WO2012109567A2 - Treatment of angiogenesis disorders - Google Patents

Treatment of angiogenesis disorders Download PDF

Info

Publication number
WO2012109567A2
WO2012109567A2 PCT/US2012/024697 US2012024697W WO2012109567A2 WO 2012109567 A2 WO2012109567 A2 WO 2012109567A2 US 2012024697 W US2012024697 W US 2012024697W WO 2012109567 A2 WO2012109567 A2 WO 2012109567A2
Authority
WO
WIPO (PCT)
Prior art keywords
agent
cells
igfbp2
subject
metastatic
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2012/024697
Other languages
English (en)
French (fr)
Other versions
WO2012109567A3 (en
Inventor
Sohail TAVAZOIE
Nils HALBERG
Kim PNG
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Rockefeller University
Original Assignee
Rockefeller University
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CA2841404A priority Critical patent/CA2841404C/en
Priority to EP19191593.3A priority patent/EP3604534A1/en
Priority to JP2013553604A priority patent/JP6178241B2/ja
Priority to ES12745124.3T priority patent/ES2645366T3/es
Priority to DK12745124.3T priority patent/DK2673363T3/da
Priority to EP17184170.3A priority patent/EP3301176B1/en
Priority to US13/984,760 priority patent/US8980261B2/en
Priority to EP12745124.3A priority patent/EP2673363B1/en
Application filed by Rockefeller University filed Critical Rockefeller University
Publication of WO2012109567A2 publication Critical patent/WO2012109567A2/en
Publication of WO2012109567A3 publication Critical patent/WO2012109567A3/en
Priority to US13/963,657 priority patent/US8715660B2/en
Anticipated expiration legal-status Critical
Priority to US14/658,927 priority patent/US9493841B2/en
Priority to US15/629,971 priority patent/US10301684B2/en
Priority to US16/415,472 priority patent/US10894989B2/en
Priority to US17/140,409 priority patent/US12060619B2/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/68Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
    • C12Q1/6876Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes
    • C12Q1/6883Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material
    • C12Q1/6886Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material for cancer
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/1703Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • A61K38/1709Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P27/00Drugs for disorders of the senses
    • A61P27/02Ophthalmic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/04Antineoplastic agents specific for metastasis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/113Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/113Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
    • C12N15/1135Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing against oncogenes or tumor suppressor genes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2300/00Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/10Type of nucleic acid
    • C12N2310/11Antisense
    • C12N2310/113Antisense targeting other non-coding nucleic acids, e.g. antagomirs
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/10Type of nucleic acid
    • C12N2310/14Type of nucleic acid interfering nucleic acids [NA]
    • C12N2310/141MicroRNAs, miRNAs
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2320/00Applications; Uses
    • C12N2320/10Applications; Uses in screening processes
    • C12N2320/11Applications; Uses in screening processes for the determination of target sites, i.e. of active nucleic acids
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2320/00Applications; Uses
    • C12N2320/10Applications; Uses in screening processes
    • C12N2320/12Applications; Uses in screening processes in functional genomics, i.e. for the determination of gene function
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2330/00Production
    • C12N2330/30Production chemically synthesised
    • C12N2330/31Libraries, arrays
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q2600/00Oligonucleotides characterized by their use
    • C12Q2600/106Pharmacogenomics, i.e. genetic variability in individual responses to drugs and drug metabolism
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q2600/00Oligonucleotides characterized by their use
    • C12Q2600/118Prognosis of disease development
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q2600/00Oligonucleotides characterized by their use
    • C12Q2600/136Screening for pharmacological compounds
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q2600/00Oligonucleotides characterized by their use
    • C12Q2600/158Expression markers
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q2600/00Oligonucleotides characterized by their use
    • C12Q2600/16Primer sets for multiplex assays
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q2600/00Oligonucleotides characterized by their use
    • C12Q2600/178Oligonucleotides characterized by their use miRNA, siRNA or ncRNA

