenesis and angiogenesis that is mediated by multiple angiogenic factors, including VEGF, FGF and PDGF.
  • ALKl ECD polypeptides may be used to inhibit angiogenesis in vivo, including both VEGF-independent angiogenesis and angiogenesis that is mediated by multiple angiogenic factors, including VEGF, FGF and PDGF.
  • the disclosure also relates to the discovery that polypeptides comprising a portion of the extracellular domain of ALKl (“ALKl ECD polypeptides”) may be used to inhibit angiogenesis in vivo, including VEGF-independent angiogenesis and angiogenesis that is mediated by multiple angiogenic factors, including VEGF, FGF and PDGF.
  • ALKl ECD polypeptides may be used to inhibit angiogenesis in vivo, including VEGF-independent angiogenesis and angiogenesis that is mediated by multiple angiogenic factors, including VEGF, FGF and PDGF.
  • ALKl ECD polypeptides may be used to inhibit angiogenesis in vivo, including VEGF-independent angiogenesis and angiogenesis that is mediated by multiple angiogenic factors, including VEGF, FGF and PDGF.
  • the disclosure provides the identity of physiological, high affinity ligands for ALKl and demonstrates that ALKl ECD polypeptides inhibit angiogenesis.
  • the disclosure provides the identity of physiological, high affinity ligands for ALKl and demonstrates that ALKl ECD polypeptides inhibit angiogenesis.
  • the data presented herein demonstrate that an ALKl ECD polypeptide can exert an anti- angiogenic effect even in situations where the ALKl ECD polypeptide does not exhibit meaningful binding to TGF- ⁇ .
  • ALKl ECD polypeptides inhibit angiogenesis that is stimulated by many different pro-angiogenic factors, including VEGF, FGF, and GDF7.
  • the disclosure provides a description of an ALKl regulatory system, in which ALKl is a receptor for the GDF5 group of ligands, which includes GDF6 and GDF7, and also for the BMP9 group of ligands, which includes BMP 10, with different affinities for the two groups of ligands. Further, the disclosure demonstrates that signaling mediated by ALKl and the ligands described above is pro-angiogenic in vivo, and that inhibition of this regulatory system has a potent anti-angiogenic effect in vivo.
  • the disclosure provides antagonists of the ALKl regulatory system, including antagonists of the ALKl receptor or one or more of the ALKl ligands, for use in inhibiting angiogenesis, including both VEGF-dependent angiogenesis and VEGF-independent angiogenesis.
  • antagonists of the ALKl regulatory system including antagonists of the ALKl receptor or one or more of the ALKl ligands, for use in inhibiting angiogenesis, including both VEGF-dependent angiogenesis and VEGF-independent angiogenesis.
  • antibodies directed to ALKl itself are expected to have different effects from an ALKl ECD polypeptide.
  • a pan-neutralizing antibody against ALKl (one that inhibits the binding of all strong and weak ligands) would be expected to inhibit the signaling of such ligands through ALKl but would not be expected to inhibit the ability of such ligands to signal through other receptors ⁇ e.g., BMPRla, BMPRlb, BMPRII in the case of GDF5-7 and BMP9-10 and TBRI and TBRII in the case of TGF ).
  • an ALKl ECD polypeptide would be expected to inhibit all of the ligands that it binds to tightly, including, for example, a construct such as that shown in the Examples, GDF5-7 and BMP9-10, but would not affect ligands that it binds to weakly, such as TGF- ⁇ . So, while a pan-neutralizing antibody against ALKl would block BMP9 and TGF- ⁇ signaling through ALKl the antibody would not block BMP9 and TGF- ⁇ signaling through another receptor, and while an ALKl ECD polypeptide may inhibit BMP9 signaling through all receptors (even receptors other than ALKl) it would not be expected to inhibit TGF- ⁇ signaling through any receptor, even ALKl.
  • Naturally occurring ALK1 proteins are transmembrane proteins, with a portion of the protein positioned outside the cell (the extracelluar portion) and a portion of the protein positioned inside the cell (the intracellular portion). Aspects of the present disclosure encompass polypeptides comprising a portion of the extracellular domain of ALK1.
  • the disclosure provides "ALK1 ECD polypeptides".
  • ALK1 ECD polypeptide is intended to refer to a polypeptide consisting of or comprising an amino acid sequence of an extracellular domain of a naturally occurring ALK1 polypeptide, either including or excluding any signal sequence and sequence N- terminal to the signal sequence, or an amino acid sequence that is at least 33 percent identical to an extracellular domain of a naturally occurring ALK1 polypeptide, and optionally at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or 100% identical to the sequence of an extracellular domain of a naturally occurring ALK1 polypeptide, as exemplified by the cysteine knot region of amino acids 34-95 of SEQ ID NO:l or the cysteine knot plus additional amino acids at the N- and C-termini of the extracellular domain, such as amino acids 22-118 or 22-120 of S
  • an ALK1 ECD polypeptide may comprise a polypeptide that is encoded by nucleotides 100-285 of SEQ ID NO:2, or silent variants thereof or nucleic acids that hybridize to the complement thereof under stringent hybridization conditions (generally, such conditions are known in the art but may, for example, involve hybridization in 50% v/v formamide, 5x SSC, 2% w/v blocking agent, 0.1% N-lauroylsarcosine, 0.3% SDS at 65°C overnight and washing in, for example, 5xSSC at about 65°C).
  • an ALK1 ECD polypeptide may comprise a polypeptide that is encoded by nucleotides 64- 384 of SEQ ID NO:2, or silent variants thereof or nucleic acids that hybridize to the complement thereof under stringent hybridization conditions (generally, such conditions are known in the art but may, for example, involve hybridization in 50% v/v formamide, 5x SSC, 2% w/v blocking agent, 0.1% N-lauroylsarcosine, 0.3% SDS at 65°C overnight and washing in, for example, 5xSSC at about 65°C).
  • ALK1 ECD polypeptide accordingly encompasses isolated extracellular portions of ALKl polypeptides, variants thereof (including variants that comprise, for example, no more than 2, 3, 4, 5 or 10 amino acid substitutions, additions or deletions in the sequence corresponding to amino acids 22-1 18 or 22-120 of SEQ ID NO: l and including variants that comprise no more than 2, 3, 4, 5, or 10 amino acid substitutions, additions or deletions in the sequence corresponding to amino acids 34-95 of SEQ ID NO: l), fragments thereof and fusion proteins comprising any of the preceding, but in each case preferably any of the foregoing ALKl ECD polypeptides will retain substantial affinity for one or more of GDF5, GDF6, GDF7, BMP9 or BMP10.
  • ALKl ECD polypeptide is explicitly intended to exclude any full-length, naturally occurring ALKl polypeptide. Generally, an ALKl ECD polypeptide will be designed to be soluble in aqueous solutions at biologically relevant temperatures, pH levels and osmolarity.
  • the disclosure provides ALKl ECD polypeptides sharing a specified degree of sequence identity or similarity to a naturally occurring ALKl polypeptide.
  • the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes).
  • the amino acid residues at corresponding amino acid positions are then compared. When a position in the first sequence is occupied by the same amino acid residue as the corresponding position in the second sequence, then the molecules are identical at that position (as used herein amino acid "identity" is equivalent to amino acid "homology”).
  • the percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences.
  • the percent identity between two amino acid sequences is determined using the Needleman and Wunsch (J. Mol. Biol. 1970; (48):444-453) algorithm which has been incorporated into the GAP program in the GCG software package (available at http://www.gcg.com).
  • the following parameters are used in the GAP program: either a Blosum 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or 6.
  • the percent identity between two nucleotide sequences is determined using the GAP program in the GCG software package (Devereux et al., Nucleic Acids Res.
  • Exemplary parameters include using a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80 and a length weight of 1, 2, 3, 4, 5, or 6. Unless otherwise specified, percent identity between two amino acid sequences is to be determined using the GAP program using a Blosum 62 matrix, a GAP weight of 10 and a length weight of 3, and if such algorithm cannot compute the desired percent identity, a suitable alternative disclosed herein should be selected.
  • the percent identity between two amino acid sequences is determined using the algorithm of E. Myers and W. Miller (CABIOS, 1989; 4:11-17) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
  • Another embodiment for determining the best overall alignment between two amino acid sequences can be determined using the FASTDB computer program based on the algorithm of Brutlag et al, (Comp. App. Biosci., 1990;6:237-245).
  • sequence alignment the query and subject sequences are both amino acid sequences.
  • the result of said global sequence alignment is presented in terms of percent identity.
  • amino acid sequence identity is performed using the FASTDB computer program based on the algorithm of Brutlag et al, (Comp. App. Biosci., 1990;6:237-245).
  • ALKl ECD polypeptides comprise an extracellular portion of a naturally occurring ALKl protein such as a sequence of SEQ ID NO:l, and preferably a ligand binding portion of the ALKl extracellular domain.
  • a soluble ALKl ECD polypeptide comprises an amino acid sequence that is at least 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence of amino acids 22-1 18 or 22-120 of the SEQ ID NO: l .
  • a truncated extracellular ALKl polypeptide comprises at least 30, 40 or 50 consecutive amino acids of an amino acid sequence of an extracellular portion of SEQ ID NO: 1.
  • an ALKl ECD polypeptide binds to one or more of
  • the ALKl polypeptide does not show substantial binding to TGF- ⁇ or TGF-P3. Binding may be assessed using purified proteins in solution or in a surface plasmon resonance system, such as a BiacoreTM system. Preferred soluble ALKl polypeptides will exhibit an anti-angiogenic activity.
  • Bioassays for angiogenesis inhibitory activity include the chick chorioallantoic membrane (CAM) assay, the mouse corneal micropocket assay, or an assay known in the art for measuring the effect of administering isolated or synthesized proteins on implanted tumors.
  • the CAM assay is described by O'Reilly, et ah, in "Angiogenic Regulation of Metastatic Growth” Cell, 1994;79 (2):315-328. Briefly, 3 day old chicken embryos with intact yolks are separated from the egg and placed in a petri dish. After 3 days of incubation, a methyl cellulose disc containing the protein to be tested is applied to the CAM of individual embryos. After 48 hours of incubation, the embryos and CAMs are observed to determine whether endothelial growth has been inhibited.
  • the mouse corneal micropocket assay involves implanting a growth factor-containing pellet, along with another pellet containing the suspected endothelial growth inhibitor, in the cornea of a mouse and observing the pattern of capillaries that are elaborated in the cornea. Other assays are described in the Examples.
  • ALKl ECD polypeptides may be produced by removing the cytoplasmic tail and the transmembrane region of an ALKl ECD polypeptide.
  • the transmembrane domain may be inactivated by deletion, or by substitution of the normally hydrophobic amino acid residues which comprise a transmembrane domain with hydrophilic ones. In either case, a substantially hydrophilic hydropathy profile is created which will reduce lipid affinity and improve aqueous solubility. Deletion of the transmembrane domain is preferred over substitution with hydrophilic amino acid residues because it avoids introducing potentially immunogenic epitopes.
  • ALKl ECD polypeptides may additionally include any of various leader sequences at the N-terminus. Such a sequence would allow the peptides to be expressed and targeted to the secretion pathway in a eukaryotic system. See, e.g., Ernst et al, U.S. Pat. No. 5,082,783. Alternatively, a native ALKl signal sequence may be used to effect extrusion from the cell. Possible leader sequences include native, tPa and honeybee mellitin leaders (SEQ ID Nos. 7-9, respectively).
  • Processing of signal peptides may vary depending on the leader sequence chosen, the cell type used and culture conditions, among other variables, and therefore actual N-terminal start sites for mature ALKl ECD polypeptides, including that of SEQ ID O:5, may shift by 1 -5 amino acids in either the N-terminal or C-terminal direction.
  • the present disclosure contemplates specific mutations of the ALKl polypeptides so as to alter the glycosylation of the polypeptide.
  • Such mutations may be selected so as to introduce or eliminate one or more glycosylation sites, such as O-linked or N-linked glycosylation sites.
  • Asparagine-linked glycosylation recognition sites generally comprise a tripeptide sequence, asparagine-X-threonine (or asparagines-X- serine) (where "X" is any amino acid) which is specifically recognized by appropriate cellular glycosylation enzymes.
  • the alteration may also be made by the addition of, or substitution by, one or more serine or threonine residues to the sequence of the wild-type ALKl polypeptide (for O-linked glycosylation sites).
  • a variety of amino acid substitutions or deletions at one or both of the first or third amino acid positions of a glycosylation recognition site (and/or amino acid deletion at the second position) results in non-glycosylation at the modified tripeptide sequence.
  • Another means of increasing the number of carbohydrate moieties on an ALKl polypeptide is by chemical or enzymatic coupling of glycosides to the ALKl polypeptide.
  • the sugar(s) may be attached to (a) arginine and histidine; (b) free carboxyl groups; (c) free sulfhydryl groups such as those of cysteine; (d) free hydroxyl groups such as those of serine, threonine, or hydroxyproline; (e) aromatic residues such as those of phenylalanine, tyrosine, or tryptophan; or (f) the amide group of glutamine.
  • Removal of one or more carbohydrate moieties present on an ALKl polypeptide may be accomplished chemically and/or enzymatically.
  • Chemical deglycosylation may involve, for example, exposure of the ALKl polypeptide to the compound trifluoromethanesulfonic acid, or an equivalent compound. This treatment results in the cleavage of most or all sugars except the linking sugar (N-acetylglucosamine or N-acetylgalactosamine), while leaving the amino acid sequence intact.
  • Chemical deglycosylation is further described by Hakimuddin et al, (1987) Arch. Biochem. Biophys. 259:52 and by Edge et al, Anal. Biochem. 1981 ; 118:131.
  • Enzymatic cleavage of carbohydrate moieties on ALKl polypeptides can be achieved by the use of a variety of endo- and exo-glycosidases as described by Thotakura et al, (1987) Meth. Enzymol. 138:350.
  • the sequence of an ALKl polypeptide may be adjusted, as appropriate, depending on the type of expression system used, as mammalian, yeast, insect and plant cells may all introduce differing glycosylation patterns that can be affected by the amino acid sequence of the peptide.
  • ALKl proteins for use in humans will be expressed in a mammalian cell line that provides proper glycosylation, such as HEK293 or CHO cell lines, although other mammalian expression cell lines, yeast cell lines with engineered glycosylation enzymes and insect cells are expected to be useful as well.
  • This disclosure further contemplates a method of generating mutants, particularly sets of combinatorial mutants of an ALKl polypeptide, as well as truncation mutants; pools of combinatorial mutants are especially useful for identifying functional variant sequences.
  • the purpose of screening such combinatorial libraries may be to generate, for example, ALKl polypeptide variants which can act as either agonists or antagonist, or alternatively, which possess novel activities altogether.
  • a variety of screening assays are provided below, and such assays may be used to evaluate variants.
  • an ALKl polypeptide variant may be screened for ability to bind to an ALKl ligand, to prevent binding of an ALKl ligand to an ALKl polypeptide or to interfere with signaling caused by an ALKl ligand.
  • the activity of an ALKl polypeptide or its variants may also be tested in a cell-based or in vivo assay, particularly any of the assays disclosed in the Examples.
  • Combinatorially-derived variants can be generated which have a selective or generally increased potency relative to an ALKl ECD polypeptide comprising an extracellular domain of a naturally occurring ALKl polypeptide.
  • mutagenesis can give rise to variants which have serum half-lives dramatically different than the corresponding wild-type ALKl BCD polypeptide.
  • the altered protein can be rendered either more stable or less stable to proteolytic degradation or other processes which result in destruction of, or otherwise elimination or inactivation of a native ALKl ECD polypeptide.
  • Such variants, and the genes which encode them can be utilized to alter ALKl ECD polypeptide levels by modulating the half-life of the ALKl polypeptides.
  • a short half-life can give rise to more transient biological effects and can allow tighter control of recombinant ALKl ECD polypeptide levels within the patient, in an Fc fusion protein, mutations may be made in the linker (if any) and/or the Fc portion to alter the half-life of the protein.
  • a combinatorial library may be produced by way of a degenerate library of genes encoding a library of polypeptides which each include at least a portion of potential ALKl polypeptide sequences.
  • a mixture of synthetic oligonucleotides can be enzymatically ligated into gene sequences such that the degenerate set of potential ALKl polypeptide nucleotide sequences are expressible as individual polypeptides, or alternatively, as a set of larger fusion proteins (e.g., for phage display).
  • the library of potential ALKl ECD variants can be generated from a degenerate oligonucleotide sequence.
  • Chemical synthesis of a degenerate gene sequence can be carried out in an automatic DNA synthesizer, and the synthetic genes then be ligated into an appropriate vector for expression.