Definitions

  • This invention relates to treatments for angiogenesis disorders.
  • Angiogenesis is a process of growth of new blood vessels and remodeling of preexisting blood vessels. It is vital for normal growth and development, as well as other physiological processes, such as wound healing. On the other hand, angiogenesis is also important in various pathological processes. For example, pathological angiogenesis is a fundamental step in the transition of tumors from a dormant state to a malignant one, characterized by the properties of anaplasia, invasiveness, and metastasis.
  • Metastatic progression of cancer is a daunting clinical challenge. Technological advances have allowed for the detection and treatment of some early stage neoplasm, however, total death rates from epithelial malignancies have remained essentially unchanged over the last forty years (seer.cancer.gov/csr/1975_2007/, National Institute of Health, 2007). It generally is believed that this is due to several factors, including molecular heterogeneity within cancer types, chemotherapeutic regimens of modest efficacy that were historically empirically derived, and a long-standing focus on the molecular drivers of primary tumor growth rather than metastatic progression.
  • VEGF has been discovered as a promoter of tumorigenesis in primary tumors (Kim, K. J. et al., Nature 362 (6423), 841 (1993)).
  • VEGF inhibition can, in combination with chemotherapy, lengthen survival by 2-3 months in patients with stage IV colorectal or lung cancer (Hurwitz, H. et al, N Engl J Med 350 (23), 2335 (2004); Giantonio, B. J. et al, J Clin Oncol 25 (12), 1539 (2007); and Sandler, A. et al, N Engl J Med 355 (24), 2542 (2006)).
  • VEGF inhibition has not proven beneficial for metastasis prevention in the adjuvant setting (Barugel, M. E., et al. Expert Rev Anticancer Ther 9 (12), 1829 (2009) and in recent pre-clinical metastasis models (Paez-Ribes, M.
  • This invention is based, at least in part, on an unexpected discovery of a new pathway that regulates endothelial recruitment and, in turn angiogenesis.
  • one aspect of this invention features a method for inhibiting endothelial recruitment, as well as angiogenesis, in a subject in need thereof.
  • the method includes a step of administering to the subject a first agent that inhibits expression or activity of a first protein selected from the group consisting of IGFBP2, MERTK, and PrrPNCl.
  • the subject has an angiogenesis disorder, i.e., a disorder characterized by pathological angiogenesis, such as cancer, an eye disorder, or an inflammatory disorder.
  • angiogenesis disorder i.e., a disorder characterized by pathological angiogenesis, such as cancer, an eye disorder, or an inflammatory disorder.
  • the cancer include metastatic cancer.
  • the above- mentioned method can further include a step of administering to the subject a second agent that inhibits expression or activity of a second protein selected from the group consisting of IGFBP2, IGF1, IGF1R, MERTK, ⁇ , ABCB9, PSAT1, PYGB, SHMT2, and VTPR.
  • the aforementioned first agent or second agent can be an antibody (or an antigen- binding portion thereof.), a nucleic acid, a polypeptide, or a small molecule compound.
  • the above antibody is an monoclonal that contains a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 9 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 10 shown below.
  • this invention features a method for treating metastatic cancer in a subject in need thereof.
  • the method includes a step of administering to the subject a first agent that inhibits expression or activity of a first protein selected from the group consisting of IGFBP2, MERTK, and PITPNC1, where the first agent inhibits angiogenesis.
  • a first agent that inhibits expression or activity of a first protein selected from the group consisting of IGFBP2, MERTK, and PITPNC1, where the first agent inhibits angiogenesis.
  • the cancer include breast cancer.
  • the method can further include a step of administering to the subject a second agent that inhibits expression or activity of a second protein selected from the group consisting of IGFBP2, IGF1, IGF1R, MERTK, PITPNC1, ABCB9, PSAT1, PYGB, SHMT2, and VIPR.
  • the first agent or second agent can be an antibody (or an antigen-binding portion thereof.), a nucleic acid, a polypeptide, or a small molecule compound.
  • the above antibody is an monoclonal that contains a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 9 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 10 shown below.
  • this invention features an isolated nucleic acid having a sequence encoding an RNAi agent capable of inhibiting expression of a protein selected from the group consisting of IGFBP2, MERTK, and PITPNCl.
  • the RNAi agent has a double- stranded structure having a first strand and a second strand; each of the first and second strands is between 19 and 30 nucleotides long; and the first strand is encoded by any one of SEQ ID NOs: 1-6 as listed in Table 5 below.
  • this invention provides a composition having an agent that inhibits expression or activity of a protein selected from the group consisting of IGFBP2, MERTK, and ⁇ , where the agent can be an antibody (or an antigen-binding portion thereof.), a nucleic acid, a polypeptide, or a small molecule compound.
  • the agent is the above-mentioned isolated nucleic acid.
  • the agent is an antibody or an antigen-binding portion thereof.
  • this invention features a method for diagnosing a metastatic potential of cancer in a subject.
  • the method includes steps of obtaining a first expression level for a first gene of the subject selected from the group consisting of IGFBP2, MERTK, and ⁇ , and comparing the first expression level with a first predetermined level for the selected first gene.
  • the subject is determined to have or be prone to develop metastatic cancer if the first expression level is greater than the first predetermined level.
  • the first predetermined level can be obtained from a control subject that is free of cancer.
  • the method further includes steps of obtaining a second expression level for a second gene of the subject selected from the group consisting of IGFBP2, IGF1, IGF1R, MERTK, ⁇ , ABCB9, PSAT1, PYGB, SHMT2, and VIPR; and comparing the second expression level with a second predetermined level for the selected second gene.
  • the subject is determined to have or be prone to develop metastatic cancer if both the first expression level and the second expression level are greater than the first predetermined level and the second predetermined level, respectively.
  • the second predetermined level can also be obtained from a control subject that is free of cancer.
  • the invention also features a method for inhibiting endothelial recruitment in a subject in need thereof.
  • the method includes a step of administering to the subject a first agent that increases expression or activity of GAS6 (i.e. an activating agent of GAS6).
  • the invention further features a composition having an agent that increases expression or activity of GAS6.
  • the aforementioned agent has GAS6 activity.
  • the agent is an antibody (or an antigen-binding portion thereof), a nucleic acid, a polypeptide, or a small molecule compound.
  • the agent is a polypeptide having the sequence of GAS6.
  • the invention features a kit for diagnosing a metastatic potential of cancer in a subject.
  • the kit includes a first reagent that specifically binds to a first expression product (e.g., polypeptide or mRNA) of a first gene selected from the group consisting of IGFBP2, MERTK, and PITPNCl.
  • the kit can further include a second reagent that specifically binds to a second expression product of a second gene selected from the group consisting of IGFBP2, IGF1, IGF1R, MERTK, ⁇ , ABCB9, PSAT1, PYGB, SHMT2, and VIPR.
  • the invention features a method for identifying genes and non- coding RNAs that regulate metastatic cancer colonization of any body tissue.
  • the method includes a first step of generating a population of mammalian cancer cells with increased metastatic tissue colonization potential by performing serial rounds of a) transplantation of a population of labeled or unlabeled cancer cells into any living tissue of the body and then b) performing isolation of said labeled cancer cells from the tissue after metastatic colonization has occurred and then c) performing repeat transplantation of isolated labeled cancer cells into living tissue of the body.
  • serial rounds of transplantation, isolation, and repeat transplantation of labeled cancer cells as described above, a population of labeled or unlabeled cancer cells with high metastatic tissue colonization potential is generated.
  • the second step of the method includes transducing, transfecting, or otherwise introducing a population of one or more shRNA molecules into the population of cancer cells with high metastatic tissue colonization potential to generate a population of engineered cancer cells with high metastatic potential that express one or more shRNA molecules that reduce expression of one or more genes or non-coding RNAs.
  • This the population of engineered cancer cells with high metastatic potential that express one or more shRNA molecules is then a) transplanted into any living tissue and then b) isolated from the living tissue after metastatic colonization has occurred.
  • the presence, absence, or abundance of one or more of the transfected, transduced, or otherwise introduced shRNAs in the population of isolated post-transplant engineered cancer cells is then assessed by either microarray analysis, DNA sequencing technology, deep sequencing technology, or cloning.
  • the reduction in levels of any single shRNA in the population of isolated cells relative to its representation prior to injection indicates that the shRNA' s target gene is required for metastatic colonization of the tissue.
  • the increase in levels of any single shRNA in the population of isolated cells relative to its representation prior to injection indicates that the shRNA's target antagonizes metastatic colonization of the tissue.
  • the second step of this method could also include transducing, transfecting, or otherwise introducing a population of one or more RNAi molecules, microRNAs, or non-coding RNAs. Additionally, the second step could also include transducing, transfecting, or otherwise introducing a population of one or more sequences encoding protein coding genes.
  • the population of engineered cancer cells with high metastatic potential that express one or more protein coding genes is then a) transplanted into any living tissue and then b) isolated from the living tissue after metastatic colonization has occurred.
  • the presence, absence, or abundance of one or more of the transfected, transduced, or otherwise introduced coding genes in the population of isolated post-transplant engineered cancer cells is then assessed by either microarray analysis, DNA sequencing technology, deep sequencing technology, or cloning.
  • the increase in the levels of any single gene in the population of isolated cells relative to its representation prior to injection indicates that the gene represents a target gene required for metastatic colonization of the tissue.
  • the decrease in the levels of any single gene in the population of isolated cells relative to its representation prior to injection indicates that the gene represents a target gene that antagonizes metastatic colonization of the tissue.
  • the invention features a monoclonal antibody (e.g., a humanized or human monoclonal antibody) or an antigen-binding portion thereof that neutralizes IGFBP2 function by inhibiting IGFBP2 binding to IGF1.
  • This antibody is capable of inhibiting endothelial recruitment by cancer cells, such as metastatic breast cancer cells or inhibiting pathological angiogenesis.
  • This antibody is also capable of inhibiting tumor progression or tumor metastasis of cancer cells, such as human breast cancer, in vivo.
  • the monoclonal antibody contains a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 9 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 10 shown below.
  • FIGs. la-f are diagrams and photographs showing that endogenous miR-126 suppresses metastatic colonization, a, Bioluminescence imaging of lung metastasis by poorly metastatic breast cancer cells upon miR-126 inhibition.
  • 4 X 10 4 MDA-MB-231 cells expressing a short hairpin (miR-Zip) targeting miR-126 or the control hairpin were injected intravenously into immunodeficient NOD-SCID mice. Representative mice shown correspond to the MDA-MB-231/miR-126KD set (top) and MDA-MB- 231/scrambled set (bottom) at day 49. Lung colonization was quantified through bioluminescence imaging.
  • mice were extracted at day 49 and immuno-histochemically stained for human vimentin (right), b, Bioluminescence imaging of systemic metastasis by poorly metastatic breast cancer cells with inhibited miR-126 expression.
  • 4 X 10 4 MDA- MB-231 cells expressing a short hairpin targeting miR-126 or the control hairpin were injected via intracardiac route into athymic nude mice. Representative mice shown correspond to the MDA-MB-231/miR-126KD set (top) and MDA-MB-231/scrambled set (bottom) at day 34.
  • c The total number of metastatic foci were counted in mice injected intracardiac with MDA-MB-231/miR-126KD and MDA-MB-231/scrambled cells (top). Representative images of bone and brain metastatic nodules are shown (bottom), d, 5 X 10 5 MDA-MB-231 cells expressing a short hairpin targeting miR-126 or the control hairpin were injected into the mammary fat pads of immunodeficient mice. Tumor volumes were measured over time.
  • n 15; error bars indicate s.e.m.; p-values based on a one-sided student's t-test at day 35.
  • e Extracted lungs from (a) were stained for human - vimentin and the size of each metastatic nodule was measured through image analysis using ImageJ.
  • f 4 X 10 4 Lm2 cells expressing a doxycycline inducible pre-miR-126 cassette were injected via the tail vein into NOD-SCID mice at day 0.
  • doxycycline (2 mg/ml) and sucrose (5%) were added to the drinking water in one group of mice and only 5% sucrose in the other.
  • the lungs were removed and immunohistochemically stained for human vimentin (right). Total number of nodules in each lung is shown to the left.
  • FIGs. 2a-2J are diagrams and photographs showing that endogenous miR-126 non- cell autonomously suppressed metastatic angiogenesis by metastatic breast cancer cells, a, Lung sections from FIG. la were histologically double- stained for human vimentin and MECA-32 or b, for vimentin and intravenously injected lectin. The border of each nodule was demarcated based on vimentin staining and the lectin/MECA-32 staining inside the metastatic nodule highlighted in black (lower panels).
  • the area positive for lectin/MECA- 32 staining within each nodule was then determined by using ImageJ software and presented as the area covered by lectin/MECA-32 stain per area of the given nodule (% vessel density).
  • n 4; error bars represent s.e.m., p- values were obtained using student's t-test.
  • n 4; error bars represent s.e.m., p-values were obtained using student's t-test. Representative images shown correspond to the LM2/miR-1260E or control set (top) and MDA-MB-231/miR- 126KD or control set (bottom).
  • FIGs. 3a-3f are diagrams and photographs showing systematic identification of a miR-126 regulatory network that mediates metastatic endothelial recruitment, a.
  • the miR- 126 metastasis signature is comprised of genes over-expressed in metastatic cells, down- regulated by miR-126 OE, and induced by miR-126 KD.
  • the heatmap represents variance-normalized expression levels based on microarray and qPCR analyses.
  • Colourmap corresponds to standard deviations change from the mean
  • b-d Kaplan-Meier curves for the (b) UCSF breast cancer cohort (117 tumors), (c) NKI cohort (295 tumors), and (d) the combined NKI/MSK/UCSF cohort (494 tumors) depicting metastasis-free- survival of those patients whose primary cancers over-expressed the miR-126 eight gene signature (positive) and those that did not (negative).
  • P-values based on the Mantel-Cox log-rank test, e Luciferase reporter assays of miR-126 metastasis genes in MDA-MB-231 cells expressing a short hairpin targeting miR-126 or the control KD hairpin.
  • Reporter constructs containing the luciferase gene upstream of the 3'UTR or coding sequences (CDS) of each miR-126 regulated gene were transfected into the various cell lines and luciferase activity was assayed at 30 hours post transfection.
  • n 4; error bars represent s.e.m.; p-values were obtained using student's t-test.
  • f The miR-126 complementary regions of the 3'UTR/CDS constructs were mutated and the luciferase reporter assay was repeated with these constructs in MDA-MB-231 cells expressing a short hairpin targeting miR-126 or the control hairpin (right).
  • n 4; error bars represent s.e.m.; p-values were obtained using student' s t-test.
  • FIGs. 4a-4e are a set of diagrams and photographs showing that IGFBP2, PITPNC1 and MERTK promoted metastatic colonization and angiogenesis.
  • a 2.5 X 10 4 LM2 cells expressing hairpins targeting IGFBP2, MERTK, PITPNC1, SHMT2 or the control hairpin were seeded in quadruplicate.
  • c-e Bioluminescence imaging of lung metastasis by lung metastatic breast cancer cells with inhibited expression of the various miR-126 regulated genes.
  • HUVEC and cancer cells were pretreated with 20 ⁇ g/ml IGFIR blocking Ab or control IgG Ab for 1 hour before trans-well recruitment of HUVEC cells towards cancer cells were assessed.
  • n 4; error bars represent s.e.m., p-values obtained using student's t-test g, IGFBP2 gradient was simulated by mixing the given amounts of recombinant IGFBP2 protein with matrigel (1: 1) in the bottom of a well.
  • Chemotaxis of 1.5 X 10 5 HUVEC cells along the IGFBP2 gradient was then assessed by counting the number of cells that had migrated to the basal side of trans-well inserts after 20h using ImageJ software.
  • FIGs. 6a-6e are diagrams and photographs showing that MERTK mediated recruitment through GAS6.
  • a IGFBP2 levels in conditioned media from Lm2 cells expressing control hairpin or 2 independent hairpins against PITPNCl as determined by ELISA.
  • b 2.5 X 10 4 MDA-MB-231 cells expressing a control hairpin or a hairpin targeting miR-126 were seeded in quadruplicate.
  • IGFBP2 gradient in the presence of Gas6 and secreted MERTK was simulated by mixing rhIGFBP2 (520 ng), Gas6 (5 ng) and MerFc (10 ug) protein with matrigel (1: 1) in the bottom of a well.
  • d Lung sections were double stained for vimentin and MECA-32. The border of each nodule was drawn based on human-vimentin staining and MECA-32 staining inside the metastatic nodule highlighted in black (lower panels). The area positive for MECA-32 staining within each nodule was then determined by using ImageJ and presented as the area covered by MECA-32 staining per area of the given nodule (% vessel density).
  • % vessel density between the injected LM2 cells expressing hairpins targeting IGFBP2, PITPNCl, MERTK or a control hairpin are shown in a cumulative fraction plot.
  • n 4, p-value based on the Kolmogorov-Smirnov Test, e, Schematic of miR-126 regulation of endothelial recruitment and metastatic colonization through interaction with IGFBP2, PITPNCl and MERTK.
  • FIG. 7 is a diagram showing that miR-Zip miRNA-anti-sense shRNA system stably inhibited miR-126 expression in MDA-MB-231 cells.
  • MDA-MB-231 cells were transduced with lenti virus expressing either a miR-Zip construct that targets miR-126 or a scrambled version of the construct that does not target any known microRNA (SYSTEM BIOSCIENCES, Mountain View, CA). The expression levels of mature miR-126 were then tested using qPCR.
  • FIG. 8 is a set of photographs and a diagram showing that breast cancer cell- expressed miR-126 regulates perfusion in metastatic nodules.
  • 4 X 10 4 MDA-MB-231 cells expressing a short hairpin targeting miR-126 or the control hairpin were injected intravenously into immunodeficient NOD-SCID mice.
  • FITC labeled low molecular weight dextran (10.000 MW) solution was injected intravenously.
  • the dextran molecules were allowed to circulate for 15 min before mice were euthanized and the lungs excised. Frozen section were prepared, and stained for human Vimentin in order to localize metastatic nodules, and the FITC signal inside the nodules was quantified with a constant threshold using ImageJ.
  • n 5; error bars represent s.e.m., p-values obtained using student' s t-test.
  • FIGs. 10a- 10c are a set of diagrams and diagrams showing that endogenous miR- 126 regulated angiogenesis, but not CD45 positive lymphocyte and Mac-2 positive macrophage recruitment, a-c, 5 X 10 5 MDA cells expressing control hairpin or hairpin targeting miR-126 were mixed in 1: 1 ratio with Matrigel and injected in the mammary fat pad. 5 min prior to sacrifice, biotinlyated lectin was injected in the tail vein. Size matched tumors were excised and functional blood vessels were detected by staining of the injected lectin (a), CD45 + lymphocyte detected by anti-CD45 (b) and Mac-2 + macrophages detected by anti-Mac-2 (c).
  • FIG. 11 is a Venn diagram showing the integrative experimental path that resulted in the identification of putative miR-126 target genes.
  • Transcriptomic profiling of genes down-regulated by greater than 1.6 fold upon miR-126 over-expression were overlapped with genes up-regulated by more than 1.4 fold in metastatic LM2 cells as compared to the parental MDA cells. This led to the identification of 23 potential miR-126 target genes.
  • 8 of these 23 genes were modulated by miR-126 in both the MDA-MB-231 breast cancer cell line and the primary CN34 cell line. These 8 genes were functionally tested for direct regulation by miR-126 through luciferase reporter assays.
  • FIGs. 12a- 12b are diagrams showing that miR-126 regulated IGFBP2 and MERTK through 3'UTR interactions and ⁇ and SHMT2 through CDS interactions, a, b, Luciferase reporter assays of the miR-126 metastasis gene set in MDA-MB-231 cells expressing a short hairpin targeting miR-126 as well as the control KD hairpin.
  • FIGs. 13a- 13d are a set of diagrams showing that independent hairpins down- regulated the expression levels of IGFBP2, PITPNC1 and MERTK in LM2 cells.
  • LM2 cells were transduced with lenti virus expressing a control hairpin or a short hairpin construct targeting IGFBP2, PITPNC1 or MERTK.
  • the expression levels of the target genes were analyzed through qPCR.
  • FIG. 14 is a diagram showing proliferation analysis of miR-126 target genes.
  • FIG. 15 is a diagram showing that IGFBP2 promoted HUVEC migration.
  • FIG. 16 is a photograph of Western blot analysis of MERTK in MDA-MB-231 cellular lysate and conditioned media, showing that ectodomain of MERTK was cleaved and secreted by MDA-MB-231 cells.
  • FIG. 17 is a set of photographs and diagrams showing that GFBP2, PITPNC1 and MERTK promoted metastatic angiogenesis.
  • Lung sections were histologically double - stained for human vimentin and intravenously injected lectin. Nodule borders were demarcated based on vimentin staining and lectin staining inside metastatic nodules.
  • % vessel density represents the area covered by lectin staining per area of a given nodule.
  • FIG. 18 is a diagram showing that endogenous miR-126 expression in HUVEC cells did not suppress recruitment of other HUVEC cells.
  • FIG. 19 is a diagram showing expression of potential miR-126 targets in HUVEC cells with suppressed miR-126 levels.
  • An antagomiR targeting miR-126 or a control antagomiR were transfected into HUVEC cells and the relative expression of potential targets in transfected cells were quantified using qPCR. Error bars represent s.e.m., p- values obtained using student's t-test.
  • FIG. 20 is a set of diagrams showing data from antibody-capture ELISA assays used to characterize binding properties of IGFBP2 neutralizing antibodies. The figure shows that supernatant from one of the hybridoma libraries (wo6663-l) generated from animals inoculated with recombinant IGFBP2 total peptide, contains antibodies that bind to IGFBP2 with high affinity.
  • FIG. 21 is a set of diagrams showing data from antibody capture ELISA assays used to characterize binding properties of IGFBP2 neutralizing antibodies. The figure shows that supernatant from hybridoma wo6663-l contains antibodies that bind to
  • IGFBP2 to neutralize IGF1 binding to IGFBP2. Also note that the antibodies from the hybridoma wo6663-l bind specifically to IGFBP2, and do not bind other IGFBP family members (IGFBP3, IGFBP4).
  • FIG. 22 is a set of diagrams showing data from antibody capture ELISA assays used to characterize binding properties of IGFBP2 neutralizing monoclonal antibodies recovered from single hybridoma clones isolated from hybridoma library wo6663-l.
  • IGFBP2 neutralizing monoclonal antibodies including Ml, M4, M6, M9, M13, M14, M15, and M16, were able to bind IGFBP2 with high affinity and neutralize its binding to IGF1.
  • FIG. 23 is a diagram showing that a composition containing physiological concentrations of the monoclonal antibody M14 is capable of inhibiting endothelial recruitment by metastatic breast cancer cells.
  • a trans- well migration assay was used to quantify endothelial recruitment by metastatic cells.
  • Highly metastatic LM2 human breast cancer cells were placed in the bottom of a Boyden chamber, where their ability to recruit HUVECS through a porous trans-well insert could be assayed.
  • the addition of a small physiologic concentration of Ml 4 to the transwell was able to significantly inhibit the recruitment and migration (migrated cells per field) of HUVEC cells (50% reduction in migrated cells) versus the negative controls (IgG and M5 antibodies). Error bars represent s.e.m.
  • FIG. 24 is a diagram showing that a composition containing physiological concentrations of the monoclonal antibody Ml 4 is capable of inhibiting breast cancer tumor progression in vivo in a mouse model.
  • tumor progression was significantly inhibited by treatment with M14 (7 to 11 fold reduction in tumor progression) compared with the PBS treated mice.
  • the signal is normalized to signal from Day 0. Significance is based on a two sided student T-test.
  • the described invention provides reagents and methods for treating disorders characterized by pathological angiogenesis, such as metastasis.
  • IGFBP2 secreted IGFBP2
  • transferase ⁇ the transferase ⁇
  • MERTK kinase MERTK
  • miR-126 miR-126
  • a newly discovered pathway coordinates IGFBP2, ⁇ , and MERTK— pro-angiogenic genes that correlate in expression with human metastasis. These genes represent regulators of metastatic endothelial recruitment and angiogenesis.
  • IGFBP2 a protein secreted by metastatic cells, recruits endothelia by modulating IGF 1 -mediated activation of the IGF type-I Receptor on endothelial cells.
  • Endothelial recruitment is a process where endothelial cells or their progenitors are mobilized and homing to a site or region in a subject for generating new blood vessels or remodeling of preexisting blood vessels, i.e., angiogenesis. Inhibiting this process via the above-mentioned new pathway can be used to inhibit pathological angiogenesis, and thereby to treat disorders characterized by pathological angiogenesis, such as metastasis.
  • an agent that inhibits expression or activity of a protein selected from IGFBP2, IGF1, IGF1R, MERTK, PITPNC1, ABCB9, PSAT1, PYGB, SHMT2, and VIPR.
  • a protein selected from IGFBP2, IGF1, IGF1R, MERTK, PITPNC1, ABCB9, PSAT1, PYGB, SHMT2, and VIPR.
  • the agent can be a nucleic acid, a polypeptide, an antibody, or a small molecule compound.
  • IGF1 (isoform 1)
  • IGF1 (isoform 2)
  • IGF1 (isoform 3)
  • IGF1 (isoform 4)
  • SHMT2 (isoform 3) MAIRAQHSNAAQTQTGEANRGWTGQESLSDSDPEMWELLQREKDRQCRGLELIASENFCS
  • MRPPSPLPARWLCVLAGALAWALGPAGGQAARLQEECDYVQMIEVQHKQCLEEAQLENET IGCSKMWDNLTCWPATPRGQVVVLACPLIFKLFSS IQGRNVSRSCTDEGWTHLEPGPYPI ACGLDDKAASLDEQQTMFYGSVKTGYTIGYGLSLATLLVATAILSLFRKLHCTRNYIHMH LFI SFILRAAAVFIKDLALFDSGESDQCSEGSVGCKAAMVFFQYCVMANFFWLLVEGLYL YTLLAVSFFSERKYFWGYILIGWGVPSTFTMVWTIARIHFEDYGCWDTINSSLWWI IKGP ILTS ILVNFILFICI IRILLQKLRPPDIRKSDSSPYSRLARSTLLLIPLFGVHYIMFAFF PDNFKPEVKMVFELVVGSFQGFVVAILYCFLNGEVQAELRRKWRRWHLQGVLGWNPKYRH PSGGSNGATCSTQVSML
  • an inhibitory agent i.e., inhibitor
  • an activating agent i.e., activator
  • it is an isolated agent, but not an endogenous molecule (a micro RNA) in a cell of the subject.
  • a micro RNA an endogenous molecule
  • the inhibitory or activating agent functions at a level of transcription, mRNA stability, translation, protein stability/degradation, protein modification, and protein binding.
  • a nucleic acid refers to a DNA molecule (for example, but not limited to, a cDNA or genomic DNA), an RNA molecule (for example, but not limited to, an mRNA), or a DNA or RNA analog.
  • a DNA or RNA analog can be synthesized from nucleotide analogs.
  • the nucleic acid molecule can be single- stranded or double-stranded.
  • An "isolated nucleic acid” is a nucleic acid the structure of which is not identical to that of any naturally occurring nucleic acid or to that of any fragment of a naturally occurring genomic nucleic acid.
  • the term therefore covers, for example, (a) a DNA which has the sequence of part of a naturally occurring genomic DNA molecule but is not flanked by both of the coding sequences that flank that part of the molecule in the genome of the organism in which it naturally occurs; (b) a nucleic acid incorporated into a vector or into the genomic DNA of a prokaryote or eukaryote in a manner such that the resulting molecule is not identical to any naturally occurring vector or genomic DNA; (c) a separate molecule such as a cDNA, a genomic fragment, a fragment produced by polymerase chain reaction (PCR), or a restriction fragment; and (d) a recombinant nucleotide sequence that is part of a hybrid gene, i.e., a gene encoding a fusion protein.
  • PCR polymerase chain reaction
  • RNA Ribonucleic acid molecule
  • DNA DNA molecule or deoxyribonucleic acid molecule
  • DNA and RNA can be synthesized naturally (e.g., by DNA replication or transcription of DNA, respectively). RNA can be post- transcriptionally modified. DNA and RNA also can be chemically synthesized.
  • DNA and RNA can be single-stranded (i.e., ssRNA and ssDNA, respectively) or multi-stranded (e.g., double- stranded, i.e., dsRNA and dsDNA, respectively).
  • the nucleic acid sequence can encode a small interference RNA (e.g., an RNAi agent) that targets one or more of the above-mentioned genes and inhibits its expression or activity.
  • RNAi agent refers to an RNA, or analog thereof, having sufficient sequence complementarity to a target RNA to direct RNA interference. Examples also include a DNA that can be used to make the RNA.
  • RNA interference refers to a sequence-specific or selective process by which a target molecule (e.g., a target gene, protein or RNA) is down-regulated.
  • an interfering RNA is a double stranded short-interfering RNA (siRNA), short hairpin RNA (shRNA), or single- stranded micro-RNA (miRNA) that results in catalytic degradation of specific mRNAs, and also can be used to lower or inhibit gene expression.
  • siRNA refers to an RNA agent, preferably a double- stranded agent, of about 10-50 nucleotides in length, preferably between about 15-25 nucleotides in length, more preferably about 17, 18, 19, 20, 21, 22, 23, 24, or 25 nucleotides in length, the strands optionally having overhanging ends comprising, for example 1, 2 or 3 overhanging nucleotides (or nucleotide analogs), which is capable of directing or mediating RNA interference.
  • Naturally-occurring siRNAs are generated from longer dsRNA molecules (e.g., >25 nucleotides in length) by a cell's RNAi machinery (e.g., Dicer or a homolog thereof).
  • miRNA refers to an RNA agent, preferably a single- stranded agent, of about 10-50 nucleotides in length, preferably between about 15-25 nucleotides in length, more preferably about 17, 18, 19, 20, 21, 22, 23, 24, or 25 nucleotides in length, which is capable of directing or mediating RNA interference.
  • Naturally-occurring miRNAs are generated from stem-loop precursor RNAs (i.e., pre- miRNAs) by Dicer.