  • the synthesis of degenerate oligonucleotides is well known in the art (see for example, Narang, SA Tetrahedron 1983;39:3; Itakura et al, Recombinant DNA, Proc. 3rd Cleveland Sympos. Macromolecules, ed. AG Walton, Amsterdam: Elsevier pp273-289; Itakura et al, (1984) Annu. Rev.
  • ALKl polypeptide variants can be generated and isolated from a library by screening using, for example, alanine scanning mutagenesis and the like (Ruf et al, Biochemistry 1994; 33:1565-1572; Wang et al, J. Biol. Chem. 1994; 269:3095-3099; Balint et al, Gene 1993; 137: 109-118; Grodberg et al, (1993) Eur. J. Biochem. 218:597-601 ; Nagashima et al, J. Biol. Chem.
  • a wide range of techniques are known in the art for screening gene products of combinatorial libraries made by point mutations and truncations, and, for that matter, for screening cDNA libraries for gene products having a certain property. Such techniques will be generally adaptable for rapid screening of the gene libraries generated by the combinatorial mutagenesis of ALK1 polypeptides.
  • the most widely used techniques for screening large gene libraries typically comprises cloning the gene library into replicable expression vectors, transforming appropriate cells with the resulting library of vectors, and expressing the combinatorial genes under conditions in which detection of a desired activity facilitates relatively easy isolation of the vector encoding the gene whose product was detected.
  • Preferred assays include ALK1 ligand binding assays and ligand-mediated cell signaling assays.
  • the ALK1 ECD polypeptides may further comprise post- translational modifications in addition to any that are naturally present in the ALK1 polypeptides.
  • modifications include, but are not limited to, acetylation, carboxylation, glycosylation, phosphorylation, lipidation, and acylation.
  • the modified ALK1 ECD polypeptides may contain non-amino acid elements, such as polyethylene glycols, lipids, poly- or mono-saccharide, and phosphates. Effects of such non-amino acid elements on the functionality of an ALK1 ECD polypeptide may be tested as described herein for other ALK1 ECD polypeptide variants.
  • an ALK1 ECD polypeptide When an ALK1 ECD polypeptide is produced in cells by cleaving a nascent form of the ALK1 polypeptide, post-translational processing may also be important for correct folding and/or function of the protein.
  • Different cells such as CHO, HeLa, MDCK, 293, WI38, NIH-3T3 or HEK293 have specific cellular machinery and characteristic mechanisms for such post-translational activities and may be chosen to ensure the correct modification and processing of the ALK1 polypeptides.
  • functional variants or modified forms of the ALK1 ECD polypeptides include fusion proteins having at least a portion of the ALK1 ECD polypeptides and one or more fusion domains.
  • fusion domains include, but are not limited to, polyhistidine, Glu-Glu, glutathione S transferase (GST), thioredoxin, protein A, protein G, an immunoglobulin heavy chain constant region (Fc), maltose binding protein (MBP), or human serum albumin.
  • GST glutathione S transferase
  • Fc immunoglobulin heavy chain constant region
  • MBP maltose binding protein
  • human serum albumin fusion domain may be selected so as to confer a desired property. For example, some fusion domains are particularly useful for isolation of the fusion proteins by affinity chromatography.
  • relevant matrices for affinity chromatography such as glutathione-, amylase-, and nickel- or cobalt- conjugated resins are used.
  • Many of such matrices are available in "kit” form, such as the Pharmacia GST purification system and the QIAexpressTM system (Qiagen) useful with (HIS 6 ) fusion partners.
  • a fusion domain may be selected so as to facilitate detection of the AL 1 ECD polypeptides.
  • detection domains include the various fluorescent proteins (e.g., GFP) as well as "epitope tags," which are usually short peptide sequences for which a specific antibody is available.
  • epitope tags for which specific monoclonal antibodies are readily available include FLAG, influenza virus haemagglutinin (HA), and c-myc tags.
  • the fusion domains have a protease cleavage site, such as for Factor Xa or Thrombin, which allows the relevant protease to partially digest the fusion proteins and thereby liberate the recombinant proteins therefrom.
  • an ALK1 ECD polypeptide is fused with a domain that stabilizes the ALK1 polypeptide in vivo (a "stabilizer” domain).
  • stabilizing is meant anything that increases serum half life, regardless of whether this is because of decreased destruction, decreased clearance by the kidney, or other pharmacokinetic effect. Fusions with the Fc portion of an immunoglobulin are known to confer desirable pharmacokinetic properties on a wide range of proteins. Likewise, fusions to human serum albumin can confer desirable properties. Other types of fusion domains that may be selected include multimerizing (e.g., dimerizing, tetramerizing) domains and functional domains.
  • the disclosure provides a fusion protein comprising a soluble extracellular domain of ALK1 fused to an Fc domain (e.g., SEQ ID NO: 6).
  • THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD (A) VSHEDPEVKFNWYVDGVEV HNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCK (A) VSNKALPVPIEKTISKAKGQPREP QVYTLPPSREE TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGPFFLYSKLT VDKSRWQQGNVFSCSVMHEALH (A) HYTQKSLSLSPGK*
  • the Fc domain has one or more mutations at residues such as Asp-265, lysine 322, and Asn-434.
  • the mutant Fc domain having one or more of these mutations e.g., Asp-265 mutation
  • the mutant Fc domain having one or more of these mutations has increased ability of binding to the MHC class I-related Fc-receptor (FcRN) relative to a wildtype Fc domain.
  • an ALK1 ECD polypeptide may be placed C-terminal to a heterologous domain, or, alternatively, a heterologous domain may be placed C-terminal to an AL l ECD polypeptide.
  • the ALK1 ECD polypeptide domain and the heterologous domain need not be adjacent in a fusion protein, and additional domains or amino acid sequences may be included C- or N- terminal to either domain or between the domains.
  • an immunoglobulin Fc region or simply “Fc” is understood to mean the carboxyl-terminal portion of an immunoglobulin chain constant region, preferably an immunoglobulin heavy chain constant region, or a portion thereof.
  • an immunoglobulin Fc region may comprise 1) a CHI domain, a CH2 domain, and a CH3 domain, 2) a CHI domain and a CH2 domain, 3) a CHI domain and a CH3 domain, 4) a CH2 domain and a CH3 domain, or 5) a combination of two or more domains and an immunoglobulin hinge region.
  • the immunoglobulin Fc region comprises at least an immunoglobulin hinge region a CH2 domain and a CH3 domain, and preferably lacks the CHI domain.
  • the class of immunoglobulin from which the heavy chain constant region is derived is IgG (Igy) ( ⁇ subclasses 1, 2, 3, or 4).
  • Other classes of immunoglobulin, IgA (Ig ), IgD (Ig5), IgE (Igs) and IgM (3 ⁇ 4 ⁇ ) may be used.
  • IgG immunoglobulin
  • IgA Ig
  • IgD IgD
  • IgE IgE
  • IgM 3 ⁇ 4 ⁇
  • the portion of the DNA construct encoding the immunoglobulin Fc region preferably comprises at least a portion of a hinge domain, and preferably at least a portion of a C3 ⁇ 4 domain of Fc gamma or the homologous domains in any of IgA, IgD, IgE, or IgM.
  • substitution or deletion of amino acids within the immunoglobulin heavy chain constant regions may be useful in the practice of the methods and compositions disclosed herein.
  • One example would be to introduce amino acid substitutions in the upper CH2 region to create an Fc variant with reduced affinity for Fc receptors (Cole et al, (1997) J. Immunol. 159:3613).
  • the present disclosure makes available isolated and/or purified forms of the ALK1 ECD polypeptides, which are isolated from, or otherwise substantially free of (e.g., at least 80%, 90%, 95%, 96%, 97%, 98%, or 99% free of), other proteins and/or other ALK1 ECD polypeptide species.
  • ALK1 ECD polypeptides will generally be produced by expression from recombinant nucleic acids.
  • the disclosure includes nucleic acids encoding soluble amino acids
  • ALK1 polypeptides comprising the coding sequence for an extracellular portion of an ALK1 proteins.
  • this disclosure also pertains to a host cell comprising such nucleic acids.
  • the host cell may be any prokaryotic or eukaryotic cell.
  • a polypeptide of the present disclosure may be expressed in bacterial cells such as E. coli, insect cells (e.g., using a baculovirus expression system), yeast, or mammalian cells. Other suitable host cells are known to those skilled in the art. Accordingly, some embodiments of the present disclosure further pertain to methods of producing the ALK1 ECD polypeptides. Ad demonstrated herein, an ALKl-Fc fusion protein set forth in SEQ ID NO: 14 and expressed in CHO cells has potent anti -angiogenic activity. 3. Nucleic Acids Encoding ALKl Polypeptides
  • the disclosure provides isolated and/or recombinant nucleic acids encoding any of the ALKl polypeptides (e.g., ALKl ECD polypeptides), including fragments, functional variants and fusion proteins disclosed herein.
  • ALKl polypeptides e.g., ALKl ECD polypeptides
  • SEQ ID NO: 2 encodes the naturally occurring human ALKl precursor polypeptide
  • SEQ ID NO: 4 encodes the precursor of an ALKl extracellular domain fused to an IgGl Fc domain.
  • the subject nucleic acids may be single-stranded or double stranded.
  • Such nucleic acids may be DNA or RNA molecules. These nucleic acids may be used, for example, in methods for making ALKl polypeptides or as direct therapeutic agents (e.g., in an antisense, RNAi or gene therapy approach).
  • the subject nucleic acids encoding ALKl polypeptides are further understood to include nucleic acids that are variants of SEQ ID NO: 2 or 4.
  • Variant nucleotide sequences include sequences that differ by one or more nucleotide substitutions, additions or deletions, such as allelic variants.
  • the disclosure provides isolated or recombinant nucleic acid sequences that are at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 2 or 4.
  • nucleic acid sequences complementary to SEQ ID NO: 2 or 4 are also within the scope of this disclosure.
  • nucleic acid sequences of the disclosure can be isolated, recombinant, and/or fused with a heterologous nucleotide sequence, or in a DNA library.
  • nucleic acids of the disclosure also include nucleotide sequences that hybridize under highly stringent conditions to the nucleotide sequence designated in SEQ ID NO: 2 or 4, complement sequence of SEQ ID NO: 2 or 4, or fragments thereof.
  • appropriate stringency conditions which promote DNA hybridization can be varied.
  • appropriate stringency conditions which promote DNA hybridization can be varied. For example, one could perform the hybridization at 6.0 x sodium chloride/sodium citrate (SSC) at about 45 °C, followed by a wash of 2.0 x SSC at 50 °C.
  • SSC sodium chloride/sodium citrate
  • the salt concentration in the wash step can be selected from a low stringency of about 2.0 x SSC at 50 °C to a high stringency of about 0.2 x SSC at 50 °C.
  • the temperature in the wash step can be increased from low stringency conditions at room temperature, about 22 °C, to high stringency conditions at about 65 °C. Both temperature and salt may be varied, or temperature or salt concentration may be held constant while the other variable is changed.
  • the disclosure provides nucleic acids which hybridize under low stringency conditions of 6 x SSC at room temperature followed by a wash at 2 x SSC at room temperature.
  • amino acids are designated by more than one triplet. Codons that specify the same amino acid, or synonyms (for example, CAU and CAC are synonyms for histidine) may result in "silent" mutations which do not affect the amino acid sequence of the protein.
  • CAU and CAC are synonyms for histidine
  • nucleotides up to about 3-5% of the nucleotides
  • nucleic acids encoding a particular protein may exist among individuals of a given species due to natural allelic variation. Any and all such nucleotide variations and resulting amino acid polymorphisms are within the scope of this disclosure.
  • the recombinant nucleic acids of the disclosure may be operably linked to one or more regulatory nucleotide sequences in an expression construct.
  • Regulatory nucleotide sequences will generally be appropriate to the host cell used for expression.
  • suitable regulatory sequences are known in the art for a variety of host cells.
  • said one or more regulatory nucleotide sequences may include, but are not limited to, promoter sequences, leader or signal sequences, ribosomal binding sites, transcriptional start and termination sequences, translational start and termination sequences, and enhancer or activator sequences. Constitutive or inducible promoters as known in the art are contemplated by the disclosure.
  • the promoters may be either naturally occurring promoters, or hybrid promoters that combine elements of more than one promoter.
  • An expression construct may be present in a cell on an episome, such as a plasmid, or the expression construct may be inserted in a chromosome.
  • the expression vector contains a selectable marker gene to allow the selection of transformed host cells. Selectable marker genes are well known in the art and will vary with the host cell used.
  • the subject nucleic acid is provided in an expression vector comprising a nucleotide sequence encoding an ALK1 ECDpolypeptide and operably linked to at least one regulatory sequence.
  • Regulatory sequences are art- recognized and are selected to direct expression of the ALK1 polypeptide.
  • the term regulatory sequence includes promoters, enhancers, and other expression control elements. Exemplary regulatory sequences are described in Goeddel; Gene Expression Technology: Methods in Enzymology, Academic Press, San Diego, CA (1990). For instance, any of a wide variety of expression control sequences that control the expression of a DNA sequence when operatively linked to it may be used in these vectors to express DNA sequences encoding an AL 1 polypeptide.
  • Such useful expression control sequences include, for example, the early and late promoters of SV40, tet promoter, adenovirus or cytomegalovirus immediate early promoter, RSV promoters, the lac system, the trp system, the TAC or TRC system, T7 promoter whose expression is directed by T7 RNA polymerase, the major operator and promoter regions of phage lambda, the control regions for fd coat protein, the promoter for 3-phosphoglycerate kinase or other glycolytic enzymes, the promoters of acid phosphatase, e.g., Pho5, the promoters of the yeast a-mating factors, the polyhedron promoter of the baculovirus system and other sequences known to control the expression of genes of prokaryotic or eukaryotic cells or their viruses, and various combinations thereof.
  • the design of the expression vector may depend on such factors as the choice of the host cell to be transformed and/or the type of protein desired to be expressed. Moreover, the vector's copy number, the ability to control that copy number and the expression of any other protein encoded by the vector, such as antibiotic markers, should also be considered.
  • a recombinant nucleic acid included in the disclosure can be produced by ligating the cloned gene, or a portion thereof, into a vector suitable for expression in either prokaryotic cells, eukaryotic cells (yeast, avian, insect or mammalian), or both.
  • Expression vehicles for production of a recombinant ALK1 polypeptide include plasmids and other vectors.
  • suitable vectors include plasmids of the types: pBR322- derived plasmids, pEMBL-derived plasmids, pEX-derived plasmids, pBTac-derived plasmids and pUC-derived plasmids for expression in prokaryotic cells, such as E. coli.
  • Some mammalian expression vectors contain both prokaryotic sequences to facilitate the propagation of the vector in bacteria, and one or more eukaryotic transcription units that are expressed in eukaryotic cells.
  • the pcDNAI/amp, pcDNAI/neo, pRc/CMV, pSV2gpt, pSV2neo, pSV2-dhfr, pTk2, pRSVneo, pMSG, pSVT7, pko-neo and pHyg derived vectors are examples of mammalian expression vectors suitable for transfection of eukaryotic cells.
  • vectors are modified with sequences from bacterial plasmids, such as pBR322, to facilitate replication and drug resistance selection in both prokaryotic and eukaryotic cells.
  • bacterial plasmids such as pBR322
  • derivatives of viruses such as the bovine papilloma virus (BPV-1), or Epstein-Barr virus (pHEBo, pREP-derived and p205) can be used for transient expression of proteins in eukaryotic cells.
  • BBV-1 bovine papilloma virus
  • pHEBo Epstein-Barr virus
  • pREP-derived and p205 Epstein-Barr virus
  • examples of other viral (including retroviral) expression systems can be found below in the description of gene therapy delivery systems.
  • the various methods employed in the preparation of the plasmids and in transformation of host organisms are well known in the art.
  • baculovirus expression systems include pVL-derived vectors (such as pVL1392, pVL1393 and pVL941), pAcUW-derived vectors (such as pAcUWl), and pBlueBac-derived vectors (such as the ⁇ -gal containing pBlueBac III).
  • pVL-derived vectors such as pVL1392, pVL1393 and pVL941
  • pAcUW-derived vectors such as pAcUWl
  • pBlueBac-derived vectors such as the ⁇ -gal containing pBlueBac III.
  • a vector will be designed for production of the subject
  • ALK1 polypeptides in CHO cells such as a Pcmv-Script vector (Stratagene, La Jolla, Calif.), pcDNA4 vectors (Invitrogen, Carlsbad, Calif.) and pCI-neo vectors (Promega, Madison, Wise).
  • the subject gene constructs can be used to cause expression of the subject ALK1 polypeptides in cells propagated in culture, e.g., to produce proteins, including fusion proteins or variant proteins, for purification.
  • This disclosure also pertains to a host cell transfected with a recombinant gene including a coding sequence (e.g., SEQ ID NO: 2 or 4) for one or more of the subject ALK1 ACD polypeptides.
  • the host cell may be any prokaryotic or eukaryotic cell.
  • an ALKl polypeptide disclosed herein may be expressed in bacterial cells such as E. coli, insect cells (e.g., using a baculovirus expression system), yeast, or mammalian cells. Other suitable host cells are known to those skilled in the art.
  • the present disclosure further pertains to methods of producing the subject ALKl polypeptides, including ALKl BCD polypeptides.
  • a host cell transfecied with an expression vector encoding an ALKl polypeptide can he cultured under appropriate conditions to allow expression of the ALKl polypeptide to occur.