  • Dicer includes Dicer as well as any Dicer orthologue or homologue capable of processing dsRNA structures into siRNAs, miRNAs, siRNA-like or miRNA-like molecules.
  • microRNA or “miRNA” is used interchangeably with the term “small temporal RNA” (or “stRNA”) based on the fact that naturally-occurring microRNAs (or “miRNAs”) have been found to be expressed in a temporal fashion (e.g., during development).
  • RNA agent refers to an RNA agent having a stem-loop structure, comprising a first and second region of complementary sequence, the degree of complementarity and orientation of the regions being sufficient such that base pairing occurs between the regions, the first and second regions being joined by a loop region, the loop resulting from a lack of base pairing between nucleotides (or nucleotide analogs) within the loop region.
  • RNAi featuring degradation of RNA molecules (e.g., within a cell).
  • Degradation is catalyzed by an enzymatic, RNA-induced silencing complex (RISC).
  • RISC RNA-induced silencing complex
  • a RNA agent having a sequence sufficiently complementary to a target RNA sequence (e.g., one or more of the above- mentioned genes) to direct RNAi means that the RNA agent has a homology of at least 50%, (e.g., 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% homology) to the target RNA sequence so that the two are sufficiently complementary to each other to hybridize and trigger the destruction of the target RNA by the RNAi machinery (e.g., the RISC complex) or process.
  • the RNAi machinery e.g., the RISC complex
  • RNA agent having a "sequence sufficiently complementary to a target RNA sequence to direct RNAi" also means that the RNA agent has a sequence sufficient to trigger the translational inhibition of the target RNA by the RNAi machinery or process.
  • a RNA agent also can have a sequence sufficiently complementary to a target RNA encoded by the target DNA sequence such that the target DNA sequence is chromatically silenced.
  • the RNA agent has a sequence sufficient to induce transcriptional gene silencing, e.g. , to down-modulate gene expression at or near the target DNA sequence, e.g., by inducing chromatin structural changes at or near the target DNA sequence.
  • polynucleotides can be delivered using polymeric, biodegradable microparticle or microcapsule delivery devices known in the art. Another way to achieve uptake of the polynucleotides is using liposomes, prepared by standard methods.
  • the polynucleotide can be incorporated alone into these delivery vehicles or co- incorporated with tissue- specific antibodies.
  • Poly-L-lysine binds to a ligand that can bind to a receptor on target cells (Cristiano, et al., 1995, J. Mol. Med. 73:479).
  • tissue specific targeting can be achieved by the use of tissue-specific transcriptional regulatory elements that are known in the art. Delivery of naked DNA (i.e., without a delivery vehicle) to an intramuscular, intradermal, or subcutaneous site is another means to achieve in vivo expression.
  • siRNA, miRNA, and asRNA (antisense RNA) molecules can be designed by methods well known in the art.
  • siRNA, miRNA, and asRNA molecules with homology sufficient to provide sequence specificity required to uniquely degrade any RNA can be designed using programs known in the art, including, but not limited to, those maintained on websites for AMBION, Inc. and DHARMACON, Inc. Systematic testing of several designed species for optimization of the siRNA, miRNA, and asRNA sequence can be routinely performed by those skilled in the art.
  • Considerations when designing short interfering nucleic acid molecules include, but are not limited to, biophysical, thermodynamic, and structural considerations, base preferences at specific positions in the sense strand, and homology. These considerations are well known in the art and provide guidelines for designing the above-mentioned RNA molecules.
  • the polypeptide is an antibody.
  • antibody refers to an immunoglobulin molecule or immunologically active portion thereof, i.e., an antigen- binding portion. Examples include, but are not limited to, a protein having at least one or two, heavy (H) chain variable regions (V H ), and at least one or two light (L) chain variable regions (V L ).
  • V H and V L regions can be further subdivided into regions of hypervariability, termed “complementarity determining regions" ("CDR"), interspersed with regions that are more conserved, termed “framework regions" (FR).
  • CDR complementarity determining regions
  • immunoglobulin refers to a protein consisting of one or more polypeptides substantially encoded by immunoglobulin genes.
  • the recognized human immunoglobulin genes include the kappa, lambda, alpha (IgAl and IgA2), gamma (IgGl, IgG2, IgG3, and IgG4), delta, epsilon and mu constant region genes, as well as the myriad immunoglobulin variable region genes.
  • antibody portion refers to one or more fragments of an antibody that retain the ability to specifically bind to an antigen (e.g., IGFBP2, IGF1, IGF1R, MERTK, ⁇ , ABCB9, PSAT1, PYGB, SHMT2, or VIPR). It has been shown that the antigen-binding function of an antibody can be performed by fragments of a full-length antibody.
  • an antigen e.g., IGFBP2, IGF1, IGF1R, MERTK, ⁇ , ABCB9, PSAT1, PYGB, SHMT2, or VIPR.
  • binding fragments encompassed within the term "antigen-binding portion" of an antibody include (i) a Fab fragment, a monovalent fragment consisting of the V L , V H , C L and C H I domains; (ii) a F(ab') 2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the V H and C H I domains; (iv) a Fv fragment consisting of the V L and V H domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., (1989) Nature 341:544-546), which consists of a V H domain; and (vi) an isolated complementarity determining region (CDR).
  • a Fab fragment a monovalent fragment consisting of the V L , V H , C L and C H I domains
  • F(ab') 2 fragment a bivalent fragment comprising two
  • the two domains of the Fv fragment, V L and V H are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the V L and V H regions pair to form monovalent molecules (known as single chain Fv (scFv); see e.g., Bird et al. (1988) Science 242:423- 426; and Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883).
  • single chain Fv single chain Fv
  • Such single chain antibodies are also intended to be encompassed within the term "antigen-binding portion" of an antibody.
  • Antibodies that specifically bind to one of the above-mentioned target protein can be made using methods known in the art.
  • This antibody can be a polyclonal or a monoclonal antibody. Examples of such antibodies include those described in the working examples below.
  • the antibody can be recombinantly produced, e.g., produced by phage display or by combinatorial methods.
  • the antibody is a fully human antibody (e.g., an antibody made in a mouse which has been genetically engineered to produce an antibody from a human immunoglobulin sequence), a humanized antibody, or a non-human antibody, for example, but not limited to, a rodent (mouse or rat), goat, primate (for example, but not limited to, monkey), rabbit, or camel antibody.
  • a rodent mouse or rat
  • primate for example, but not limited to, monkey
  • camel antibody camel antibody.
  • methods to generate humanized version of antibodies include, but are not limited to, CDR grafting (Queen et al., U.S. Pat. No. 5,585,089; Riechmann et al., Nature 332:323 (1988)), chain shuffling (U.S. Pat. No.
  • Examples of methods to generate fully human antibodies include, but are not limited to, generation of antibodies from mice that can express human immunoglobulin genes and use of phage-display technology to generate and screen human immunoglobulin gene libraries.
  • an "isolated antibody” is intended to refer to an antibody that is substantially free of other antibodies having different antigenic specificities (e.g., an isolated antibody that specifically binds IGFBP2, IGF1, IGF1R, MERTK, ⁇ , ABCB9, PSAT1, PYGB, SHMT2, or VIPR is substantially free of antibodies that specifically bind antigens other than such an antigen).
  • An isolated antibody that specifically binds the antigen may, however, have cross-reactivity to other antigens, such as IGFBP2, IGF1, IGF1R, MERTK, PrrPNCl, ABCB9, PSAT1, PYGB, SHMT2, or VIPR molecules from other species.
  • an isolated antibody may be substantially free of other cellular material and/or chemicals.
  • monoclonal antibody or “monoclonal antibody composition” as used herein refer to a preparation of antibody molecules of single molecular composition.
  • a monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope.
  • human antibody is intended to include antibodies having variable regions in which both the framework and CDR regions are derived from human germline immunoglobulin sequences. Furthermore, if the antibody contains a constant region, the constant region also is derived from human germline immunoglobulin sequences.
  • the human antibodies of the invention may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo).
  • the term "human antibody”, as used herein is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
  • human monoclonal antibody refers to antibodies displaying a single binding specificity which have variable regions in which both the framework and CDR regions are derived from human germline immunoglobulin sequences.
  • the human monoclonal antibodies are produced by a hybridoma which includes a B cell obtained from a transgenic nonhuman animal, e.g., a transgenic mouse, having a genome comprising a human heavy chain transgene and a light chain transgene fused to an immortalized cell.
  • recombinant human antibody includes all human antibodies that are prepared, expressed, created or isolated by recombinant means, such as (a) antibodies isolated from an animal (e.g., a mouse) that is transgenic or transchromosomal for human immunoglobulin genes or a hybridoma prepared therefrom (described further below), (b) antibodies isolated from a host cell transformed to express the human antibody, e.g., from a transfectoma, (c) antibodies isolated from a recombinant, combinatorial human antibody library, and (d) antibodies prepared, expressed, created or isolated by any other means that involve splicing of human immunoglobulin gene sequences to other DNA sequences.
  • Such recombinant human antibodies have variable regions in which the framework and CDR regions are derived from human germline immunoglobulin sequences.
  • such recombinant human antibodies can be subjected to in vitro mutagenesis (or, when an animal transgenic for human Ig sequences is used, in vivo somatic mutagenesis) and thus the amino acid sequences of the V H and V L regions of the recombinant antibodies are sequences that, while derived from and related to human germline V H and V L sequences, may not naturally exist within the human antibody germline repertoire in vivo.
  • isotype refers to the antibody class (e.g., IgM or IgGl) that is encoded by the heavy chain constant region genes.
  • an antibody recognizing an antigen and "an antibody specific for an antigen” are used interchangeably herein with the term “an antibody which binds specifically to an antigen.”
  • high affinity for an IgG antibody refers to an antibody having a -7 -8 -9
  • K D 10 " M or less, preferably 10 " M or less, more preferably 10 " M or less and even more preferably 10 " M or less for a target antigen.
  • "high affinity” binding can vary for other antibody isotypes. For example, "high affinity” binding for an
  • IgM isotype refers to an antibody having a -7 r less, more preferably 10 - " 8
  • composition comprising a monoclonal antibody that neutralizes
  • this antibody can be a fully human antibody, a humanized antibody, or a non-human antibody, for example, but not limited to, a rodent (mouse or rat), goat, primate (for example, but not limited to, monkey), rabbit, or camel antibody.
  • one or more amino-acids of this monoclonal monoclonal antibody may be substituted in order to alter its physical properties. These properties include, but are not limited to, binding specificity, binding affinity, immunogenicity, and antibody isotype.
  • Pharmaceutical compositions containing fully human or humanized versions of the above described antibodies can be used to treat disorders of pathological angiogenesis.
  • composition comprising an IGFBP2 neutralizing antibody that inhibits IGFl from binding to IGFBP2 inhibits breast cancer tumor progression and tumor burden in vivo.
  • administration of the above described antibody reduced tumor burden of human breast cancer in vivo in a mouse model of human cancer.
  • compositions containing fully human or humanized versions of the above described antibodies can be used to inhibit breast cancer metastasis in human patients by inhibiting endothelial recruitment by metastatic cells.
  • pharmaceutical compositions containing fully human or humanized versions of these antibodies can be used to treat other types of vascular tumors.
  • Typical vascularized tumors that can be treated with this composition include solid tumors, particularly carcinomas, which require a vascular component for the provision of oxygen and nutrients.
  • Exemplary solid tumors include, but are not limited to, carcinomas of the lung, breast, bone, ovary, stomach, pancreas, larynx, esophagus, testes, liver, parotid, biliary tract, colon, rectum, cervix, uterus, endometrium, kidney, bladder, prostate, thyroid, squamous cell carcinomas, adenocarcinomas, small cell carcinomas, melanomas, gliomas, glioblastomas, neuroblastomas, Kaposi's sarcoma, and sarcomas.
  • the polypeptide is a mutant form of the above-mentioned protein, which interferes with the above-mentioned pathway and therefore inhibits endothelial recruitment and angiogenesis.
  • mutant encompasses naturally occurring mutants and mutants created chemically and/or using recombinant DNA techniques.
  • a mutant of one of the above-mentioned wild type polypeptide can be due to alteration, e.g., truncation, elongation, substitution, deletion, or insertion, of one or more amino acids.
  • the alteration also can have a modified amino acid, such as one comprising a post-translational modification.
  • the pro-angiogenic activity of a mutant is substantially lower than the activity of the wild type polypeptide by at least about 20% (e.g., 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 100%) as measured using an assay described herein or known in the art.
  • amino acid compositions of the above-mentioned antibodies or polypeptides may vary with or without disrupting the ability (e.g., affinity) to bind to the respective antigens or targets, and trigger or inhibit the respective cellular response.
  • they can contain one or more conservative amino acid substitutions.
  • a "conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art.
  • amino acids with basic side chains e.g., lysine, arginine, histidine
  • acidic side chains e.g., aspartic acid, glutamic acid
  • uncharged polar side chains e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine
  • nonpolar side chains e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan
  • ⁇ -branched side chains e.g., threonine, valine, isoleucine
  • aromatic side chains e.g., tyrosine, phenylalanine, tryptophan, histidine
  • a predicted nonessential amino acid residue in, e.g., SEQ ID NO: 9 or 10 can be replaced with another amino acid residue from the same side chain family.
  • mutations can be introduced randomly along all or part of the sequences, such as by saturation mutagenesis, and the resultant mutants can be screened for the ability to bind to the respective antigen and trigger the respective cellular response to identify mutants that retain the activity.
  • compositions within the scope of this invention is a composition that contains a suitable carrier and one or more of the agents described above.
  • the composition can be a pharmaceutical composition that contains a pharmaceutically acceptable carrier, a dietary composition that contains a dietarily acceptable suitable carrier, or a cosmetic composition that contains a cosmetically acceptable carrier.
  • composition refers to the combination of an active agent with a carrier, inert or active, making the composition especially suitable for diagnostic or therapeutic use in vivo or ex vivo.