  • the ALKl polypeptide may be secreted and isolated from a mixture of cells and medium containing the AL l polypeptide.
  • the ALKl polypeptide may be retained cytoplasmically or in a membrane fraction and the cells harvested, lysed and the protein isolated.
  • a cell culture includes host cells, media and other byproducts. Suitable media for cell culture are well known in the art.
  • the subject ALKl polypeptides can be isolated from cell culture medium, host cells, or both, using techniques known in the art for purifying proteins, including ion- exchange chromatography, gel filtration chromatography, ultrafiltration, electrophoresis, immunoaffinity purification with antibodies specific for particular epitopes of the ALKl polypeptides and affinity purification with an agent that binds to a domain fused to the ALKl polypeptide (e.g., a protein A column may be used to purify an ALKl-Fc fusion).
  • the ALKl polypeptide is a fusion protein containing a domain which facilitates its purification.
  • purification is achieved by a series of column chromatography steps, including, for example, three or more of the following, in any order: protein A chromatography, Q sepharose chromatography, phenylsepharose chromatography, size exclusion chromatography, and cation exchange chromatography.
  • the purification could be completed with viral filtration and buffer exchange.
  • a fusion gene coding for a purification leader sequence such as a poly-(His)/enterokinase cleavage site sequence at the N-terminus of the desired portion of the recombinant ALKl polypeptide, can allow purification of the expressed fusion protein by affinity chromatography using a Ni metal resin.
  • the purification leader sequence can then be subsequently removed by treatment with enterokinase to provide the purified ALKl polypeptide (e.g., see Hochuli et al., (1987) J. Chromatography 411 :177; and Janknecht et al., PNAS USA 88:8972). Techniques for making fusion genes are well known.
  • the joining of various DNA fragments coding for different polypeptide sequences is performed in accordance with conventional techniques, employing blunt-ended or stagger-ended termini for ligation, restriction enzyme digestion to provide for appropriate termini, filling-in of cohesive ends as appropriate, alkaline phosphatase treatment to avoid undesirable joining, and enzymatic ligation.
  • the fusion gene can be synthesized by conventional techniques including automated DNA synthesizers.
  • PCR amplification of gene fragments can be carried out using anchor primers which give rise to complementary overhangs between two consecutive gene fragments which can subsequently be annealed to generate a chimeric gene sequence (see, for example, Current Protocols in Molecular Biology, eds. Ausubel et al, John Wiley & Sons: 1992).
  • a nucleic acid compound may be single or double stranded.
  • a double stranded compound may also include regions of overhang or non- complementarity, where one or the other of the strands is single stranded.
  • a single stranded compound may include regions of self-complementarity, meaning that the compound forms a so-called "hairpin” or "stem-loop" structure, with a region of double helical structure.
  • a nucleic acid compound may comprise a nucleotide sequence that is complementary to a region consisting of no more than 1000, no more than 500, no more than 250, no more than 100 or no more than 50, 35, 30, 25, 22, 20 or 18 nucleotides of the full-length ALKl nucleic acid sequence or ligand nucleic acid sequence.
  • the region of complementarity will preferably be at least 8 nucleotides, and optionally at least 10 or at least 15 nucleotides, and optionally between 15 and 25 nucleotides.
  • a region of complementarity may fall within an intron, a coding sequence or a noncoding sequence of the target transcript, such as the coding sequence portion.
  • a nucleic acid compound will have a length of about 8 to about 500 nucleotides or base pairs in length, and optionally the length will be about 14 to about 50 nucleotides.
  • a nucleic acid may be a DNA (particularly for use as an antisense), RNA or RNA:DNA hybrid. Any one strand may include a mixture of DNA and RNA, as well as modified forms that cannot readily be classified as either DNA or RNA.
  • a double stranded compound may be DNA:DNA, DNA:RNA or RNA:RNA, and any one strand may also include a mixture of DNA and RNA, as well as modified forms that cannot readily be classified as either DNA or RNA.
  • a nucleic acid compound may include any of a variety of modifications, including one or modifications to the backbone (the sugar-phosphate portion in a natural nucleic acid, including internucleotide linkages) or the base portion (the purine or pyrimidine portion of a natural nucleic acid).
  • An antisense nucleic acid compound will preferably have a length of about 15 to about 30 nucleotides and will often contain one or more modifications to improve characteristics such as stability in the serum, in a cell or in a place where the compound is likely to be delivered, such as the stomach in the case of orally delivered compounds and the lung for inhaled compounds.
  • the strand complementary to the target transcript will generally be RNA or modifications thereof.
  • the other strand may be RNA, DNA or any other variation.
  • the duplex portion of double stranded or single stranded "hairpin" RNAi construct will preferably have a length of 18 to 40 nucleotides in length and optionally about 21 to 23 nucleotides in length, so long as it serves as a Dicer substrate.
  • Catalytic or enzymatic nucleic acids may be ribozymes or DNA enzymes and may also contain modified forms.
  • Nucleic acid compounds may inhibit expression of the target by about 50%, 75%, 90% or more when contacted with cells under physiological conditions and at a concentration where a nonsense or sense control has little or no effect. Preferred concentrations for testing the effect of nucleic acid compounds are 1, 5 and 10 micromolar. Nucleic acid compounds may also be tested for effects on, for example, angiogenesis.
  • Another aspect of the disclosure pertains to an antibody reactive with an extracellular portion of an ALK1 polypeptide, preferably antibodies that are specifically reactive with ALK1 polypeptide.
  • such antibody may interfere with ALK1 binding to a ligand such as GDF5, GDF6, GDF7 BMP-9 or BMP- 10 - it will be understood that an antibody against a ligand of ALK1 should bind to the mature, processed form of the relevant protein.
  • the disclosure also provides antibodies that bind to GDF5, GDF6, GDF7, BMP9 and/or BMP10 and inhibit ALK1 binding to such ligands.
  • Preferred antibodies will exhibit an anti-angiogenic activity in a bioassay, such as a CAM assay or corneal micropocket assay (see above).
  • a preferred anti-BMP9 antibody is described in Example 10, below.
  • an antibody that inhibits both BMP9 and BMP 10 may be desirable; such an antibody may inhibit both ligands in an ALK1 binding assay, in an angiogenesis assay (e.g., HUVEC tube forming assay, CAM assay, Matrigel assay, or other such assays described herein).
  • antibody as used herein is intended to include whole antibodies, e.g., of any isotype (IgG, IgA, IgM, IgE, etc), and includes fragments or domains of immunoglobulins which are reactive with a selected antigen.
  • Antibodies can be fragmented using conventional techniques and the fragments screened for utility and/or interaction with a specific epitope of interest.
  • the term includes segments of proteolytically-cleaved or recombinantly-prepared portions of an antibody molecule that are capable of selectively reacting with a certain protein.
  • Non-limiting examples of such proteolytic and/or recombinant fragments include Fab, F(ab')2, Fab', Fv, and single chain antibodies (scFv) containing a V[L] and/or V[H] domain joined by a peptide linker.
  • the scFv's may be covalently or non-covalently linked to form antibodies having two or more binding sites.
  • the term antibody also includes polyclonal, monoclonal, or other purified preparations of antibodies and recombinant antibodies.
  • recombinant antibody means an antibody, or antigen binding domain of an immunoglobulin, expressed from a nucleic acid that has been constructed using the techniques of molecular biology, such as a humanized antibody or a fully human antibody developed from a single chain antibody. Single domain and single chain antibodies are also included within the term “recombinant antibody.”
  • Antibodies may be generated by any of the various methods known in the art, including administration of antigen to an animal, administration of antigen to an animal that carries human immunoglobulin genes, or screening with an antigen against a library of antibodies (often single chain antibodies or antibody domains). Once antigen binding activity is detected, the relevant portions of the protein may be grafted into other antibody frameworks, including full-length IgG frameworks.
  • anti-protein/anti-peptide antisera or monoclonal antibodies can be made by standard protocols (See, for example, Antibodies: A Laboratory Manual ed. by Harlow and Lane (Cold Spring Harbor Press: 1988)).
  • BMP9 and BMP 10 have considerable amino acid identity, and therefore, each protein may be used as an immunogen to generate antibodies that can cross-react with both B P9 and BMP 10. Fragments of highly similar sequence may also be used as immunogens.
  • a mammal such as a mouse, a hamster or rabbit can be immunized with an immunogenic form of the peptide (e.g., a ALKl polypeptide or an antigenic fragment which is capable of eliciting an antibody response, or a fusion protein).
  • an immunogenic form of the peptide e.g., a ALKl polypeptide or an antigenic fragment which is capable of eliciting an antibody response, or a fusion protein.
  • Techniques for conferring immunogenicity on a protein or peptide include conjugation to carriers or other techniques well known in the art.
  • An immunogenic portion preferably an extracellular portion
  • an ALKl polypeptide or an ALKl ligand such as BMP9 or BMP 10 can be administered in the presence of adjuvant.
  • the progress of immunization can be monitored by detection of antibody titers in plasma or serum. Standard ELISA or other immunoassays can be used with the immunogen as antigen to assess the levels of antibodies.
  • anti-ALKl or anti-ligand antisera can be obtained and, if desired, polyclonal antibodies can be isolated from the serum.
  • antibody-producing cells lymphocytes
  • immortalizing cells such as myeloma cells to yield hybridoma cells.
  • Such techniques are well known in the art, and include, for example, the hybridoma technique (originally developed by Kohler and Milstein, Nature, 1975;256: 495-497), the human B cell hybridoma technique (Kozbar et ah, Immunology Today, (1983;4:72, and the EBV- hybridoma technique to produce human monoclonal antibodies (Cole et al, (1985) Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, Inc. pp. 77-96).
  • Hybridoma cells can be screened immunochemically for production of antibodies specifically reactive with a mammalian ALKl polypeptide of the present disclosure or ligands such as BMP9 or BMP 10 and monoclonal antibodies isolated from a culture comprising such hybridoma cells.
  • Antibodies with specificity for both BMP9 and BMP 10 may be selected from hybridomas that are obtained from animals inoculated with either BMP9 or BMP 10 alone.
  • antibody as used herein is intended to include fragments thereof which are also specifically reactive with one of the subject ALKl polypeptides or ALKl ligand polypeptides or a combination of target antigens (e.g., BMP9 and BMP10).
  • Antibodies can be fragmented using conventional techniques and the fragments screened for utility in the same manner as described above for whole antibodies. For example, F(ab)2 fragments can be generated by treating antibody with pepsin. The resulting F(ab)2 fragment can be treated to reduce disulfide bridges to produce Fab fragments.
  • the antibody of the present disclosure is further intended to include bispecific, single-chain, and chimeric and humanized molecules having affinity for an ALK1 polypeptide conferred by at least one CDR region of the antibody.
  • the antibody further comprises a label attached thereto and is able to be detected, (e.g., the label can be a radioisotope, fluorescent compound, enzyme or enzyme co-factor).
  • an antibody of the disclosure is a recombinant antibody, particularly a humanized monoclonal antibody or a fully human recombinant antibody.
  • the adjective "specifically reactive with” as used in reference to an antibody is intended to mean, as is generally understood in the art, that the antibody is sufficiently selective between the antigen of interest (e.g., an ALK1 polypeptide or an ALK1 ligand) and other antigens that are not of interest that the antibody is useful for, at minimum, detecting the presence of the antigen of interest in a particular type of biological sample.
  • the antibody a higher degree of specificity in binding may be desirable.
  • an antibody for use in detecting a low abundance protein of interest in the presence of one or more very high abundance protein that are not of interest may perform better if it has a higher degree of selectivity between the antigen of interest and other cross-reactants.
  • Monoclonal antibodies generally have a greater tendency (as compared to polyclonal antibodies) to discriminate effectively between the desired antigens and cross-reacting polypeptides.
  • an antibody that is effective at selectively identifying an antigen of interest in one type of biological sample may not be as effective for selectively identifying the same antigen in a different type of biological sample (e.g., a blood sample).
  • an antibody that is effective at identifying an antigen of interest in a purified protein preparation that is devoid of other biological contaminants may not be as effective at identifying an antigen of interest in a crude biological sample, such as a blood or urine sample.
  • the application provides antibodies that have demonstrated specificity for an antigen of interest in a sample type that is likely to be the sample type of choice for use of the antibody.
  • One characteristic that influences the specificity of an antibody: antigen interaction is the affinity of the antibody for the antigen. Although the desired specificity may be reached with a range of different affinities, generally preferred antibodies will have an affinity (a dissociation constant) of about 10 " , 10 " , 10 " , 10 " or less. Given the apparently low binding affinity of TGFp for ALK1 , it is expected that many anti-ALKl antibodies will inhibit TGFP binding.
  • the GDF5,6,7 group of ligands bind with a KD of approximately 5x10 "8 M and the BMP9,10 ligands bind with a KD of approximately lxlO "10 M.
  • antibodies of appropriate affinity may be selected to interfere with the signaling activities of these ligands.
  • the techniques used to screen antibodies in order to identify a desirable antibody may influence the properties of the antibody obtained.
  • an antibody to be used for certain therapeutic purposes will preferably be able to target a particular cell type. Accordingly, to obtain antibodies of this type, it may be desirable to screen for antibodies that bind to cells that express the antigen of interest (e.g., by fluorescence activated cell sorting).
  • an antibody is to be used for binding an antigen in solution, it may be desirable to test solution binding.
  • a variety of different techniques are available for testing antibody:antigen interactions to identify particularly desirable antibodies.
  • Such techniques include ELISAs, surface plasmon resonance binding assays (e.g., the Biacore binding assay, Bia-core AB, Uppsala, Sweden), sandwich assays (e.g., the paramagnetic bead system of IGEN International, Inc., Gaithersburg, Maryland), western blots, immunoprecipitation assays and immunohistochemistry.
  • an antibody disclosed herein is an antibody that binds to the mature portion of human BMP9, the amino acid sequence of which is shown below:
  • an antibody disclosed herein is an antibody that binds to the mature portion of human BMP 10, the amino acid sequence of which is shown below:
  • non-antibody proteins that bind to BMP9 or BMPIO may be generated by selection from libraries.
  • a wide variety of technologies are available for selecting random peptides, as well as framework based proteins, that bind to a particular ligand.
  • an approach to identifying a useful non-antibody protein will involve screening or selecting from a library those proteins that bind to BMP9 and/or BMPIO or inhibit a BMP9 or BMPIO activity, such as receptor (e.g., ALKl) binding or cellular signaling (e.g, SMAD 1/5 signaling).
  • a BMP9 or BMPIO activity such as receptor (e.g., ALKl) binding or cellular signaling (e.g, SMAD 1/5 signaling).
  • the application further provides antibodies and ALKl -Fc fusion proteins that contain engineered or variant Fc regions.
  • Such antibodies and Fc fusion proteins may be useful, for example, in modulating effector functions, such as, antigen-dependent cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). Additionally, the modifications may improve the stability of the antibodies and Fc fusion proteins.
  • Amino acid sequence variants of the antibodies and Fc fusion proteins are prepared by introducing appropriate nucleotide changes into the DNA, or by peptide synthesis. Such variants include, for example, deletions from, and/or insertions into and/or substitutions of, residues within the amino acid sequences of the antibodies and Fc fusion proteins disclosed herein.
  • amino acid changes also may alter post-translational processes of the antibodies and Fc fusion proteins, such as changing the number or position of glycosylation sites.
  • Antibodies and Fc fusion proteins with reduced effector function may be produced by introducing changes in the amino acid sequence, including, but are not limited to, the Ala- Ala mutation described by Bluestone et al, (see WO 94/28027 and WO 98/47531; also see Xu et al., 2000 Cell Immunol 200; 16-26).
  • antibodies and Fc fusion proteins of the disclosure containing mutations within the constant region including the Ala-Ala mutation may be used to reduce or abolish effector function.
  • antibodies and Fc fusion proteins may comprise a mutation to an alanine at position 234 or a mutation to an alanine at position 235, or a combination thereof.