  • a “pharmaceutically acceptable carrier,” after administered to or upon a subject, does not cause undesirable physiological effects.
  • the carrier in the pharmaceutical composition must be “acceptable” also in the sense that it is compatible with the active ingredient and can be capable of stabilizing it.
  • One or more solubilizing agents can be utilized as pharmaceutical carriers for delivery of an active compound.
  • a pharmaceutically acceptable carrier include, but are not limited to, biocompatible vehicles, adjuvants, additives, and diluents to achieve a composition usable as a dosage form.
  • examples of other carriers include colloidal silicon oxide, magnesium stearate, cellulose, sodium lauryl sulfate, and D&C Yellow # 10.
  • compositions in any of the forms described above, can be used for treating disorders characterized by pathological angiogenesis.
  • An effective amount refers to the amount of an active compound/agent that is required to confer a therapeutic effect on a treated subject. Effective doses will vary, as recognized by those skilled in the art, depending on the types of diseases treated, route of administration, excipient usage, and the possibility of co-usage with other therapeutic treatment.
  • a pharmaceutical composition of this invention can be administered parenterally, orally, nasally, rectally, topically, or buccally.
  • parenteral refers to subcutaneous, intracutaneous, intravenous, intrmuscular, intraarticular, intraarterial, intrasynovial, intrasternal, intrathecal, intralesional, or intracranial injection, as well as any suitable infusion technique.
  • a sterile injectable composition can be a solution or suspension in a non-toxic parenterally acceptable diluent or solvent.
  • solutions include, but are not limited to, 1,3-butanediol, mannitol, water, Ringer's solution, and isotonic sodium chloride solution.
  • fixed oils are conventionally employed as a solvent or suspending medium (e.g., synthetic mono- or diglycerides).
  • Fatty acid such as, but not limited to, oleic acid and its glyceride derivatives, are useful in the preparation of injectables, as are natural pharmaceutically acceptable oils, such as, but not limited to, olive oil or castor oil, polyoxyethylated versions thereof.
  • oil solutions or suspensions also can contain a long chain alcohol diluent or dispersant such as, but not limited to, carboxymethyl cellulose, or similar dispersing agents.
  • a long chain alcohol diluent or dispersant such as, but not limited to, carboxymethyl cellulose, or similar dispersing agents.
  • Other commonly used surfactants such as, but not limited to, Tweens or Spans or other similar emulsifying agents or bioavailability enhancers, which are commonly used in the manufacture of pharmaceutically acceptable solid, liquid, or other dosage forms also can be used for the purpose of formulation.
  • a composition for oral administration can be any orally acceptable dosage form including capsules, tablets, emulsions and aqueous suspensions, dispersions, and solutions.
  • commonly used carriers include, but are not limited to, lactose and corn starch.
  • Lubricating agents such as, but not limited to, magnesium stearate, also are typically added.
  • useful diluents include, but are not limited to, lactose and dried corn starch.
  • compositions for topical administration can be formulated as solutions, ointments, creams, suspensions, lotions, powders, pastes, gels, sprays, aerosols, or oils.
  • topical formulations can be in the form of patches or dressings impregnated with active ingredient(s), which can optionally comprise one or more excipients or diluents.
  • the topical formulations include a material that would enhance absorption or penetration of the active agent(s) through the skin or other affected areas.
  • the topical composition is useful for treating disorders in the skin, such as melanoma and certain inflammatory disorders.
  • a topical composition contains a safe and effective amount of a dermatologically acceptable carrier suitable for application to the skin.
  • a "cosmetically acceptable” or “dermatologically-acceptable” composition or component refers a composition or component that is suitable for use in contact with human skin without undue toxicity, incompatibility, instability, allergic response, and the like.
  • the carrier enables an active agent and optional component to be delivered to the skin at an appropriate concentration(s).
  • the carrier thus can act as a diluent, dispersant, solvent, or the like to ensure that the active materials are applied to and distributed evenly over the selected target at an appropriate concentration.
  • the carrier can be solid, semi-solid, or liquid.
  • the carrier can be in the form of a lotion, a cream, or a gel, in particular one that has a sufficient thickness or yield point to prevent the active materials from sedimenting.
  • the carrier can be inert or possess dermatological benefits. It also should be physically and chemically compatible with the active components described herein, and should not unduly impair stability, efficacy, or other use benefits associated with the composition.
  • the described invention provides methods for treating in a subject an angiogenic disorder or a disorder of angiogenesis.
  • angiogenic disorder disorder of angiogenesis
  • disorder of angiogenesis disorder of angiogenesis
  • angiogenesis disorder refers to a disorder characterized by pathological angiogenesis.
  • a disorder characterized by pathological angiogenesis refers to a disorder where abnormal or aberrant angiogenesis, alone or in combination with others, contributes to causation, origination, or symptom of the disorder. Examples of this disorder include various cancers (e.g., vascularized tumors), eye disorders, inflammatory disorders, and others.
  • Typical vascularized tumors that can be treated with the method include solid tumors, particularly carcinomas, which require a vascular component for the provision of oxygen and nutrients.
  • Exemplary solid tumors include, but are not limited to, carcinomas of the lung, breast, bone, ovary, stomach, pancreas, larynx, esophagus, testes, liver, parotid, biliary tract, colon, rectum, cervix, uterus, endometrium, kidney, bladder, prostate, thyroid, squamous cell carcinomas, adenocarcinomas, small cell carcinomas, melanomas, gliomas, glioblastomas, neuroblastomas, Kaposi's sarcoma, and sarcomas.
  • arthritis rheumatoid arthritis, psoriasis, atherosclerosis, diabetic retinopathy, age
  • treatment targets include those described in, e.g., US Applications 2009004297, 20090175791, and 20070161553, such as angiofibroma, atherosclerotic plaques, corneal graft neovascularization, hemophilic joints, hypertrophic scars, Osler- Weber syndrome, pyogenic granuloma retrolental fibroplasia, scleroderma, trachoma, vascular adhesions, synovitis, dermatitis, various other inflammatory diseases and disorders, and endometriosis.
  • a “subject” refers to a human and a non-human animal.
  • a non-human animal include all vertebrates, e.g., mammals, such as non-human mammals, non-human primates (particularly higher primates), dog, rodent (e.g., mouse or rat), guinea pig, cat, and rabbit, and non-mammals, such as birds, amphibians, reptiles, etc.
  • the subject is a human.
  • the subject is an experimental animal or animal suitable as a disease model.
  • a subject to be treated for a disorder can be identified by standard diagnosing techniques for the disorder.
  • the subject can be examined for mutation, expression level, or activity level of one or more of the genes or proteins mentioned above by methods known in the art or described above before treatment. If the subject has a particular mutation in the gene, or if the gene expression or activity level is, for example, greater in a sample from the subject than that in a sample from a normal person, the subject is a candidate for treatment.
  • exemplary technologies include angiography or arteriography, a medical imaging technique used to visualize the inside, or lumen, of blood vessels and organs of the body, can generally be done by injecting a radio-opaque contrast agent into the blood vessel and imaging using X-ray based techniques such as fluoroscopy.
  • Treating refers to administration of a compound or agent to a subject who has a disorder with the purpose to cure, alleviate, relieve, remedy, delay the onset of, prevent, or ameliorate the disorder, the symptom of the disorder, the disease state secondary to the disorder, or the predisposition toward the disorder.
  • An “effective amount” or “therapeutically effective amount” refers to an amount of the compound or agent that is capable of producing a medically desirable result in a treated subject.
  • the treatment method can be performed in vivo or ex vivo, alone or in conjunction with other drugs or therapy.
  • a therapeutically effective amount can be administered in one or more administrations, applications or dosages and is not intended to be limited to a particular formulation or administration route.
  • the agent can be administered in vivo or ex vivo, alone or co-administered in conjunction with other drugs or therapy, i.e., a cocktail therapy.
  • co-administration or “co-administered” refers to the administration of at least two agent(s) or therapies to a subject.
  • the agents can be used alone or in combination with, e.g., chemotherapeutic, radiotherapeutic, apoptopic, anti-angiogenic agents and/or immunotoxins or coaguligands.
  • the co-administration of two or more agents/therapies is concurrent.
  • a first agent/therapy is administered prior to a second agent/therapy.
  • formulations and/or routes of administration of the various agents/therapies used may vary.
  • a compound or agent is administered to a subject.
  • the compound is suspended in a pharmaceutically-acceptable carrier (such as, for example, but not limited to, physiological saline) and administered orally or by intravenous infusion, or injected or implanted subcutaneously, intramuscularly, intrathecally, intraperitoneally, intrarectally, intravaginally, intranasally, intragastrically, intratracheally, or intrapulmonarily.
  • a pharmaceutically-acceptable carrier such as, for example, but not limited to, physiological saline
  • the dosage required depends on the choice of the route of administration; the nature of the formulation; the nature of the patient's illness; the subject's size, weight, surface area, age, and sex; other drugs being administered; and the judgment of the attending physician. Suitable dosages are in the range of 0.01-100 mg/kg. Variations in the needed dosage are to be expected in view of the variety of compounds available and the different efficiencies of various routes of administration. For example, oral administration would be expected to require higher dosages than administration by i.v. injection. Variations in these dosage levels can be adjusted using standard empirical routines for optimization as is well understood in the art. Encapsulation of the compound in a suitable delivery vehicle (e.g., polymeric microparticles or implantable devices) can increase the efficiency of delivery, particularly for oral delivery.
  • a suitable delivery vehicle e.g., polymeric microparticles or implantable devices
  • the described invention also provides diagnosis kits and methods.
  • a subject having cancer cells or a cells prone to tumorigenesis can be diagnosed based on the expression or activity of one or more of the above-described genes or polypeptides in a test sample from the subject.
  • the polypeptide and nucleic acids can be used as markers to indicate the presence or absence of a cancer cell or cell prone to tumorigenesis.
  • Diagnostic and prognostic assays of the described invention include methods for assessing the expression level of the polypeptide or nucleic acid.
  • the presence, level, or absence of the polypeptide or nucleic acid in a test sample can be evaluated by obtaining a test sample from a test subject and contacting the test sample with a compound or an agent capable of detecting the polypeptide or nucleic acid (e.g., mRNA probe, genomic cDNA probe, or cDNA probe).
  • the "test sample” can include tissues, cells and biological fluids isolated from a subject, as well as tissues, cells and fluids present within a subject.
  • the level of expression of the gene can be measured in a number of ways, including, but not limited to, measuring the mRNA encoded by the gene; measuring the amount of polypeptide encoded by the gene; or measuring the activity of polypeptide encoded by the gene.
  • the level of mRNA corresponding to the gene in a cell can be determined both by in situ and by in vitro formats.
  • Messenger RNA isolated from a test sample can be used in hybridization or amplification assays that include, but are not limited to, Southern or Northern analyses, PCR analyses, and probe arrays.
  • one diagnostic method for the detection of mRNA levels involves contacting the isolated mRNA with a nucleic acid probe that can hybridize to the mRNA encoded by the gene.
  • the probe can be a full- length nucleic acid, or a portion thereof, such as an oligonucleotide of at least 10 nucleotides in length and sufficient to specifically hybridize under stringent conditions to mRNA or genomic DNA.
  • mRNA (or cDNA prepared from it) is immobilized on a surface and contacted with the probes, for example, by running the isolated mRNA on an agarose gel and transferring the mRNA from the gel to a membrane, such as nitrocellulose.
  • the probes are immobilized on a surface and the mRNA (or cDNA) is contacted with the probes, for example, in a gene chip array.
  • a skilled artisan can adapt known mRNA detection methods for detecting the level of mRNA.
  • the level of mRNA (or cDNA prepared from it) in a sample encoded by one or more of the above-mentioned genes can be evaluated with nucleic acid amplification, e.g., by standard PCR (U.S. Patent No. 4,683,202), RT-PCR (Bustin S. J Mol Endocrinol. 25: 169-93, 2000), quantitative PCR (Ong Y. et al., Hematology. 7:59-67, 2002), real time PCR (Ginzinger D. Exp Hematol. 30:503-12, 2002), and in situ PCR (Thaker V. Methods Mol Biol.
  • amplification primers are defined as being a pair of nucleic acid molecules that can anneal to 5' or 3' regions of a gene (plus and minus strands, respectively, or vice- versa) and contain a short region in between. Under appropriate conditions and with appropriate reagents, such primers permit the amplification of a nucleic acid molecule having the nucleotide sequence flanked by the primers.
  • a cell or tissue sample can be prepared and immobilized on a support, such as, but not limited to, a glass slide, and then contacted with a probe that can hybridize to genomic DNA on chromosomes or mRNA that encodes the corresponding polypeptide.
  • the methods of the described invention further include contacting a control sample with a compound or agent capable of detecting mRNA, or genomic DNA, and comparing the presence of mRNA or genomic DNA in the control sample with the presence of mRNA or genomic DNA in the test sample.
  • nucleic acid-based diagnostic methods can provide qualitative and quantitative information to determine whether a subject has or is predisposed to a disease associated with aberrant gene expression and aberrant angiogenesis, e.g., cancers.
  • a variety of methods can be used to determine the level of one or more of the above-mentioned polypeptide.
  • these methods include contacting an agent that selectively binds to the polypeptide, such as an antibody, to evaluate the level of polypeptide in a sample.
  • Antibodies can be polyclonal, or monoclonal. An intact antibody, or a fragment thereof (e.g., Fab or F(ab') 2 ) also can be used.
  • the antibody bears a detectable label.
  • the term "labeled", with regard to the probe or antibody is intended to encompass direct labeling of the probe or antibody by physically linking a detectable substance to the probe or antibody, as well as indirect labeling of the probe or antibody by reactivity with a detectable substance.
  • an antibody with a rabbit Fc region can be indirectly labeled using a second antibody directed against the rabbit Fc region, wherein the second antibody is coupled to a detectable substance.
  • detectable substances include, but are not limited to, radio isotopes (for example, but not limited to, 125 I, 131 I, 35 S, 3 H, or 32 P), enzymes (for example, but not limited to, alkaline phosphatase, horseradish peroxidase, luciferase, or ⁇ -glactosidase), fluorescent moieties or proteins (for example, but not limited to, fluorescein, rhodamine, phycoerythrin, GFP, or BFP), or luminescent moieties (for example, but not limited to, QdotTM nanoparticles by the Quantum Dot Corporation, Palo Alto, CA).
  • the detection methods can be used to detect one or more of the above-mentioned polypeptide in a biological sample in vitro as well as in vivo.
  • In vitro techniques for detection of the polypeptide include ELISAs, immuno-precipitations, immunofluorescence, EIA, RIA, and Western blotting analysis.
  • In vivo techniques for detection of the polypeptide include introducing into a subject a labeled antibody.
  • the antibody can be labeled with a detectable substance as described above. The presence and location of the detectable substance in a subject can be detected by standard imaging techniques.
  • the diagnostic methods described herein can identify subjects having, or at risk of developing, a disease or disorder associated with aberrant expression or activity of one or more of the above-mentioned polypeptides.
  • a disease or disorder include those described above.
  • the prognostic assays described herein can be used to determine whether a subject is suitable to be administered with an agent (e.g., an agonist, antagonist, peptidomimetic, protein, peptide, nucleic acid, small molecule, or other drug candidate) to treat a disorder, such as cancer.
  • an agent e.g., an agonist, antagonist, peptidomimetic, protein, peptide, nucleic acid, small molecule, or other drug candidate
  • a disorder such as cancer
  • an agent e.g., an agonist, antagonist, peptidomimetic, protein, peptide, nucleic acid, small molecule, or other drug candidate
  • diagnostic assays provide information useful in prognostication, identifying progression of and management of malignancies (cancers) that are characterized by abnormal, pathological angiogenesis.
  • the information more specifically assists the clinician in designing chemotherapeutic or other treatment regimes to eradicate such malignancies from the body of an afflicted mammal, e.g., a human.
  • This example describes general methods and materials used in Examples 2-8.
  • mice were given drinking water with 5% sucrose.
  • lxlO 6 293T cells were seeded onto a 10 cm plate and incubated for 24h. Twelve micrograms of vector K (Gag/Pol), 6 ⁇ g of vector A (Env) and 12 ⁇ g of the appropriate shRNA plasmid were then co-transfected into the 293T cells using 40 of TRANSIT®-293 transfection reagent (MIR 2700, MIRUS BIO LLC, Madison, WI). After 16h, the media was replaced with fresh antibiotic-free DMEM supplemented with 10% FBS.
  • TRANSIT®-293 transfection reagent MIR 2700, MIRUS BIO LLC, Madison, WI
  • the virus was harvested by spinning for 5 min at l,500g before being filtered through a 0.45 ⁇ filter.
  • H29 cells were seeded onto a 10-cm plate and allowed to grow to 90% confluence. Ten micrograms of the appropriate plasmid was then transfected into H29 cells using 60 ⁇ of LIPOFECT AMINETM 2000 transfection reagent (11668-019, INVITROGEN by LIFE TECHNOLOGIES, Carlsbad, CA). After 16h, the media were replaced with fresh antibiotic-free DMEM supplemented with 10% FBS. After another 48h, the virus was harvested by spinning for 5 min at l,500g and filtered through a 0.45 ⁇ filter.
  • Two milliliters of the appropriate virus was used to transduce 50K cancer cells in the presence of 10 ⁇ g/mL of polybrene (TR-1003-G, MILLIPORE, Billerica, A). After 24h, the media was changed to DMEM supplemented with 10% FBS and 2 ⁇ g/mL puromycin (lentivirus) or 10 ⁇ g/mL blasticidin for selection. After another 72h, the cells were washed and allowed to grow in D10F and tested for knock down of the gene of interest by qPCR.
  • polybrene TR-1003-G, MILLIPORE, Billerica, A
  • HUVEC cells (25,000) were seeded into 24-well plates approximately 24h before the start of the recruitment assay. HUVEC cells were serum starved in EGM-2 media supplemented with 0.2% FBS for 24 hours. The HUVEC cells were then labeled with CELLTRACKER Red CMTPX dye (C34552, INVITROGEN) for 45 min and rescued in EGM-2 media supplemented with 2% FBS for 30 min. Meanwhile, cancer cells were washed with PBS and 1 mL 0.2% FBS EGM-2 media was added to each well. Each well was then fitted with a 3.0 ⁇ HTS FLUROBLOCK Insert (351151, BD FALCON, San Jose, CA).
  • CELLTRACKER Red CMTPX dye C34552, INVITROGEN
  • each antibody was then added to each well: 50 ng/mL anti-IGFBP2 (AF674, R&D SYSTEMS, Minneapolis, MN), 20 ⁇ g/mL anti-IGF-1 (AF-291-NA, R&D SYSTEMS), 40 ⁇ g/mL anti-IGF-2 (MAB292, R&D SYSTEMS), 20 ⁇ g/mL anti-IGFIR (MAB391, R&D SYSTEMS), 5 ⁇ g/mL anti-IGF2R (AF2447, R&D Systems) and anti-IgG (AB-108-C, R&D SYSTEMS).
  • anti-IGFBP2 AF674, R&D SYSTEMS, Minneapolis, MN
  • 20 ⁇ g/mL anti-IGF-1 AF-291-NA, R&D SYSTEMS
  • 40 ⁇ g/mL anti-IGF-2 MAB292, R&D SYSTEMS
  • 20 ⁇ g/mL anti-IGFIR MAB391,
  • HUVEC cells or cancer cells were then incubated with 20 ⁇ g/mL anti-IGFIR or control IgG antibody for lh and washed once with PBS.
  • the HUVEC cells were then serum starved for lh before being resuspended 0.2% FBS EGM-2 at 100K HUVECs per mL.
  • the resuspension (0.5 mL) was then added into each FLUOROBLOCK insert and the recruitment assay was allowed to proceed for 16h.
  • FLUOROBLOCK inserts were fixed with 4% paraformaldehyde for 15 min and mounted onto slides with VECTASHIELD mounting media (H-1000, VECTOR LABORATORIES, Burlingame, CA). Three images of each insert were taken and the images were analyzed using IMAGEJ (NIH).
  • Matrigel 250 ⁇ , BD BIOSCIENCES, #356231 containing given amounts of bovine serum albumin (A2153, Sigma Aldrich), rhIGFBP2 (674-B2, R&D Systems), rhGas6 (885-GS, R&D Systems), anti-IGFIR (MAB391, R&D Systems) and MerFc (891- MR-100, R&D Systems) were allowed to solidify at the bottom of a 24 well plate for 30 min before 250 ⁇ HUVEC media containing 0.2% FBS were added. A 3.0- ⁇ HTS Fluroblock Insert (351151, BD Falcon) was then placed in each well.
  • bovine serum albumin A2153, Sigma Aldrich
  • rhIGFBP2 (674-B2, R&D Systems
  • rhGas6 885-GS, R&D Systems
  • anti-IGFIR MAB391, R&D Systems
  • MerFc 891- MR-100, R&D Systems
  • HUVEC cells were labeled with CellTracker Red CMTPX dye (C34552, Invitrogen) before resuspending 300K HUVECs per mL of 0.2% FBS EGM-2. 0.5 mL of the resuspension was then added into each Fluoroblock insert and the assay allowed proceeding for 20h. The inserts were then fixed for 15 min in 4% paraformaldehyde and mounted onto slides with VectaShield mounting media (H-1000, Vector Laboratories). 5 fields of the basal side of each insert were then imaged and the images were analyzed using ImageJ (NIH).
  • CMTPX dye C34552, Invitrogen
  • HUVEC cells were grown to 90% confluence and stimulated in the given concentrations of bovine serum albumin (Sigma Aldrich, #A2153), rhIGFBP2 (674-B2, R&D Systems) and anti-IGFIR (MAB391, R&D Systems) in HUVEC media containing 0.2% FBS for 40 min at 37°C. The cells were then trypsinized and 50K cells were added into HTS Fluroblock Inserts (351151, BD Falcon). After 24 hours in 37°C with 5% C0 2 , the inserts were removed, the membrane excised and fixed in 4% paraformaldehyde. HUVEC cells that had migrated to the basal side of the membrane were visualized with DAPI and counted in 5 fields per membrane using Image J (NIH).
  • bovine serum albumin Sigma Aldrich, #A2153
  • rhIGFBP2 (674-B2, R&D Systems
  • anti-IGFIR MAB391, R&D Systems
  • HUVEC cells were seeded on a 6-cm plate and allowed to grow to confluence.
  • Cancer cells were serum starved in DMEM media supplemented with 0.2% FBS for 30 min, labeled with CELLTRACKER Green CMFDA dye (C7025, Invitrogen) for 45 min and incubated in DMEM media supplemented with 10% FBS for 30 min. Cancer cells were then trypsinized and resuspended in 10% FBS/DMEM to 10K cells/mL. Five milliliters of the resuspension was then added to each plate of HUVECs and the plate was incubated at 37°C for 10 min. The plates were then washed gently with PBS and fixed with 4% paraformaldehyde for 15 min. Each plate was then treated with 1 mL of PBS and 6 images were taken from each plate. The number of cancer cells adherent to the HUVEC cells were then quantified using IMAGEJ.
  • CELLTRACKER Green CMFDA dye C7025, Invitrogen
  • Cancer cells (lxlO 6 ) were seeded to a 10-cm plate and allowed to grow for 24h. The cancer cells were then washed gently with PBS and EGM-2 media supplemented with 2% FBS was added to each plate. The conditioned EGM-2 media was collected after 24h. HUVEC cells (25K) were seeded in triplicate in a 6-well plate and allowed to grow for 16h. The HUVEC cells were then washed gently with PBS and 3 mL conditioned EGM-2 media was added to each well. After 48h, the conditioned media was replaced with another 3 mL of conditioned media. After another 48h, the cells were trypsinized and counted using a haemocytometer.
  • Tube formation assay was performed according to manufacturer's protocol (354149, BD BIOCOATTM ANGIOGENES IS SYSTEM - Endothelial Cell Tube Formation). Briefly, HUVEC cells were serum starved in EGM-2 media supplemented with 0.2% FBS for 24 hours. The HUVEC cells were then labeled with CELLTRACKER Red CMTPX dye (C34552, INVIT ROGEN) for 45 min and subsequently treated in EGM- 2 media supplemented with 2% FBS for 30 min. Meanwhile, the tube formation assay plate, which was in 96-well format, was incubated at 37°C for 30 min.
  • CELLTRACKER Red CMTPX dye C34552, INVIT ROGEN
  • the cancer cells and HUVEC cells were trypsinized and resuspended at 400K/mL and 800K/mL respectively in EGM-2 media supplemented with 2% FBS.
  • the cancer cell and HUVEC cell suspensions were then mixed at a 1: 1 ratio and 50 ⁇ of each mixture was seeded into each well of the tube formation assay plate.
  • the assay plate was incubated at 37°C for 16h. Images of each well were taken and the images were processed using METAMORPH analysis software (MOLECULAR DEVICES, Inc.) to obtain the number of branch points per image.
  • TNFSF4 GTATCCTCGAATTCAAAGTATCAAAGT CTGAGTTGTTCTGCACCTTCA
  • Potential miR-126 targets were identified by using 3 sets of microarray profiles: LM2 control cells relative to LM2 cells over-expressing miR-126 (GSE No. 23905) and 2 replicate arrays of MDA and LM2 cells (GSE No. 23904 and Minn, A. J. et al, Nature 436 (7050), 518 (2005). With these arrays, the following criteria were used to identify possible miR-126 targets genes: (1) Genes down-regulated more than 1.6 fold upon miR- 126 over-expression in LM2 cells and (2) Genes up-regulated by more than 1.4 fold in one of the two LM2 versus MDA arrays. All potential targets were subsequently verified by qPCR.
  • Luciferase reporter assay was performed as described in Tavazoie, S. F. et al., Nature 451 (7175), 147 (2008). Briefly the full-length 3'UTR's and CDS's of ABCB9, IGFBP2, MERTK, PITPNCl, PSATl, PYGB, SHMT2 and VIPRl were cloned into the psiCheck2 dual luciferase reporter vector (C8021, PROMEGA, Madison, WI). Listed below are the sequences of the CDS's and 3'UTR's.
  • TCAGAGAAGA CAGGACGGGG ACAGTTGAGG GAAGGCTGGA GAGATAGTCA TCAGCCTATC
  • MDA-MB-231 cells expressing either a control hairpin or a hairpin targeting miR- 126 were transfected with the respective specific reporter construct. Thirty hours after transfection, the cells were lysed and the ratio of renilla to firefly luciferase expression was determined using the dual luciferase assay (E1910, PROMEGA). Cloning primer sequences are shown in Table 2 below.
  • miR-126 sites in genes were identified by alignment to the complementary miR- 126 sequence 5-TTACTCACGGTACGA-3, and mutagenesis was performed using the QUICKCHANGE Multi Site-Directed Mutagenesis Kit (200514, AGILENT TECHNOLOGIES, Santa Clara, CA). Based on the UCSC genome browser the 3'UTR of MERTK was mutated at position 5 (GTT to CAC), the 3'UTR of IGFBP2 was mutated at position 246 (GGT to CAC), the CDS of PITPNCl was mutated at position 709 (TAC to GTA) from the start codon and the CDS of SHMT2 was mutated at position 1126 (GGT to CAC). Mutagenesis primers are in shown in Table 3 below.
  • LM2 cells 2.5 X 10 4 expressing a control hairpin or short hairpins targeting IGFBP2, PITPNCl or MERTK were seeded in triplicate in 6 well plates and viable cells were counted at 5 days after seeding.
  • Lungs were prepared by perfusion fixation with 4% paraformaldehyde infused through the vascular system and through the trachea. After excision, the lungs were placed in 4% paraformaldehyde overnight and embedded in paraffin. Five minutes prior to fixation, 100 mg biotinylated lectin (B-1175, VECTOR LABORATORIES) was injected into the circulation via the tail vein.
  • the MECA-32 and lectin signals were quantified using IMAGEJ while the metastatic nodules' extents were determined through co-staining with human vimentin.
  • the collective area covered by vessels was determined by subtracting background (rolling ball radius of 1 pixel) and by using a pre-determined threshold as cut-off.
  • Vessel density is given as the percentage of area covered by the blood vessels compared to the total area of the metastatic nodule.
  • a metastatic nodule was defined by an area positive for vimentin staining with a total area above 2000 ⁇ .
  • Mammary fat pad tumors were excised and submerged into 4% paraformaldehyde for 24 hours.
  • the fixed tissue was embedded in paraffin and sectioned in 5 ⁇ thick slices.
  • Immuno-detection were performed using antibodies directed towards MECA-32 (Developmental Studies Hybridoma Bank), Mac-2 (CL8942AP, Cederlane, Burlington) and CD45 (550539, BD Biosciences). Detection of primary antibodies was performed using various biotinylated secondary antibodies (Vector Laboratories). The signal was subsequently amplified using the ABC kit (Vector Laboratories), and detected using DAB (3,3'-diaminodbenzidine). Before mounting the slides were counterstained with hematoxilin.
  • IGBFP2 levels in conditioned media were determined using an IGFBP2 ELISA (AAHBLG-1-2, RAYBIOTECH, Norgross, GA).
  • Cellular lysates from MDA-MB-231 cells were prepared by lysing cells in 1 ml ice-cold RIPA buffer containing protease inhibitors (ROCHE, Mannheim, Germany). Conditioned media were prepared by incubating MDA-MB-231 cells in serum free media for 24 hours. The media was then concentrated twenty times by spin filtering. 40 ⁇ g protein was subsequently separated on a 4-12% SDS-PAGE, and transferred to a PVDF membrane. A monoclonal antibody against human MERTK (CVO-311, CAVEO THERAPEUTICS, Aurora, CO) was used to detect MERTK.
  • CVO-311 CAVEO THERAPEUTICS, Aurora, CO
  • the Kolmogorov-Smirnov test was used to determine the significance of difference in the blood vessel density for both MECA-32 and lectin staining using the publicly available software at physics.csbsju.edu/stats/KS-test.html.
  • assays were carried out to analyze metastatic progression in the setting of miR-126 loss-of-function. This enabled one to compare in vivo metastatic events between control and miR-126 knockdown (KD) cells and to reveal the influence of endogenous miR-126 on metastatic colonization.
  • KD miR-126 knockdown
  • a MDA-231 breast cancer cell line was generated in which miR-126 was stably knocked down (94% knock down; FIG. 7) using the miR-Zip anti-sense hairpin microRNA inhibition system.
  • miR-126 KD and control KD cells were injected into immunodeficient mice and evaluated for metastatic colonization capacity in tail-vein colonization assays.
  • miR-126 silencing provides a metastatic initiation advantage for cells as they initiate metastases in the metastatic niche
  • its induction in the initial phase of metastasis formation should reduce the number of metastatic nodules.