  • the antibody or Fc fusion protein comprises an IgG4 framework, wherein the Ala-Ala mutation would describe a mutation(s) from phenylalanine to alanine at position 234 and/or a mutation from leucine to alanine at position 235.
  • the antibody or Fc fusion protein comprises an IgGl framework, wherein the Ala- Ala mutation would describe a mutation(s) from leucine to alanine at position 234 and/or a mutation from leucine to alanine at position 235.
  • the antibody or Fc fusion protein may alternatively or additionally carry other mutations, including the point mutation K322A in the CH2 domain (Hezareh et al, 2001 ; J. Virol. 75: 12161-8).
  • the antibody or Fc fusion protein is modified to either enhance or inhibit complement dependent cytotoxicity (CDC).
  • Modulated CDC activity may be achieved by introducing one or more amino acid substitutions, insertions, or deletions in an Fc region (see, e.g., U.S. Pat. No. 6,194,551).
  • cysteine residue(s) may be introduced in the Fc region, thereby allowing interchain disulfide bond formation in this region.
  • the homodimeric antibody thus generated may have improved or reduced internalization capability and/or increased or decreased complement-mediated cell killing. See Caron et al; J. Exp Med. 1992; 176:1191-1195 and Shopes, B. (1992); J. Immunol.
  • the disclosure provides methods of treating renal cell carcinoma in a mammal by administering to a mammal an effective amount of an ALK1 ECD polypeptide, such as an ALKl-Fc fusion protein, or an antibody disclosed herein, such as an antibody against GDF5, GDF6, GDF7, BMP9, BMP 10, or the ECD of ALK1, or nucleic acid antagonists ⁇ e.g., antisense or siRNA) of any of the foregoing hereafter collectively referred to as “therapeutic agents” or "ALK1 "antagonist(s).” It is expected that these therapeutic agents are useful in treating renal cell carcinoma as a single agents, or in combination with other RCC therapeutic agents.
  • polypeptide therapeutic agents of the present disclosure have several properties that make them particularly attractive as therapeutic agents in treating RCC.
  • ALK1 ECD polypeptides affect renal cell growth by modulating multiple factors that promote and sustain tumor growth. proliferation and tumor angiogenesis. This is highly relevant in cancers, where a cancer will frequently have mutations associated with multiple distinct signaling pathways that drive for example, tumor growth, proliferation, angiogenesis, and metastasis.
  • the therapeutic agents disclosed herein are particularly effective in treating tumors such as renal cell carcinomas that are resistant to treatment with a drug that targets a single angiogenic factor (e.g., bevacizumab, which targets VEGF), while at the same time providing the potential to antagonize the activity of ALKl, which is selectively expressed on activated endothelium cells and appears to play an instrumental role in regulating the response of these cells to multiple factors such as BMP9, VEGF, and FGF that drive tumor angiogenesis and cell proliferation.
  • a drug that targets a single angiogenic factor e.g., bevacizumab, which targets VEGF
  • ALKl-Fc fusion proteins are effective in reducing tumor growth of tumors in vivo in a human RCC xenograft model. Accordingly, it is expected that ALKl ECD polypeptides such as ALKl-Fc fusion proteins and other therapeutic agents disclosed herein are useful in stand-alone (i.e., single agent) therapy for treating renal cell carcinoma. Additionally, as further disclosed herein, ALKl-Fc fusion protein significantly increases the tumor growth inhibiting activity of sunitinib, the current standard of care in advanced RCC in each of the human RCC xenograft models tested.
  • ALKl ECD polypeptides such as ALKl-Fc fusion proteins and other therapeutic agents disclosed herein are useful in combination therapy with other agents, such as receptor tyrosine kinase inhibitors for treating renal cell carcinoma.
  • the term “treat” or “treatment” refers to contact or administration of an exogenous therapeutic agent, diagnostic agent, or composition to the mammal (e.g., human), subject, cell, tissue, organ, or biological fluid, and can refer, e.g., to therapeutic, pharmacokinetic, diagnostic, research, and experimental methods.
  • Treating” or “treatment” include the administration of an ALKl ECD polypeptide, such as an ALKl- Fc fusion protein or other ALK antagonist to prevent or delay the onset of the symptoms, complications, or biochemical indicia of a disease, condition, or disorder, alleviating the symptoms or arresting or inhibiting further development of the disease, condition, or disorder.
  • Treatment can be prophylactic (to prevent or delay the onset of the disease, or to prevent the manifestation of clinical or subclinical symptoms thereof) or therapeutic suppression or alleviation of symptoms after the manifestation of the disease, condition. or disorder.
  • Treatment can be with the ALKl ECD polypeptide (e.g., ALKl -Fc fusion protein) or other ALKl antagonist alone, or in combination with one or more additional therapeutic agents.
  • mammalian animal including but not limited to non-primates such as cows, pigs, horses, sheep, cows, dogs, cats, rats, and mice
  • a primate including but not limited to monkeys, apes, and humans
  • a human including but not limited to monkeys, apes, and humans
  • the term “amount effective” or “effective amount” refers to an amount of a therapeutic agent, e.g., an ALKl ECD polypeptide such as an ALKl-Fc fusion protein, that is sufficient to achieve the desired effect, such as, to alleviate one or more disease symptoms or effects in the treated subject or population, whether by inducing the regression of or inhibiting the progression of such symptom(s) or effects by any clinically measurable degree.
  • a therapeutic agent e.g., an ALKl ECD polypeptide such as an ALKl-Fc fusion protein
  • the amount of a therapeutic agent that is effective to alleviate any particular disease symptom or effect may vary according to factors such as the disease state, age, and weight of the patient, and the ability of the drug to elicit a desired response in the patient. Whether a disease symptom or effect has been alleviated can be assessed by any clinical measurement typically used (e.g., by healthcare providers or laboratory clinicians) to assess the severity or progression status of that symptom or effect.
  • RTKI refers to a small-molecule receptor tyrosine kinase inhibitor that binds to and inhibits signaling of VEGFRl , VEGFR2, or VEGFR3.
  • An RTKI can bind to and inhibit receptor tyrosine kinases in addition to a VEGFR, such as PDGFRa, PDGFRb, RET, and c-Met.
  • an RTKI can inhibit a different class of kinases and kinases that are not cell surface receptors, such as the serine kinases B-raf kinase and c-raf kinase.
  • the disclosure relates to a method of treating renal cell carcinoma (RCC) in a mammal, comprising administering to a mammal that has RCC an effective amount of an RTKI and an ALKl ECD polypeptide, such as an ALKl-Fc fusion protein or other ALK antagonist disclosed herein.
  • the ALK antagonist is an agent selected from (a) an ALKl polypeptide comprising a ligand binding portion of the extracellular domain of ALKl; (b) an antibody that binds to the extracellular domain of human ALKl ; (c) an antibody that binds to human BMP9; and (d) an antibody that binds to human BMP 10.
  • the ALKl polypeptide used according to the method comprises a polypeptide having an amino acid sequence that is at least 90% identical to the sequence of amino acids 22-120 of SEQ ID NO: l .
  • the ALKl polypeptide further comprises a constant domain of an immunoglobulin.
  • the ALKl polypeptide further comprises an Fc portion of an immunoglobulin and in additional aspects, the Fc portion is an Fc portion of a hwian IgGl .
  • the ALKl polypeptide comprises an amino acid sequence that is at least 90% identical to the sequence of SEQ ID NO: 3 or SEQ ID NO: 14.
  • the disclosure encompasses a method of treating renal cell carcinoma in a mammal that has RCC and that has undergone a medical procedure to treat RCC.
  • the medical procedure is selected from nephron- sparing surgery, nephrectomy, complete nephrectomy and tissue ablation.
  • the treatment is administered to the mammal within 1, 2, 3, 4, 5, 6, or one month after the medical procedure.
  • the antibody used according to the methods of the disclosure bind an epitope within the sequence of amino acids 22-1 18 of SEQ ID NO: l and inhibits binding of a ligand selected from GDF5, GDF6, GDF7, BMP9 and BMP 10.
  • the antibody binds to an epitope within the sequence of amino acids 1-111 of SEQ ID NO: 12 and inhibits binding of BMP9 to a receptor.
  • the antibody binds to an epitope within the sequence of amino acids 1-108 of SEQ ID NO: 13 and inhibits binding of BMP 10 to a receptor.
  • the RTKI used according to the methods of the disclosure is sunitinib.
  • the RTKI used according to the methods of the disclosure is not sunitinib.
  • the RTKI used according to the methods of the disclosure is sorafenib.
  • the RTKI is pazopanib.
  • the RTKI is axitinib.
  • the RTKI is tivozanib or vandetanib.
  • RTKI used according to the method is an agent selected from: motesanib (AMG-706), vatalanib (PTK787/ZK), samaxanib (SU5416), SU6668, AZD2171, XL 184, XL880/GSK1363089, PF-2351066, MGCD265, ZD6474, AEE788, AG-013736, AG- 013737, GW786034, and ABT-869.
  • the pharmaceutical preparations comprise a VEGF receptor tyrosine kinase inhibitor agent disclosed in International Patent Appl. Publ. Nos.
  • the disclosure relates to a method of treating renal cell carcinoma (RCC) in a mammal, comprising administering to a mammal that has RCC (1) an effective amount of (1) an RTKI, (2) an ALK1 ECD polypeptide, such as an ALKl-Fc fusion protein or other ALK antagonist disclosed, and (3) a mammalian target of rapamycin (mTOR)-targeted inhibitor.
  • RCC renal cell carcinoma
  • mTOR-targeted inhibitor refers to a small-molecule inhibitor that binds to and inhibits signaling of the AKT/mTOR signalling pathway.
  • the mTOR inhibitor used according to the methods of the invention is everolimus.
  • the mTOR inhibitor is temsirolimus.
  • the mTOR inhibitor is an agent selected from: WYE354, YE132 (Pfizer), PP30 and PP242, AZD8055, OSI-027, Torinl, BEZ235, XL765, GDC-0980, PF- 04691502 and PF-05212384.
  • the renal cell carcinoma (RCC) treated according to the methods of the disclosure is a clear cell renal cell carcinoma.
  • the RCC is a TNM stage III disease.
  • the RCC is a TNM stage IV disease.
  • the RCC is found within the intrarenal veins.
  • the RCC has invaded the renal sinus.
  • the RCC has metastasized to the adrenal gland or to a lymph node.
  • the RCC has metastasized to the lung, intraabdominal lymph nodes, bone, brain, or liver.
  • the disclosure relates to a method of treating metastatic renal cell carcinoma (RCC) in a mammal, comprising administering to a mammal having metastatic RCC an effective amount of an RTKI and an ALK1 ECD polypeptide, such as an ALKl-Fc fusion protein or other ALK antagonist disclosed herein.
  • the disclosure encompasses a method of treating renal cell carcinoma in a mammal that has RCC and that has undergone a medical procedure to treat RCC.
  • the medical procedure is selected from nephron- sparing surgery, nephrectomy, complete nephrectomy and tissue ablation.
  • the treatment is administered to the mammal within 1, 2, 3, 4, 5, 6, or a month after the medical procedure.
  • the disclosure is directed to methods of treating a mammal that has received prior treatment with an RCC therapeutic agent.
  • the disclosure encompasses a method of treating renal cell carcinoma in a mammal having previously received an RCC therapeutic agent, the method comprising administering to the mammal an effective amount of an agent selected from: (a) an ALKl polypeptide comprising a ligand binding portion of the extracellular domain of ALKl ; (b) an antibody that binds to the extracellular domain of human ALKl ; (c) an antibody that binds to human BMP9; and (d) an antibody that binds to human BMP 10.
  • an agent selected from: (a) an ALKl polypeptide comprising a ligand binding portion of the extracellular domain of ALKl ; (b) an antibody that binds to the extracellular domain of human ALKl ; (c) an antibody that binds to human BMP9; and (d) an antibody that binds to human BMP 10.
  • the ALKl polypeptide used according to the method comprises a polypeptide having an amino acid sequence that is at least 90% identical to the sequence of amino acids 22-120 of SEQ ID NO:l .
  • the ALKl polypeptide further comprises a constant domain of an immunoglobulin.
  • the ALKl polypeptide further comprises an Fc portion of an immunoglobulin and in additional aspects, the Fc portion is an Fc portion of a human IgGl .
  • the ALKl polypeptide comprises an amino acid sequence that is at least 90% identical to the sequence of SEQ ID NO: 3 or SEQ ID NO: 14.
  • the antibody used according to the methods of the disclosure binds to an epitope within the sequence of amino acids 22-1 18 of SEQ ID NO:l and inhibits binding of a ligand selected from GDF5, GDF6, GDF7, BMP9 and BMP 10.
  • the antibody binds to an epitope within the sequence of amino acids 1- 11 1 of SEQ ID NO: 12 and inhibits binding of BMP9 to a receptor.
  • the antibody binds to an epitope within the sequence of amino acids 1-108 of SEQ ID NO: 13 and inhibits binding of BMP 10 to a receptor.
  • the previously received RCC therapeutic agent is an RTKI.
  • the RTKI is an agent selected from: sunitinib, sorafenib, pazopanib, axitinib, tivozanib and vandetanib.
  • the previously received RCC therapeutic agent is a mammalian target of rapamycin (mTOR)-targeted inhibitor.
  • the mTOR-targeted inhibitor is an agent selected from: everolimus and temsirolimus.
  • the mTOR inhibitor is an agent selected from: WYE354, YE132 (Pfizer), PP30 and PP242, AZD8055, OSI-027, Torinl, BEZ235, XL765, GDC- 0980, PF-04691502 and PF-05212384.
  • the previously received RCC therapeutic agent is a systemic cytokine therapy.
  • the previously received RCC therapeutic agent is interferon alpha (IFN-a) or interleukin-2 (IL-2).
  • the RTKI used according to the methods of treating a mammal that has received prior treatment with an RCC therapeutic agent is sunitinib.
  • the RTKI used according to the methods of treating a mammal that has received prior treatment with an RCC therapeutic agent is not sunitinib.
  • the RTKI used according to the methods of treating a mammal that has received prior treatment with an RCC therapeutic agent is sorafenib.
  • the RTKI is pazopanib.
  • the RTKI is axitinib.
  • the RTKI is tivozanib or vandetanib.
  • RTKI used according to the method is an agent selected from: motesanib (AMG-706), vatalanib (PTK787/ZK), samaxanib (SU5416), SU6668, AZD2171, XL184, XL880/GSK1363089, PF-2351066, MGCD265, ZD6474, AEE788, AG-013736, AG-013737, GW786034, and ABT-869.
  • the pharmaceutical preparations comprise a VEGF receptor tyrosine kinase inhibitor agent disclosed in International Patent Appl. Publ. Nos. W097/22596, WO 97/30035, WO 97/32856 or WO 98/13354.
  • the disclosure relates to a method of treating renal cell carcinoma (RCC) in a mammal having previously received an RCC therapeutic agent, the method comprising administering to the mammal an effective amount of (1) an RTKI, (2) an ALK1 ECD polypeptide, such as an ALKl-Fc fusion protein or other ALK antagonist disclosed, and (3) a mammalian target of rapamycin (mTOR)-targeted inhibitor.
  • mTOR-targeted inhibitors, and assays for identifying mTOR-targeted inhibitors that can be used according to the methods of the disclosure are known in the art.
  • the mTOR inhibitor used according to the methods of the invention is everolimus.
  • the mTOR inhibitor is temsirolimus. In other aspects, the mTOR inhibitor is an agent selected from: WYE354, YE132 (Pfizer), PP30 and PP242, AZD8055, OSI- 027, Torinl, BEZ235, XL765, GDC-0980, PF-04691502 and PF-05212384.
  • the disclosure relates to a method of treating renal cell carcinoma (RCC) in a mammal having previously received an RCC therapeutic agent wherein the renal cell carcinoma (RCC) treated according to the methods of the disclosure is a clear cell renal cell carcinoma.
  • the RCC is a TNM stage III disease.
  • the RCC is a TNM stage IV disease.
  • the RCC is found within the intrarenal veins.
  • the RCC has invaded the renal sinus.
  • the RCC is metastatic renal cell carcinoma.
  • the RCC has metastasized to the adrenal gland or to a lymph node.
  • the RCC has metastasized to the lung, intra-abdominal lymph nodes, bone, brain, or liver.
  • the disclosure is directed to methods of treating a mammal that has RCC and that is preparing to undergo a medical procedure to treat RCC.
  • the disclosure encompasses a method of treating renal cell carcinoma in a mammal that has RCC and that is preparing to undergo a medical procedure to treat RCC, the method comprising administering to the mammal an effective amount of an agent selected from: (a) an ALKl polypeptide comprising a ligand binding portion of the extracellular domain of ALKl ; (b) an antibody that binds to the extracellular domain of human ALKl ; (c) an antibody that binds to human BMP9; and (d) an antibody that binds to human BMP 10.
  • an agent selected from: (a) an ALKl polypeptide comprising a ligand binding portion of the extracellular domain of ALKl ; (b) an antibody that binds to the extracellular domain of human ALKl ; (c) an antibody that binds to human BMP9; and (d) an antibody
  • the ALKl polypeptide used according to the method comprises a polypeptide having an amino acid sequence that is at least 90% identical to the sequence of amino acids 22-120 of SEQ ID NO: l .
  • the ALKl polypeptide further comprises a constant domain of an immunoglobulin.
  • the ALKl polypeptide further comprises an Fc portion of an immunoglobulin and in additional aspects, the Fc portion is an Fc portion of a human IgGl .
  • the ALKl polypeptide comprises an amino acid sequence that is at least 90% identical to the sequence of SEQ ID NO: 3 or SEQ ID NO: 14.
  • the agent is administered at least, 1, 2, 3, 4, 5, 6, or 7 days before the medical procedure.
  • the mammal has received a series of at least 1, 2, 3, or 4 treatments with the agent prior to the operation.
  • the agent is administered prior to a medical procedure selected from: nephron-sparing surgery, nephrectomy, complete nephrectomy and tissue ablation.
  • an antibody is administered to treat a mammal that has
  • the administered antibody binds an epitope within the sequence of amino acids 22-118 of SEQ ID NO.l and inhibits binding of a ligand selected from GDF5, GDF6, GDF7, BMP9 and BMP 10.