  • miR-126 expression was induced in metastatic breast cancer cells (LM2) displaying silencing of this miRNA using a conditional tet-on system. Consistent with this, restoring miR-126 expression to LM2 cells after they have extravasated in the lung (Day 3) significantly reduced metastatic colonization (FIG. If).
  • restoring miR-126 expression at this early phase of metastasis initiation in the niche significantly reduced the number of metastasis nodules visualized at day 49.
  • miR-126 The ability of miR-126 to regulate various cancer-endothelial interactions such as endothelial adhesion, endothelial proliferation, and tube-formation was analyzed in LM2 metastatic cells (originally derived from the poorly metastatic MDA-231 population, Minn, A. J. et al., Nature 436 (7050), 518 (2005)) in co-culture with human umbilical vein endothelial cells (HUVECs). Restoring miR-126 expression to LM2 cells, which display silencing of miR-126, did not suppress adhesion of metastatic cells to endothelial cells (FIG. 2c), proliferation of endothelial cells (FIG. 2d), or tube formation as assessed by automated quantification of branch points (FIG. 2e). Consistent with this, inhibition of miR-126 in MDA-231 cells did not enhance these angiogenic phenotypes either (FIGs. 9a- c).
  • the CN34LMla line a highly lung metastatic derivative that was previously obtained through in-vivo selection of the CN34 primary malignant population (Tavazoie et al., Nature 451 (7175), 147 (2008)) (an independent primary malignant population obtained from the pleural fluid of a patient with metastatic breast cancer Gupta et al., Nature 446 (7137), 765 (2007)), also displayed significantly enhanced endothelial recruitment capacity compared to its poorly metastatic parental line (FIG. 2h). Both gain- and loss-of-function experiments revealed miR-126 to significantly suppress endothelial recruitment by the CN34 population as well (FIG. 2i). The findings reveal enhanced endothelial recruitment capacity to be a key feature of metastatic breast cancer populations and identify endogenous miR-126 as a major regulator of this process.
  • Metastatic breast cancer cells expressing a control hairpin or over-expressing miR-126 were thus implanted into the mammary fat pads of mice.
  • Endothelial recruitment to metastatic cells in the mammary fat pad was inhibited by miR-126 expression (FIG. 2j), while miR-126 knockdown in poorly metastatic cells significantly increased endothelial recruitment to and functional vessel content of breast tumors growing in mammary fat pads as determined by meca-32 staining (FIG.
  • miR-126 selectively regulates endothelial recruitment to breast cancer cells independent of their anatomic location.
  • a systematic search was conducted to identify the molecular targets of miR-126 that mediate endothelial recruitment and metastatic colonization. Specifically, transcriptomic analysis of LM2 cells over-expressing miR-126 was performed and global transcript alterations to poorly metastatic MDA-231 cells and highly metastatic LM2 cells were compared.
  • miR-126 in inhibiting metastasis, the biological mediators of miR-126 display increased expression in metastatic cells and that they would be suppressed by this miRNA.
  • a set of 23 genes were identified as they were suppressed upon miR-126 over-expression (>1.6- fold; FIG. 11; Table 4), and up-regulated (> 1.4-fold) in metastatic cells relative to the parental MDA-231 line (FIG. 11).
  • ARHGAP5 -2.04 WSB 1 -1.85 LOC441453 -1.74 CNTNAP3 -1.67
  • binding protein IGF-binding protein 2 the receptor kinase MERTK, the phosphatidylinositol transfer protein PITPNCl, and the hydroxymethyltranferase enzyme
  • SHMT2 comprise a set of direct targets of miR- 126 in human breast cancer.
  • EXAMPLE 6 IGFBP2, PITPNCl, and MERTK Promote Endothelial Recruitment and Metastasis
  • assays were carried out to examine if any of the miR-126 target genes regulate the recruitment of endothelial cells by cancer cells.
  • knockdown of IGFBP2, MERTK, or PITPNCl using independent short hairpins significantly suppressed the ability of metastatic LM2 cells to recruit endothelial cells
  • stage III and stage IV breast cancers display local metastatic dissemination and distal metastases, respectively, and collectively comprise those that develop distal relapse at much higher rates than stage I and II patients.
  • expression levels of IGFBP2 P ⁇ 0.0003
  • MERTK P ⁇ 0.002
  • PITPNCl P ⁇
  • stage III and IV patients were individually significantly increased in primary cancers of stage III and IV patients relative to stage I and II patients (FIG. 4b). Given their requirement for endothelial recruitment by metastatic cells, as well as their direct targeting by miR- 126, it was sought to determine if any of the miR- 126 target genes are required for metastatic colonization.
  • IGFBP2 is a secreted factor and, as such, poised to mediate inter-cellular communication between metastatic cancer cells and endothelial cells.
  • ELISA analysis revealed metastatic LM2 cells to secrete 2.1 -fold higher levels of this factor than the poorly metastatic MDA-231 parental line (FIG. 5a).
  • IGFBP insulin-like growth factors
  • IGFBP2 was known to bind both IGF1 and IGF2 in the extracellular space and modulate their signaling activity (Jones, J. I. et al. Endocr Rev 16 (1), 3 (1995); Arai, T., et al. Endocrinology 137 (11), 4571 (1996); Rajaram, S., et al. Endocr Rev 18 (6), 801 (1997); and Hoflich, A. et al, FEBS Lett 434 (3), 329 (1998)). To determine which IGF mediates miR-126-dependent endothelial recruitment, cells were treated with blocking antibodies against IGF1, IGF2, or with immunoglobulin control. Antibody-mediated inhibition of IGF1, but not IGF2, significantly reduced endothelial recruitment resulting from miR-126 knockdown (FIG. 5d).
  • assays were carried out to investigate the mechanisms by which the other miR-126 target genes PITPNC1 and MERTK mediate endothelial recruitment.
  • MERTK receptor exists in both membrane bound and soluble forms, where the extracellular domain has been cleaved and thus generally is believed to act as a decoy receptor to negatively regulate MERTK receptor activation on cells expressing it (Sather, S. et al., Blood (3), 1026 (2007). Soluble MERTK was detected in conditioned media of MDA-MB-231 cells (FIG. 16). Without being bound by theory, soluble MERTK released from cancer cells may promote endothelial recruitment through binding and inhibition of GAS6.
  • trans-well chemotactic assays were performed for quantifying the chemo tactic migration of endothelial cells towards these factors.
  • Recombinant GAS6 at low, physiological doses inhibited endothelial chemotaxis towards recombinant IGFBP2 (FIG. 6c).
  • recombinant soluble MERTK ectodomain abrogated the GAS6 suppressive effect on endothelial chemotaxis (FIG. 6c).
  • a miRNA expressed in cancer cells can non-cell-autonomously regulate the complex process of metastatic endothelial recruitment and vascular perfusion through the coordinate regulation of IGFBP2, MERTK, and PITPNC1 - a novel set of angiogenesis and metastasis genes. It was found that the increased expression of these metastatic angiogenesis genes endows highly metastatic breast cancer cells with enhanced endothelial recruitment capacity relative to poorly metastatic cells. Metastatic cells over-expressing these genes are able to more readily establish blood vessels needed for effective colonization. Although the requirement for all of these three genes in metastatic endothelial recruitment was demonstrated, one of them, i.e., secreted IGFBP2, is a trans-cellular mediator of this phenotype.
  • IGF1 signaling pathway modulated by IGFBP2 secreted from cancer cells and culminating in IGF1R activation on endothelial cells— as a mediator of metastatic-cell endothelial recruitment and have identified miR- 126 in cancer cells as a regulator of this pathway.
  • IGF1 and IGF2 have been reported (Laviola, L., et al. Curr Pharm Des 13 (7), 663 (2007) and Varela-Nieto, I., et al.
  • IGFBP2 is one of 16 members of the IGFBP family; see Schmid, C, Cell Biol Int 19 (5), 445 (1995); Hwa, V., et al. Endocr Rev 20 (6), 761 (1999); and Firth, S. M. et al. Endocr Rev 23 (6), 824 (2002). Identification of IGFBP2 as a promoter of metastasis, its over-expression in metastatic human breast cancer, and the robust effect of its antibody- mediated inhibition on endothelial recruitment by metastatic cells provides a specific handle for therapeutic targeting of the IGF pathway in breast cancer progression and cancer angiogenesis.
  • IGFBP2 was identified as a positive regulator of endothelial recruitment through its activation of a positive regulator of this process (IGF1)
  • MERTK was also discovered as a promoter of recruitment through its inhibition of a negative regulator of endothelial chemotaxis (GAS6).
  • GAS6 endothelial chemotaxis
  • miR-126 which is developmentally expressed in endothelial cells
  • endothelial- expressed miR-126 was thus found to be a promoter of normal developmental angiogenesis in mouse and zebrafish systems (Nicoli, S. et al., Nature 464 (7292), 1196 (2010) and Fish, J. E. et al, Dev Cell 15 (2), 272 (2008).)
  • miR-126 In view of its role as an angiogenesis promoter, it was unexpected that miR-126 also suppressed angiogenesis in, e.g., breast cancer, as disclosed herein. It was unexpected that miR-126 could act in at least two different ways. On one hand, it acts in a cell-type specific fashion to suppress pathologic angiogenesis as disclosed in this application. As disclosed in this application, miR-126 suppressed pathologic endothelial migration to metastases. On the other hand, while in development miR-126 expression maintains vessel integrity. Indeed, endothelial miR-126 was shown to regulate developmental angiogenesis through targeting of Spred-1 and PIK3R2, genes that were not significantly regulated by miR-126 in breast cancer cells (Wang, S.
  • This example describes two approaches for identifying a gene or a non-coding
  • the lenti-miR library (SYSTEM BIOSCIENCES, Cat # PMIRHPLVAHT- 1 ) was used in this approach.
  • This library consists of a pool of lentivirus containing precursor microRNAs representative of the entire human genome.
  • Parental populations of the SW620 and LS174T cell-lines (2 x 10 5 cells) were transduced with the library at a multiplicity of infection (MOI) of 1 to obtain a heterogeneous pool of parental cells with individual cells over-expressing different microRNA.
  • MOI multiplicity of infection
  • Each microRNA precursor was represented at approximately 50X after transduction.
  • Four days after transduction a half- portion of the transduced cells were set aside and genomic DNA extracted using Qiagen DNeasy kit. This was the reference pool of genomic DNA prior to the selective pressure of liver colonization. The remaining half population was injected into the livers of NOD/SCID mice. 3-5 weeks after injection, genomic DNA was extracted from the tumors that formed in the livers. Transductions and injections were
  • Lenti-miR derived microRNA precursors were recovered from genomic DNA by PCR amplification in the linear range using library- specific, T7 promoter-containing primers (forward primer: 5'-
  • the resulting PCR amplicons were a composite of different precursor microRNAs with T7 promoter sequences and were used as templates for in vitro transcription to obtain a biotinylated precursor library.
  • the biotinylated library obtained from the reference pool and tumors were labeled with Cy3 and Cy5 respectively and hybridized to a microarray designed to detect the microRNA sequences (Genosensor).
  • a dye-swap experiment was performed to control for dye -bias.
  • microRNAs that became over-represented in the tumor population compared to the reference pool were considered as promoters and microRNAs that were under-represented, suppressors of liver colonization.
  • the lentiplex whole-genome shRNA library (SIGMA- ALDRICH, Cat # SHPH01) was used in this approach.
  • This library is a pooled library of lentivirus containing approximately 150,000 shRNAs targeting the whole human genome, with each gene being targeted by 3-5 independent shRNAs.
  • PCR approach followed by Solexa deep sequencing of PCR amplicons were used.
  • An initial PCR amplification was performed on 500ng of genomic DNA using primers (forward primer: 5 ' -TGGACTATCATATGCTTACCGTAACT-3 ' ; reverse primer: 5'- AAAGAGGAT CTCTGTCCCTGT-3') specific for the virus vector, followed by primers with sequences required for Solexa deep sequencing (forward primer: 5'- AATGATACGGCGACCACCGAG
  • the count for each shRNA species was normalized against the total number of sequences obtained and their gene targets identified by matching to a database provided by Sigma. Gene targets whose shRNAs which became over-represented in the tumor pool are considered suppressors of liver colonization and vice versa. To account for non-specific effects of shRNA- silencing, only gene targets hit identified by three or more independent shRNA "hits" were considered as putative suppressors or promoters.
  • EXAMPLE 11 Monoclonal antibody that neutralizes IGFBP2 function inhibited endothelial recruitment by metastatic human breast cancer cells.
  • This example demonstrates a monoclonal antibody that inhibits endothelial recruitment by metastatic breast cancer cells by binding to IGFBP2 and inhibiting the interaction (binding) of IGF1 to IGFBP2.
  • this monoclonal antibody is capable of inhibiting endothelial recruitment by metastatic human breast cancer cells.
  • the methods used to generate neutralizing antibodies to IGFBP2 are those commonly known in the art.
  • mice were immunized with recombinant IGFBP2 total peptide to generate a polyclonal antibody response.
  • hybridomas libraries were generated by fusion of B cells isolated from the immunimized mice to myeloma cell lines. Supernatant from these hybridomas were then isolated in order to screen and identify those hybridoma cells generating antibodies that bind IGFBP2 with high affinity, using antibody capture competitive ELISA assays (FIG. 20). Once identified, hybridomas generating antibodies with high affinity to IGFBP2 were screened in order to identify those that generate antibodies capable of inhibiting IGFBP2 from binding IGF1, using antibody capture competitive ELISA assays (FIG. 21).
  • Hybridoma library wo6663-l contained antibodies that bound to IGFBP2 to neutralize IGF1 binding, without binding to other IGFBP family members IGFBP3 and IGFBP4 (FIGs. 20 and 21).
  • To isolate single clones (monoclonal) hybridoma cells seperation and screening was performed on hybridoma library wo6663-l. 2000 single hybridoma clones (monoclonal) were screened from this library to identify those that generated monoclonal antibodies that bound to IGFBP2 with high affinity to neutralize IGF1 binding .
  • IGFBP2_14 (M14) (dashed box in FIG. 22).
  • IGFBP2_14 The monoclonal antibody IGFBP2_M14 (M14) inhibited endothelial recruitment by human metastatic breast cancer cells:
  • IGFBP2 neutralizing monoclonal antibodies generated in the above screen were tested in an in vitro endothelial recruitment assay using transwells.
  • Highly metastatic LM2 human breast cancer cells were placed in the bottom of a Boyden chamber, where their ability to recruit HUVECS through a porous trans-well insert could be assayed.
  • Small physiologic concentration of IGFBP2 neutralizing antibodies including Ml, M4, M6, M9, M13, M14, Ml 5, and M16 (from FIG. 22) were added to the transwells individually in physiologic concentrations. Of all antibodies tested, M14 (dashed box in FIG.
  • EXAMPLE 12 Monoclonal antibody M14 inhibited tumor progression of human breast cancer in vivo.
  • IGFBP2 neutralizing antibody Ml 4 is capable of inhibiting tumor progression and tumor metastasis in vivo in a mouse model of human breast cancer.
  • Intraperitoneal injections of PBS and M14 antibody were given immediately on Day 0 to mice in each group respectively, and then subsequently, injections were given biweekly. Tumor burden in both the M14 treated and PBS treated control mice were followed twice a week by bioluminensence from the luciferase reporter. At day 14, tumor progression was significantly inhibited by treatment with M 14 (7 to 11 fold reduction in tumor progression) compared with the PBS treated mice (FIG. 24).