  • the antibody binds to an epitope within the sequence of amino acids 1-1 1 1 of SEQ ID NO:12 and inhibits binding of BMP9 to a receptor.
  • the antibody binds to an epitope within the sequence of amino acids 1-108 of SEQ ID NO: 13 and inhibits binding of BMP 10 to a receptor.
  • an RTKI is administered with an ALK-1 antagonist disclosed herein to treat a mammal prior to undergoing a medical procedure.
  • the ALK-1 antagonist disclosed herein to treat a mammal prior to undergoing a medical procedure.
  • RTKI used according to the methods of treating a mammal prior to undergoing a medical procedure to treat RCC is siraitimb.
  • the RTKI used according to the methods of treating a mammal prior to undergoing a medical procedure to treat RCC is not sunitinib.
  • the RTKI used according to the methods of treating a mammal prior to undergoing a medical procedure to treat RCC is sorafenib.
  • the RTKI is pazopanib.
  • the RTKI is axitinib.
  • the RTKI is tivozanib or vandetanib.
  • RTKI used according to the method is an agent selected from: motesanib (AMG-706), vatalanib (PTK787/ZK), samaxanib (SU5416), SU6668, AZD2171, XL184, XL880/GSK1363089, PF-2351066, MGCD265, ZD6474, AEE788, AG-013736, AG-013737, GW786034, and ABT-869.
  • the agent comprises an RTKI disclosed in International Patent AppL Publ. Nos. W097/22596, WO 97/30035, WO 97/32856 or WO 98/13354.
  • the disclosure is directed to methods of treating a mammal that has RCC and that is preparing to undergo a medical procedure to treat RCC wherein the method comprises administering to the mammal an effective amount of (1) an RTKI, (2) an ALK1 ECD polypeptide, such as an ALKl-Fc fusion protein or other ALK antagonist disclosed, and (3) a mammalian target of rapamycin (mTOR)-targeted inhibitor.
  • the mTOR inhibitor used according to the methods of the invention is everolimus. In other aspects, the mTOR inhibitor is temsirolimus.
  • the mTOR inhibitor is an agent selected from: WYE354, YE132 (Pfizer), PP30 and PP242, AZD8055, OSI-027, Torinl, BEZ235, XL765, GDC-0980, PF-04691502 and PF- 05212384.
  • the disclosure relates to a method of treating renal cell carcinoma (RCC) in a mammal having RCC prior to undergoing a medical procedure to treat RCC wherein the renal cell carcinoma (RCC) is a clear cell renal cell carcinoma.
  • the RCC is a TNM stage III disease.
  • the RCC is a TNM stage IV disease.
  • the RCC is found within the intrarenal veins. In other aspects, the RCC has invaded the renal sinus. In further aspects, the RCC is metastatic renal cell carcinoma. In additional aspects, the RCC has metastasized to the adrenal gland or to a lymph node. In further aspects, the RCC has metastasized to the lung, intra-abdominal lymph nodes, bone, brain, or liver.
  • the disclosure is directed to methods of treating a mammal that has RCC and that has undergone a medical procedure to treat RCC.
  • the disclosure encompasses a method of treating renal cell carcinoma in a mammal that has RCC and that has undergone a medical procedure to treat RCC, the method comprising administering to the mammal an effective amount of an agent selected from: (a) an ALKl polypeptide comprising a ligand binding portion of the extracellular domain of ALKl; (b) an antibody that binds to the extracellular domain of human ALKl; (c) an antibody that binds to human BMP9; and (d) an antibody that binds to human BMP 10.
  • an agent selected from: (a) an ALKl polypeptide comprising a ligand binding portion of the extracellular domain of ALKl; (b) an antibody that binds to the extracellular domain of human ALKl; (c) an antibody that binds to human BMP9; and (d) an antibody that binds to human BMP
  • the ALKl polypeptide used according to the method comprises a polypeptide having an amino acid sequence that is at least 90% identical to the sequence of amino acids 22-120 of SEQ ID NO: 1.
  • the ALKl polypeptide further comprises a constant domain of an immunoglobulin.
  • the ALKl polypeptide further comprises an Fc portion of an immunoglobulin and in additional aspects, the Fc portion is an Fc portion of a human IgGl.
  • the ALKl polypeptide comprises an amino acid sequence that is at least 90% identical to the sequence of SEQ ID NO: 3 or SEQ ID NO: 14.
  • the agent is administered at least, 1, 2, 3, 4, 5, 6, or 7 days after the medical procedure.
  • the agent is administered within one week, one month, or three months of the medical procedure. In another aspect, the agent is administered at least, 1, 2, 3, 4, 5, 6, or 7 days after In another aspect the mammal receives a series of at least 1, 2,3, or 4 treatments with the agent after the operation. In another aspect, the agent is administered after a medical procedure selected from: nephron-sparing surgery, nephrectomy, complete nephrectomy and tissue ablation. [0171] In some embodiments, an antibody is administered to treat a mammal that has
  • the antibody binds to an epitope within the sequence of amino acids 22-118 of SEQ ID NO:l and inhibits binding of a ligand selected from GDF5, GDF6, GDF7, BMP9 and BMP 10. In additional aspects, the antibody binds to an epitope within the sequence of amino acids 1-1 11 of SEQ ID NO: 12 and inhibits binding of BMP9 to a receptor. In further aspects, the antibody binds to an epitope within the sequence of amino acids 1-108 of SEQ ID NO: 13 and inhibits binding of BMP 10 to a receptor.
  • an RTKI is administered with an ALK-1 antagonist disclosed herein to treat a mammal that has RCC and that has undergone a medical procedure to treat RCC.
  • the RTKI used according to the methods of treating a mammal after undergoing a medical procedure is sunitinib.
  • the RTKI used according to the methods of treating a mammal after undergoing a medical procedure to treat RCC is not sunitinib.
  • the RTKI used according to the methods of treating a mammal after undergoing a medical procedure to treat RCC is sorafenib.
  • the RTKI is pazopanib.
  • the RTKI is axitinib. In another embodiment, the RTKI is tivozanib or vandetanib.
  • RTKI used according to the method is an agent selected from: motesanib (AMG- 706), vatalanib (PTK787/ZK), samaxanib (SU5416), SU6668, AZD2171 , XL184, XL880/GSK1363089, PF-2351066, MGCD265, ZD6474, AEE788, AG-013736, AG- 013737, GW786034, and ABT-869.
  • the agent comprises an RTKI disclosed in International Patent Appl. Publ. Nos. W097/22596, WO 97/30035, WO 97/32856 or WO 98/13354.
  • the disclosure relates to a method of treating renal cell carcinoma (RCC) in a mammal after undergoing a medical procedure to treat the RCC wherein the method comprises administering to the mammal an effective amount of (1) an RTKI, (2) an ALK1 ECD polypeptide, such as an ALKl-Fc fusion protein or other ALK antagonist disclosed, and (3) a mammalian target of rapamycin (mTOR)-targeted inhibitor.
  • the mTOR inhibitor used according to the methods of the invention is everolimus. In other aspects, the mTOR inhibitor is temsirolimus.
  • the mTOR inhibitor is an agent selected from: WYE354, YE132 (Pfizer), PP30 and PP242, AZD8055, OSI-027, Torinl , BEZ235, XL765, GDC-0980, PF-04691502 and PF-05212384.
  • the disclosure relates to a method of treating RCC in a mammal having RCC after undergoing a medical procedure to treat RCC wherein the renal cell carcinoma (RCC) is a clear cell renal cell carcinoma.
  • the RCC is a TNM stage III disease.
  • the RCC is a TNM stage IV disease.
  • the RCC is found within the intrarenal veins.
  • the RCC has invaded the renal sinus.
  • the RCC is metastatic renal cell carcinoma.
  • the RCC has metastasized to the adrenal gland or to a lymph node.
  • the RCC has metastasized to the lung, intra-abdominal lymph nodes, bone, brain, or liver.
  • the disclosure is directed to methods of treating a mammal that has metastatic RCC.
  • the disclosure encompasses a method of treating metastatic RCC wherein the method comprises administering to the mammal an effective amount of an agent selected from: (a) an AL 1 polypeptide comprising a ligand binding portion of the extracellular domain of ALK1 ; (b) an antibody that binds to the extracellular domain of human ALK1; (c) an antibody that binds to human BMP9; and (d) an antibody that binds to human BMP 10.
  • an agent selected from: (a) an AL 1 polypeptide comprising a ligand binding portion of the extracellular domain of ALK1 ; (b) an antibody that binds to the extracellular domain of human ALK1; (c) an antibody that binds to human BMP9; and (d) an antibody that binds to human BMP 10.
  • the ALK1 polypeptide used according to the method comprises a polypeptide having an amino acid sequence that is at least 90% identical to the sequence of amino acids 22-120 of SEQ ID NO: l .
  • the ALK1 polypeptide further comprises a constant domain of an immunoglobulin.
  • the ALK1 polypeptide further comprises an Fc portion of an immunoglobulin and in additional aspects, the Fc portion is an Fc portion of a human IgGl .
  • the ALK1 polypeptide comprises an amino acid sequence that is at least 90% identical to the sequence of SEQ ID NO: 3 or SEQ ID NO: 14.
  • an antibody is administered to treat a mammal that has metastatic RCC.
  • the administered antibody binds an epitope within the sequence of amino acids 22-1 18 of SEQ ID NO: l and inhibits binding of a ligand selected from GDF5, GDF6, GDF7, BMP9 and BMP 10.
  • the antibody binds to an epitope within the sequence of amino acids 1-1 1 1 of SEQ ID NO: 12 and inhibits binding of BMP9 to a receptor.
  • the antibody binds to an epitope within the sequence of amino acids 1-108 of SEQ ID NO:13 and inhibits binding of BMP 10 to a receptor.
  • the disclosure relates to a method of treating metastatic renal cell carcinoma (RCC) in a mammal, comprising administering to a mammal having metastatic RCC an effective amount of an RTKI and an ALK1 ECD polypeptide, such as an ALKl-Fc fusion protein or other ALK antagonist disclosed herein.
  • the RTKI is sunitinib. In other embodiments, the RTKI is not sunitinib. In some aspects the RTKI is sorafenib. In additional aspects, the RTKI is pazopanib. In additional aspects, the RTKI is axitinib. In another embodiment, the RTKI is tivozanib or vandetanib.
  • RTKI is an agent selected from: motesanib (AMG-706), vatalanib (PTK787/ZK), samaxanib (SU5416), SU6668, AZD2171, XL184, XL880/GSK1363089, PF-2351066, MGCD265, ZD6474, AEE788, AG-013736, AG-013737, GW786034, and ABT-869.
  • the agent comprises an RTKI disclosed in International Patent Appl. Publ. Nos. W097/22596, WO 97/30035, WO 97/32856 or WO 98/13354.
  • the disclosure is directed to methods of treating a mammal that has metastatic RCC wherein the method comprises administering to the mammal an effective amount of (1) an RTKI, (2) an ALK1 ECD polypeptide, such as an ALKl-Fc fusion protein or other ALK antagonist disclosed, and (3) a mammalian target of rapamycin (mTOR)-targeted inhibitor.
  • mTOR mammalian target of rapamycin
  • the mTOR inhibitor used according to the methods of the invention is everolimus. In other aspects, the mTOR inhibitor is temsirolimus.
  • the mTOR inhibitor is an agent selected from: WYE354, YE132 (Pfizer), PP30 and PP242, AZD8055, OSI-027, Torinl, BEZ235, XL765, GDC-0980, PF-04691502 and PF-05212384.
  • the disclosure also provides methods of inhibiting angiogenesis in a mammal by administering to a mammal an effective amount of an ALK1 ECD polypeptide, such as an ALKl-Fc fusion protein, or other "therapeutic agent” or “ALK1 "antagonist” as disclosed herein. It is expected that these therapeutic agents will also be useful in inhibiting angiogenesis in bones and joints, and in tumors, particularly tumors associated with bones and joints.
  • Angiogenesis associated diseases include, but are not limited to, angiogenesis- dependent cancer, including, for example, solid tumors, blood born tumors such as leukemias, and tumor metastases; benign tumors, for example hemangiomas, acoustic neuromas, neurofibromas, trachomas, and pyogenic granulomas; rheumatoid arthritis; psoriasis; rubeosis; Osier-Webber Syndrome; myocardial angiogenesis; plaque neovascularization; telangiectasia; hemophiliac joints; and angiofibroma.
  • angiogenesis- dependent cancer including, for example, solid tumors, blood born tumors such as leukemias, and tumor metastases; benign tumors, for example hemangiomas, acoustic neuromas, neurofibromas, trachomas, and pyogenic granulomas; rheumatoid arthritis; psoriasis; rubeosis;
  • polypeptide therapeutic agents of the present disclosure are useful for treating or preventing a cancer (tumor), and particularly such cancers as are known to rely on angiogenic processes to support growth.
  • ALKl ECD polypeptides affect angiogenesis that is stimulated by multiple factors. This is highly relevant in cancers, where a cancer will frequently acquire multiple factors that support tumor angiogenesis.
  • the therapeutic agents disclosed herein will be particularly effective in treating tumors that are resistant to treatment with a drug that targets a single angiogenic factor (e.g., bevacizumab, which targets VEGF).
  • an ALKl -Fc fusion protein is effective in reducing the pathological effects of melanoma, lung cancer and multiple myeloma. Multiple myeloma is widely recognized as a cancer that includes a significant angiogenic component. Accordingly, it is expected that ALKl-Fc fusion proteins and other therapeutic agents disclosed herein will be useful in treating multiple myeloma and other tumors associated with the bone. As demonstrated herein, therapeutic agents disclosed herein may be used to ameliorate the bone damage associated with multiple myeloma, and therefore may be used to ameliorate bone damage associated with bone metastases of other tumors, such as breast or prostate tumors. As noted herein, the GDF5-7 ligands are highly expressed in bone, and, while not wishing to be limited to any particular mechanism, interference with these ligands may disrupt processes that are required for tumor development in bone.
  • the disclosure is directed to methods of inhibiting angiogenesis in a mammal having a condition for which angiogenesis inhibition is desirable, wherein the method comprises administering to the mammal an effective amount of an agent selected from: (a) an ALKl polypeptide comprising a ligand binding portion of the extracellular domain of ALKl ; (b) an antibody that binds to the extracellular domain of human ALKl ; (c) an antibody that binds to human BMP9; and (d) an antibody that binds to human BMP10.
  • an agent selected from: (a) an ALKl polypeptide comprising a ligand binding portion of the extracellular domain of ALKl ; (b) an antibody that binds to the extracellular domain of human ALKl ; (c) an antibody that binds to human BMP9; and (d) an antibody that binds to human BMP10.
  • the ALKl polypeptide used according to the method comprises a polypeptide having an amino acid sequence that is at least 90% identical to the sequence of amino acids 22-120 of SEQ ID NO: l .
  • the ALKl polypeptide further comprises a constant domain of an immunoglobulin.
  • the ALKl polypeptide further comprises an Fc portion of an immunoglobulin and in additional aspects, the Fc portion is an Fc portion of a human IgGL in other aspects, the ALK1 polypeptide comprises an amino acid sequence that is at least 90% identical to the sequence of SEQ ID NO: 3 or SEQ ID NO: 14.
  • an antibody is administered to inhibit angiogenesis in a mammal, in further embodiments, the administered antibody binds an epitope within the sequence of amino acids 22-1 18 of SEQ ID NO: l and inhibits binding of a ligand selected from GDF5, GDF6, GDF7, BMP9 and BMP 10. in additional aspects, the antibody binds to an epitope within the sequence of amino acids 1-1 1 1 of SEQ ID NO: 12 and inhibits binding of BMP9 to a receptor. In further aspects, the antibody binds to an epitope within the sequence of amino acids 1-108 of SEQ ID NO: 13 and inhibits binding of BMP 10 to a receptor.
  • an RTKI is administered with an ALK.-1 antagonist disclosed herein to inhibit angiogenesis in a mammal
  • the RTKI is sunitimh.
  • the RTKI is not sunitinib.
  • the RTKI is sorafenib.
  • the RTKI is pazopanib.
  • the RTKI is axitinib.
  • the RTKI is tivozanib or vandetanib.
  • RT I is selected from: motesanib (AMG-706), vatalanib (PTK787/ZK), samaxanib (SU5416), SU6668, AZD2171 , XI . 1 84. XL880/GSK1363089, PF-2351066, MGCD265, ZD6474, AEE788, AG-013736, AG-013737, GW786034, and ABT-869.
  • the RTKI disclosed in international Patent Appl. Publ. Nos. W097/22596, WO 97/30035, WO 97/32856 or WO 98/13354.
  • the disclosure is directed to methods of inhibiting angiogenesis wherein the method comprises administering to a mammal an effective amount of ( 1) an RTKI, (2) an ALK1 ECD polypeptide, such as an ALKl-Fc fusion protein or other ATK antagonist disclosed, and (3) a mammalian target of rapamycin (mTGR)-iargeted inhibitor.
  • mTGR mammalian target of rapamycin
  • the mTOR inhibitor used according to the methods of the invention is everolimus. In other aspects, the mTOR inhibitor is temsirolimus.
  • the m TOR inhibitor is an agent selected from: WYE354, YE 132 (Pfizer), PP30 and PP242, AZD8055, OSI-027, Torinl , BEZ235, XL765, GDC-0980, PF-04691502 and PF-G52I2384.
  • the antiangiogenic agents described herein may be used in combination with other compositions and procedures for the treatment of diseases. For example, a tumor may be treated conventionally with surgery, radiation or chemotherapy combined with the ALK1 or ALK1 ligand antagonist and then the antagonist may be subsequently administered to the patient to extend the dormancy of micrometastases and to stabilize any residual primary tumor.
  • angiogenesis-inhibiting agents can also be given prophylactically to individuals known to be at high risk for developing new or re-current cancers. Accordingly, an aspect of the disclosure encompasses methods for prophylactic prevention of cancer in a subject, comprising administrating to the subject an effective amount of an ALK1 or ALK1 ligand antagonist and/or a derivative thereof, or another angiogenesis-inhibiting agent of the present disclosure.
  • ALKl-Fc is effective for diminishing the phenotype of a murine model of rheumatoid arthritis. Accordingly, therapeutic agents disclosed herein may be used for the treatment of rheumatoid arthritis and other types of bone or joint inflammation.
  • angiogenesis inhibiting proteins of the present disclosure are useful in the treatment of disease of excessive or abnormal stimulation of endothelial cells. These diseases include, but are not limited to, intestinal adhesions, atherosclerosis, scleroderma, and hypertrophic scars, i.e., keloids. They are also useful in the treatment of diseases that have angiogenesis as a pathologic consequence such as cat scratch disease (Rochele minalia quintosa) and ulcers (Helicobacter pylori).
  • General angiogenesis inhibiting proteins can be used as a birth control agent by reducing or preventing uterine vascularization required for embryo implantation.
  • the present disclosure provides an effective birth control method when an amount of the inhibitory protein sufficient to prevent embryo implantation is administered to a female.
  • an amount of the inhibiting protein sufficient to block embryo implantation is administered before or after intercourse and fertilization have occurred, thus providing an effective method of birth control, possibly a "morning after" method. While not wanting to be bound by this statement, it is believed that inhibition of vascularization of the uterine endometrium interferes with implantation of the blastocyst.
  • Administration methods may include, but are not limited to. pills, injections
  • one or more therapeutic agents can be administered, together (simultaneously) or at different times (sequentially).
  • therapeutic agents can be administered with another type of compound for treating cancer or for inhibiting angiogenesis.
  • the subject methods of the disclosure can be used alone.
  • the subject methods may be used in combination with other conventional anti-cancer therapeutic approaches directed to treatment or prevention of proliferative disorders (e.g., tumor).
  • such methods can be used in prophylactic cancer prevention, prevention of cancer recurrence and metastases after surgery, and as an adjuvant of other conventional cancer therapy.
  • conventional cancer therapies e.g., chemotherapy, radiation therapy, phototherapy, immunotherapy, and surgery
  • a subject polypeptide therapeutic agent e.g., chemotherapy, radiation therapy, phototherapy, immunotherapy, and surgery
  • a wide array of conventional compounds have been shown to have anti-neoplastic activities. These compounds have been used as pharmaceutical agents in chemotherapy to shrink solid tumors, prevent metastases and further growth, or decrease the number of malignant cells in leukemic or bone marrow malignancies.
  • chemotherapy has been effective in treating various types of malignancies, many anti-neoplastic compounds induce undesirable side effects. It has been shown that when two or more different treatments are combined, the treatments may work synergistically and allow reduction of dosage of each of the treatments, thereby reducing the detrimental side effects exerted by each compound at higher dosages. In other instances, malignancies that are refractory to a treatment may respond to a combination therapy of two or more different treatments.
  • a polypeptide therapeutic agent disclosed herein When a polypeptide therapeutic agent disclosed herein is administered in combination with another conventional anti-neoplastic agent, either concomitantly or sequentially, such therapeutic agent may enhance the therapeutic effect of the antineoplastic agent or overcome cellular resistance to such anti-neoplastic agent. This allows decrease of dosage of an anti-neoplastic agent, thereby reducing the undesirable side effects, or restores the effectiveness of an anti-neoplastic agent in resistant cells.
  • the methods of the disclosure also include co-administration with other medicaments that are used to treat conditions of the eye.
  • administration can occur simultaneously or sequentially in time.
  • the therapeutic agents and/or medicaments may be administered by different routes of administration or by the same route of administration.
  • compositions for use in accordance with the present disclosure may be formulated in conventional manner using one or more physiologically acceptable carriers or excipients. Such formulations will generally be substantially pyrogen free, in compliance with most regulatory requirements.
  • the therapeutic method of the disclosure includes administering the composition systemically, or locally as an implant or device.
  • the therapeutic composition for use in this disclosure is in a pyrogen-free, physiologically acceptable form.
  • Therapeutically useful agents other than the AL 1 signaling antagonists which may also optionally be included in the composition as described above, may be administered simultaneously or sequentially with the subject compounds (e.g., ALK1 ECD polypeptides or any of the antibodies disclosed herein) in the methods disclosed herein.
  • compositions suitable for parenteral administration may comprise one or more ALK1 ECD polypeptides or other antibodies in combination with one or more pharmaceutically acceptable sterile isotonic aqueous or nonaqueous solutions, dispersions, suspensions or emulsions, or sterile powders which may be reconstituted into sterile injectable solutions or dispersions just prior to use, which may contain antioxidants, buffers, bacteriostats, solutes which render the formulation isotonic with the blood of the intended recipient or suspending or thickening agents.
  • aqueous and nonaqueous carriers examples include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate.
  • polyols such as glycerol, propylene glycol, polyethylene glycol, and the like
  • vegetable oils such as olive oil
  • injectable organic esters such as ethyl oleate.
  • Proper fluidity can be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
  • compositions and formulations may, if desired, be presented in a pack or dispenser device which may contain one or more unit dosage forms containing the active ingredient.
  • the pack may for example comprise metal or plastic foil, such as a blister pack.
  • the pack or dispenser device may be accompanied by instructions for administration.
  • Applicants constructed a soluble ALK1 fusion protein that has the extracellular domain of human AL 1 fused to a human Fc or mouse ALK1 fused to a murine Fc domain with a minimal linker in between.
  • the constructs are referred to as hALKl-Fc and mALKl-Fc, respectively.
  • hALKl-Fc is shown as purified from CHO cell lines in Figure 3B (SEQ ID NO:
  • the conventional C-terminus of the extracellular domain of human AL 1 protein is amino acid 118 of SEQ ID NO:l
  • the portion of SEQ ID NO: 14 that derives from human ALK1 incorporates two residues c-terminal to Ql 18, a leucine and an alanine.
  • the disclosure therefore provides ALK1 ECD polypeptides (including Fc fusion proteins) having a c-terminus of the ALK1 derived sequence that is anywhere from 1 to 5 amino acids upstream (113-117 relative to SEQ ID NO:l) or downstream (119-123) of Q118.
  • HBML Honey bee mellitin
  • TP A MDAMKRGLCCVLLLCGAVFVSP
  • the selected form employs the TPA leader and has the unprocessed amino acid sequence shown in Figure 4 (SEQ ID NO:5).
  • Purification can be achieved by a series of column chromatography steps, including, for example, three or more of the following, in any order: protein A chromatography, Q sepharose chromatography, phenylsepharose chromatography, size exclusion chromatography, and cation exchange chromatography.
  • the purification can be completed with viral filtration and buffer exchange.
  • the hALKl-Fc protein was purified to a purity of >98% as determined by size exclusion chromatography and >95% as determined by SDS PAGE.
  • hALKl-Fc tends to be expressed in a mixture of dimers and higher order aggregates which, while appearing pure under denaturing, reducing conditions (e.g., reducing SDS-PAGE), are problematic for administration to a patient.
  • the aggregates may be immunogenic or poorly bioavailable, and because of their heterogeneity, these aggregates make it difficult to characterize the pharmaceutical preparation at a level that is desirable for drug development.
  • various approaches were tested to reduce the amount of aggregate in final preparations.
  • CD (Cat. No. 91119, Irvine Scientific, Santa Ana, CA) showed a remarkable reduction in the production of aggregated products, while maintaining high level production of the hALKl-Fc. Additionally, elution of the material from a hydrophobic interaction column (e.g., phenylsepharose) at a pH of 8.0 resulted in further resolution of the aggregated product. The resulting material is comprised of greater than 99% dimers. A comparison to an ALKl-Fc fusion protein sold by R&D Systems (cat. no. 370- AL, Minneapolis, MN) shows that this protein, produced in NSO cells, is 84% dimers, with the remaining protein appearing as high molecular weight species by size exclusion chromatography.
  • ALKl-Fc fusion protein sold by R&D Systems (cat. no. 370- AL, Minneapolis, MN) shows that this protein, produced in NSO cells, is 84% dimers, with the remaining protein appearing as high molecular weight species by size exclusion chromatography.
  • ALKl is a type 1 receptor for ligands of the TGFP family.
  • Multiple members of the TGFp family were tested for binding to a human ALKl-Fc fusion protein, using a BiacoreTM system.
  • TGFP itself, GDF8, GDF1 1, BMP2 and BMP4 all failed to show substantial binding to the hALKl-Fc protein, while BMP2 and BMP4 showed only limited binding.
  • GDF5 and GDF7 displayed significant binding, with KD values of approximately 5 x 10 " M in both cases. Based on the structural similarity of GDF5 and GDF7 to GDF6, it is expected that GDF6 will bind the fusion protein with similar affinity.
  • the highest binding affinity to hALKl-Fc was observed for BMP9, with K D values ranging from 1 x 10 "10 to 2 x 10 "9 , and BMP10, with a KD of approximately 3 x lo- 9 .
  • the hALKl-Fc compound (lC ⁇ g/ml) or antibody (l( ⁇ g/ml) diminished this transcriptional response, each by nearly 60%, indicating that the presence of ALKl-Fc significantly reduces BMP9 signaling, and moreover, that the BMP9 signaling is related to ALKl activity.
  • SMAD phosphorylation is commonly used to assay activation of upstream activin receptors.
  • ALKl is known to modulate phosphorylation of SMAD proteins 1,5 and 8 upon activation by its ligand.
  • rhBMP-9 50ng/ml
  • HUVEC cells a human endothelial cell line which innately expresses ALK1 receptor, over a timecourse of 30 minutes.
  • Phosphorylation of SMAD 1/5/8 was seen 5 minutes after treatment of cells with ligand and phosphorylation was maintained for the entirety of the 30 minute period.
  • hALKl-Fc 250ng/ml
  • SMAD 1/5/8 phosphorylation was reduced, confirming that this agent inhibits Smad 1/5/8 activation in endothelial cells.
  • hALKl-Fc and mALKl-Fc in the presence of the strongly pro-angiogenic factor ECGS maintained strong inhibition of neovascularization demonstrating even more potent anti-angiogenic activity than the negative control endostatin (lOOng/ml).
  • VEGF and FGF are well-known to stimulate angiogenesis.
  • a CAM (chick chorioallantoic membrane) assay system was used to assess the angiogenic effects of GDF7. As shown in Figure 6, GDF7 stimulates angiogenesis with a potency that is similar to that of VEGF. Similar results were observed with GDF5 and GDF6.
  • ALKl-Fc fusions were tested for anti-angiogenic activity in the CAM assay.
  • ALKL ALKl-Fc proteins and a commercially available, anti-angiogenic anti-VEGF monoclonal antibody were compared in the CAM assay.
  • the ALKl-Fc proteins had similar potency as compared to anti-VEGF.
  • the anti-VEGF antibody bevacizumab is currently used in the treatment of cancer and macular degeneration in humans. See Figure 8.
  • the mouse corneal micropocket assay was used to assess the effects of ALKl-Fc on angiogenesis in the mouse eye.
  • hALKl-Fc administered intraperitoneally, significantly inhibited ocular angiogenesis.
  • hALKl-Fc inhibited ocular angiogenesis to the same degree as anti-VEGF.
  • hALKl-Fc and anti-VEGF were used at identical weight/weight dosages. Similar data were obtained when a Matrigel plug impregnated with VEGF was implanted in a non-ocular location.
  • GDF5, 6 and 7 are primarily localized to bone and joints, while BMP9 is circulated in the blood. Thus, there appears to be a pro-angiogenic system of the bones and joints that includes ALK1, GDF5, 6 and 7 and a systemic angiogenic system that includes ALK1 and BMP9 (and possibly BMP 10).
  • the murine collagen-induced arthritis model is a well-accepted model of rheumatoid arthritis.
  • groups of 10 mice were treated with vehicle, anti- VEGF (bevacizumab - as a negative control, because bevacizumab does not inhibit murine VEGF), or doses of mALKl-Fc ("RAP-041") at 1 mg/kg, 10 mg/kg or 25 mg/kg.
  • mALKl-Fc mALKl-Fc
  • Example 7 ALKl-Fc Reduces Tumor Angiogenesis in a CAM Assay
  • Tumors as with any tissue, have a basic nutrient and oxygen requirement.
  • small tumors are capable of acquiring adequate amounts via diffusion from neighboring blood vessels, as the tumor increases in size, it must secure nutrients by recruiting and maintaining existing capillaries.
  • mALKl-Fc proteins In order to test the capacity of ALK1 -Fc proteins to limit tumor growth through vessel inhibition, we tested varying concentrations of mALKl-Fc in a melanoma explant CAM assay. As with CAM assays described above, small windows were made in the surface of each egg through which 5xl0 5 B16 melanoma cells were implanted. Eggs were then treated daily with 0.02 mg/ml mALKl-Fc, 0.2 mg/ml mALKl-Fc, or left untreated for a period of a week.
  • tumors were carefully removed, weighed and digital images were captured. Tumors originating from CAMs treated with mALKl-Fc showed a significant decrease in size as compared to untreated CAM tumors. Quantification of tumor weight demonstrated that weight of tumors treated daily with either 0.02 mg/ml or 0.2 mg/ml mALKl-Fc showed a reduction of 65% and 85% compared to the untreated CAMs (Fig 6E). In conclusion, neovascularization and tumor growth was significantly suppressed upon addition of ALKl-Fc in a dose-responsive manner, indicating that ALKl-Fc is a powerful anti- angiogenic agent.
  • a CAM (chick chorioallantoic membrane) assay system was used to assess the angiogenic effects of recombinant human BMP9 (rhB9) and anti-BMP9 monoclonal antibody (mabB9) (R&D Systems, Minneapolis, MN, Cat. No. MAB3209).
  • This antibody is known to neutralize BMP9/ALK1 signaling. See, e.g., Scharpfenecker et at, J Cell Sci. 2007 Mar 15;120(Pt 6):964-72; David et at, (2007); Blood Mar 1;109(5):1953-61; David et al, Circ. Res. 2008 Apr 25;102(8);914-22.
  • this murine monoclonal antibody could be humanized to provide a therapeutic agent for use in humans.
  • the antibody may be humanized by a variety of art-recognized techniques, including chimerization, CDR-grafting, resurfacing, back mutations, superhumanization, human string content optimization, and empirical methods, such as FR library generation and selection, FR shuffling and humaneering. See, e.g, Almagro and Fransson, Frontiers in Biosciences, 13: 1619-1633, 2008.
  • mALKl-Fc was effective in delaying the growth of breast cancer tumor cell lines derived from both estrogen receptor positive (ER+) and estrogen receptor negative tumor cells (ER-).
  • the MDA-MB-231 breast cancer cell line (derived from ER- cells) was stably transfected with the luciferase gene to allow for the in vivo detection of tumor growth and potential metastasis.
  • 1 x 10 6 MDA-MB-231 -Luc cells were implanted orthotopically in the mammary fat pad of athymic nude mice (Harlan). Tumor progression was followed by bioluminescent detection using an I VIS Spectrum imaging system (Caliper Life Sciences). An increase in the luminescence (number of photons detected) corresponds to an increase in tumor burden.
  • mice Thirty female nude mice were injected with 1 x 10 6 tumor cells into the mammary fat pad. Three days after tumor implantation the mice were treated with either vehicle control or mALKl-Fc (30 mg/kg) twice per week by subcutaneous (SC) injection. Treatment was continued and tumor progression was monitored by bioluminescent imaging for 10 weeks. mALKl-Fc treatment at 30 mg/kg slowed tumor progression as determined by bioluminescent detection when compared to vehicle treated controls ( Figure 14). Treatment with mALKl-Fc delayed, but did not reverse tumor growth in this model. This may be expected of an antiangiogenic compound in that tumors may be able to survive to a certain size before requiring new blood vessel formation to support continued growth. In a similar experiment, hALKl-Fc produced similar, if slightly lesser, effects at dose levels as low as 3 mg/kg.
  • the estrogen-receptor-positive (ER+), luciferase expressing cell line, MCF-7 was also tested in an orthotopic implantation model.
  • ER+ estrogen-receptor-positive
  • MCF-7 luciferase expressing cell line
  • Example 1 Inhibition of BMP 10 Signaling by hALKl-Fc in a Cell-based Assay
  • 786-0 cells a von Hippel Lindau (VHL)-deficient human renal cell carcinoma
  • Example 14 ALK-Fc has Single Agent Activity in the A498 Tumor Xenograft Model
  • A498 cells a VHL-deficient human RCC cell line ⁇ see Iliopoulos et al, Nature
  • A498 tumor cells were injected subcutaneously (1 x 10 7 cells) into the flanks of 6- to 8-week-old female athymic nude/beige mice (Charles River Laboratories) that were of 20 g average body weight. Tumors developed in >80% of the mice and were usually visible within a few days of implantation. Mice were treated with Fc or ALK-Fc when the tumors had grown to a diameter of 12 mm. ALK-Fc (10 mg/kg) was administered 3 times per week intraperitoneally. Tumors were measured daily while mice were on treatment.
  • ALK-FC has single agent activity as treatment with ALK-
  • Example 15 ALK-Fc Also Enhances the Activity of Sunitinib in the A498 Tumor Xenograft Model
  • Example 14 Mice were treated with vehicle plus Fc, sunitinib plus Fc, vehicle plus ALK- Fc, or subitinib plus ALK-Fc when the tumors had grown to a diameter of 12 mm.
  • Sunitinib (53.6 mg/kg; Pfizer) was administered 6 of 7 days per week by gavage beginning.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Epidemiology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Gastroenterology & Hepatology (AREA)
  • General Engineering & Computer Science (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Oncology (AREA)
  • Urology & Nephrology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Peptides Or Proteins (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Endocrinology (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
PCT/US2013/024510 2012-02-02 2013-02-01 Alk1 antagonists and their uses in treating renal cell carcinoma Ceased WO2013116781A1 (en)

Priority Applications (9)

Application Number Priority Date Filing Date Title
AU2013214779A AU2013214779A1 (en) 2012-02-02 2013-02-01 ALK1 antagonists and their uses in treating renal cell carcinoma
RU2014134923A RU2633638C2 (ru) 2012-02-02 2013-02-01 Антагонисты alk1 и их применение в лечении почечно-клеточной карциномы
EP13744185.3A EP2809335A4 (en) 2012-02-02 2013-02-01 ALK1 ANTAGONISTS AND THEIR USE FOR THE TREATMENT OF NIERENZELLENKARZINOMEN
MX2014009277A MX2014009277A (es) 2012-02-02 2013-02-01 Antagonistas alk1 y sus usos en el tratamiento de carcinoma de celula renal.
CA2863188A CA2863188A1 (en) 2012-02-02 2013-02-01 Alk1 antagonists and their uses in treating renal cell carcinoma
BR112014019151A BR112014019151A2 (pt) 2012-02-02 2013-02-01 antagonistas alk1 e seus usos no tratamento de carcinoma de célula renal
CN201380013788.3A CN104321070A (zh) 2012-02-02 2013-02-01 Alk1拮抗剂及其在治疗肾细胞癌中的用途
KR1020147024468A KR20140123558A (ko) 2012-02-02 2013-02-01 Alk1 길항제 및 신세포 암종 치료에서의 그의 용도
JP2014555801A JP2015506961A (ja) 2012-02-02 2013-02-01 Alk1アンタゴニストおよび腎細胞癌の治療におけるその使用

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201261593864P 2012-02-02 2012-02-02
US61/593,864 2012-02-02
US201261597124P 2012-02-09 2012-02-09
US61/597,124 2012-02-09

Publications (1)

Publication Number Publication Date
WO2013116781A1 true WO2013116781A1 (en) 2013-08-08

Family

ID=48903082

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2013/024510 Ceased WO2013116781A1 (en) 2012-02-02 2013-02-01 Alk1 antagonists and their uses in treating renal cell carcinoma

Country Status (11)

Country Link
US (1) US20130202594A1 (https=)
EP (1) EP2809335A4 (https=)
JP (1) JP2015506961A (https=)
KR (1) KR20140123558A (https=)
CN (1) CN104321070A (https=)
AU (1) AU2013214779A1 (https=)
BR (1) BR112014019151A2 (https=)
CA (1) CA2863188A1 (https=)
MX (1) MX2014009277A (https=)
RU (1) RU2633638C2 (https=)
WO (1) WO2013116781A1 (https=)

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2015147908A1 (en) * 2014-03-28 2015-10-01 Acceleron Pharma, Inc. Use of activin receptor-like kinase 1 (alk-1) antagonists in the treatment of cancer
JP2016036322A (ja) * 2014-08-11 2016-03-22 日本化薬株式会社 血管新生因子と結合するキメラタンパク質
WO2016144917A1 (en) * 2015-03-10 2016-09-15 University Of Massachusetts Targeting gdf6 and bmp signaling for anti-melanoma therapy
US9452197B2 (en) 2006-11-02 2016-09-27 Acceleron Pharma, Inc. Antagonists of BMP9, BMP10, ALK1 and other ALK1 ligands, and uses thereof
US10059756B2 (en) 2006-11-02 2018-08-28 Acceleron Pharma Inc. Compositions comprising ALK1-ECD protein
US12006354B2 (en) 2017-05-24 2024-06-11 Novartis Ag Antibody-IL2 engrafted proteins and methods of use in the treatment of cancer
US12144860B2 (en) 2006-11-02 2024-11-19 Acceleron Pharma Inc. ALK1 receptor and ligand antagonists and uses thereof

Families Citing this family (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3303387A2 (en) 2015-06-05 2018-04-11 Novartis AG Antibodies targeting bone morphogenetic protein 9 (bmp9) and methods therefor
CN106994181A (zh) * 2017-03-10 2017-08-01 上海交通大学医学院附属第九人民医院 Bmp9在制备延缓肝纤维化药物中的应用
WO2019173482A1 (en) * 2018-03-06 2019-09-12 Sanford Burnham Prebys Medical Discovery Institute 4-aminoquinoline compounds for the treatment of angiogenesis
US20250002588A1 (en) 2023-04-07 2025-01-02 Diagonal Therapeutics Inc. Bispecific agonistic antibodies to activin a receptor like type 1 (alk1)

Citations (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1987005330A1 (en) 1986-03-07 1987-09-11 Michel Louis Eugene Bergh Method for enhancing glycoprotein stability
US5082783A (en) 1985-11-25 1992-01-21 Biogen, Inc. Enhanced secretion of heterologous proteins by hosts using substituted promoters
US20070105887A1 (en) 2005-11-04 2007-05-10 Wyeth Antineoplastic combinations of temsirolimus and sunitinib malate
WO2008008981A1 (en) 2006-07-13 2008-01-17 Zymogenetics, Inc. Interleukin 21 and tyrosine kinase inhibitor combination therapy
US20080175844A1 (en) * 2006-11-02 2008-07-24 Acceleron Pharma, Inc. ALK1 receptor and ligand antagonist and uses thereof
US20090017019A1 (en) * 2007-06-01 2009-01-15 Wyeth Methods and compositions for modulating bmp-10 activity
WO2009128083A1 (en) 2008-04-16 2009-10-22 Natco Pharma Limited Novel polymorphic forms of sunitinib base
US20110118297A1 (en) 2009-11-13 2011-05-19 Pankaj Bhargava Tivozanib and Temsirolimus in Combination
WO2011127519A1 (en) * 2010-04-15 2011-10-20 Vegenics Pty Limited Combination treatment with vegf-c antagonists

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6858598B1 (en) * 1998-12-23 2005-02-22 G. D. Searle & Co. Method of using a matrix metalloproteinase inhibitor and one or more antineoplastic agents as a combination therapy in the treatment of neoplasia
KR20100090683A (ko) * 2007-11-09 2010-08-16 제넨테크, 인크. 액티빈 수용체-유사 키나제-i 길항제 조성물 및 사용 방법
JP5719766B2 (ja) * 2008-05-02 2015-05-20 アクセルロン ファーマ, インコーポレイテッド 血管新生および周皮細胞組成物を調節するための方法および組成物

Patent Citations (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5082783A (en) 1985-11-25 1992-01-21 Biogen, Inc. Enhanced secretion of heterologous proteins by hosts using substituted promoters
WO1987005330A1 (en) 1986-03-07 1987-09-11 Michel Louis Eugene Bergh Method for enhancing glycoprotein stability
US20070105887A1 (en) 2005-11-04 2007-05-10 Wyeth Antineoplastic combinations of temsirolimus and sunitinib malate
WO2008008981A1 (en) 2006-07-13 2008-01-17 Zymogenetics, Inc. Interleukin 21 and tyrosine kinase inhibitor combination therapy
US20080175844A1 (en) * 2006-11-02 2008-07-24 Acceleron Pharma, Inc. ALK1 receptor and ligand antagonist and uses thereof
US20090017019A1 (en) * 2007-06-01 2009-01-15 Wyeth Methods and compositions for modulating bmp-10 activity
WO2009128083A1 (en) 2008-04-16 2009-10-22 Natco Pharma Limited Novel polymorphic forms of sunitinib base
US20110118297A1 (en) 2009-11-13 2011-05-19 Pankaj Bhargava Tivozanib and Temsirolimus in Combination
WO2011127519A1 (en) * 2010-04-15 2011-10-20 Vegenics Pty Limited Combination treatment with vegf-c antagonists

Non-Patent Citations (19)

* Cited by examiner, † Cited by third party
Title
14TH ANNUAL MEETING OF THE EUROPEAN-HEMATOLOGY-ASSOCIATION, 4 June 2009 (2009-06-04)
APLIN; WRISTON, CRC CRIT. REV. BIOCHEM., 1981, pages 259 - 306
BERTOLINI ET AL.: "Anti-VEGF and beyond: shaping a new generation of anti-angiogenic therapies for cancer.", DRUG DISCOV TODAY, vol. 16, no. 23-24, pages 1052 - 1060, XP028125384 *
CHO ET AL., HEMATOL. ONCOL. CLIN. NORTH AM., vol. 24, no. 4, 2011, pages 917 - 935
CHO ET AL.: "Future Directions in Renal Cell Carcinoma: 2011 and Beyond.", HEMATOL ONCOL CLIN NORTH AM., vol. 25, no. 4, 2011, pages 917 - 935, XP055159739 *
CUNHA ET AL., J. EXP. MED., vol. 207, no. 1, 2010, pages 85 - 100
CUNHA ET AL.: "ALK1 as an emerging target for antiangiogenic therapy of cancer.", BLOOD, vol. 117, no. 26, 2011, pages 6999 - 7006, XP055159740 *
CUNHA ET AL.: "Genetic and pharmacological targeting of activin receptor-like kinase 1 impairs tumor growth and angiogenesis.", J EXP MED., vol. 207, no. 1, 2010, pages 85 - 100, XP055159732 *
ELFIKY ET AL.: "Novel molecular targets for the therapy of renal cell carcinoma.", DISCOV MED. 1539-6509, vol. 13, no. 73, 2012, pages 461 - 71, XP008174471 *
ESCUDIER ET AL., N. ENG. J. MED., vol. 356, no. 2, 2007, pages 125 - 134
ESCUDIER ET AL.: "Sorafenib in advanced clear-cell renal-cell carcinoma.", N ENGL J MED., vol. 356, no. 2, 2007, pages 125 - 34, XP055159735 *
GRINBERG ET AL., HAEMATOLOGICA - THE HEMATOLOGY JOURNAL, vol. 94, no. 2, 2009, pages 67
MITCHELL ET AL., MOLECULAR CANCER THERAPEUTICS, vol. 9, no. 2, 2010, pages 379 - 388
MOTZER ET AL., J. CLIN. ONCOL, vol. 27, no. 22, 2009, pages 3584 - 3590
MOTZER ET AL.: "Overall survival and updated results for sunitinib compared with interferon alfa in patients with metastatic renal cell carcinoma.", J CLIN ONCOL., vol. 27, no. 22, 2009, pages 3584 - 3590, XP055159728 *
NOLAN-STEVAUX ET AL.: "Beyond VEGF: The NOTCH and ALK1 Signaling Pathways as Tumor Angiogenesis Targets.", 2 July 2012 (2012-07-02), XP055159743, Retrieved from the Internet <URL:http://cdn.intechopen.com/pdfs/28601/InTech-Beyond_vegf_the_notch_andalkl_signaling_pathways_as_tumor_angiogenesis_targets.pdf> [retrieved on 20130325] *
PIRCHER ET AL.: "Biomarkers in tumor angiogenesis and anti-angiogenic therapy.", INT J MOL SCI., vol. 12, no. 10, 2011, pages 7077 - 99, XP008148105 *
See also references of EP2809335A4
SHARMA ET AL., EUROPEAN JOURNAL OF CANCER SUPPLEMENT, vol. 8, no. 7, 2010, pages 149 - 150

Cited By (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9452197B2 (en) 2006-11-02 2016-09-27 Acceleron Pharma, Inc. Antagonists of BMP9, BMP10, ALK1 and other ALK1 ligands, and uses thereof
US10059756B2 (en) 2006-11-02 2018-08-28 Acceleron Pharma Inc. Compositions comprising ALK1-ECD protein
US12144860B2 (en) 2006-11-02 2024-11-19 Acceleron Pharma Inc. ALK1 receptor and ligand antagonists and uses thereof
WO2015147908A1 (en) * 2014-03-28 2015-10-01 Acceleron Pharma, Inc. Use of activin receptor-like kinase 1 (alk-1) antagonists in the treatment of cancer
JP2016036322A (ja) * 2014-08-11 2016-03-22 日本化薬株式会社 血管新生因子と結合するキメラタンパク質
WO2016144917A1 (en) * 2015-03-10 2016-09-15 University Of Massachusetts Targeting gdf6 and bmp signaling for anti-melanoma therapy
EP3735982A1 (en) * 2015-03-10 2020-11-11 The University of Massachusetts Targeting gdf6 and bmp signaling for anti-melanoma therapy
US12006354B2 (en) 2017-05-24 2024-06-11 Novartis Ag Antibody-IL2 engrafted proteins and methods of use in the treatment of cancer

Also Published As

Publication number Publication date
US20130202594A1 (en) 2013-08-08
MX2014009277A (es) 2015-03-03
RU2014134923A (ru) 2016-03-27
CN104321070A (zh) 2015-01-28
AU2013214779A1 (en) 2014-09-04
JP2015506961A (ja) 2015-03-05
BR112014019151A2 (pt) 2017-06-27
RU2633638C2 (ru) 2017-10-16
KR20140123558A (ko) 2014-10-22
EP2809335A1 (en) 2014-12-10
CA2863188A1 (en) 2013-08-08
EP2809335A4 (en) 2015-10-28

Similar Documents

Publication Publication Date Title
US12144860B2 (en) ALK1 receptor and ligand antagonists and uses thereof
AU2018200237B2 (en) Methods and compositions based on ALK1 antagonists for modulating angiogenesis and pericyte coverage
US20130202594A1 (en) ALK1 Antagonists and Their Uses in Treating Renal Cell Carcinoma
US9452197B2 (en) Antagonists of BMP9, BMP10, ALK1 and other ALK1 ligands, and uses thereof
US20220017600A1 (en) Methods and compositions for modulating angiogenesis and pericyte composition
CA2724525A1 (en) Antagonists of bmp9, bmp10, alk1 and other alk1 ligands, and uses thereof
AU2016247166B2 (en) ALK1 receptor and ligand antagonists and uses thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 13744185

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2863188

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: MX/A/2014/009277

Country of ref document: MX

ENP Entry into the national phase

Ref document number: 2014555801

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2013744185

Country of ref document: EP

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112014019151

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 20147024468

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2014134923

Country of ref document: RU

ENP Entry into the national phase

Ref document number: 2013214779

Country of ref document: AU

Date of ref document: 20130201

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 112014019151

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20140801