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • General Health & Medical Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Zoology (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Wood Science & Technology (AREA)
  • Biomedical Technology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Immunology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Microbiology (AREA)
  • Physics & Mathematics (AREA)
  • Epidemiology (AREA)
  • Oncology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Analytical Chemistry (AREA)
  • Pathology (AREA)
  • Plant Pathology (AREA)
  • Marine Sciences & Fisheries (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Hospice & Palliative Care (AREA)
  • Mycology (AREA)
  • Endocrinology (AREA)
  • Pain & Pain Management (AREA)
  • Rheumatology (AREA)
PCT/US2012/024697 2011-02-11 2012-02-10 Treatment of angiogenesis disorders Ceased WO2012109567A2 (en)

Priority Applications (13)

Application Number Priority Date Filing Date Title
EP12745124.3A EP2673363B1 (en) 2011-02-11 2012-02-10 Treatment of angiogenesis disorders
EP19191593.3A EP3604534A1 (en) 2011-02-11 2012-02-10 Method for identifying nucleic acids regulating metastasation
JP2013553604A JP6178241B2 (ja) 2011-02-11 2012-02-10 血管新生障害の処置
ES12745124.3T ES2645366T3 (es) 2011-02-11 2012-02-10 Tratamiento de trastornos de la angiogénesis
DK12745124.3T DK2673363T3 (da) 2011-02-11 2012-02-10 Behandling af angiogenesesygdomme
EP17184170.3A EP3301176B1 (en) 2011-02-11 2012-02-10 Method for identifying nucleic acids regulating metastasation
US13/984,760 US8980261B2 (en) 2011-02-11 2012-02-10 Treatment of angiogenesis disorders
CA2841404A CA2841404C (en) 2011-02-11 2012-02-10 Treatment of angiogenesis disorders
US13/963,657 US8715660B2 (en) 2011-02-11 2013-08-09 Treatment of angiogenesis disorders
US14/658,927 US9493841B2 (en) 2011-02-11 2015-03-16 Treatment of angiogenesis disorders
US15/629,971 US10301684B2 (en) 2011-02-11 2017-06-22 Treatment of angiogenesis disorders
US16/415,472 US10894989B2 (en) 2011-02-11 2019-05-17 Treatment of angiogenesis disorders
US17/140,409 US12060619B2 (en) 2011-02-11 2021-01-04 Treatment of angiogenesis disorders

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201161441738P 2011-02-11 2011-02-11
US61/441,738 2011-02-11

Related Child Applications (3)

Application Number Title Priority Date Filing Date
US13/984,760 A-371-Of-International US8980261B2 (en) 2011-02-11 2012-02-10 Treatment of angiogenesis disorders
US13/963,657 Continuation US8715660B2 (en) 2011-02-11 2013-08-09 Treatment of angiogenesis disorders
US14/658,927 Division US9493841B2 (en) 2011-02-11 2015-03-16 Treatment of angiogenesis disorders

Publications (2)

Publication Number Publication Date
WO2012109567A2 true WO2012109567A2 (en) 2012-08-16
WO2012109567A3 WO2012109567A3 (en) 2012-11-01

Family

ID=46639221

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2012/024697 Ceased WO2012109567A2 (en) 2011-02-11 2012-02-10 Treatment of angiogenesis disorders

Country Status (7)

Country Link
US (6) US8980261B2 (cg-RX-API-DMAC7.html)
EP (3) EP2673363B1 (cg-RX-API-DMAC7.html)
JP (4) JP6178241B2 (cg-RX-API-DMAC7.html)
CA (2) CA3146962A1 (cg-RX-API-DMAC7.html)
DK (1) DK2673363T3 (cg-RX-API-DMAC7.html)
ES (2) ES2645366T3 (cg-RX-API-DMAC7.html)
WO (1) WO2012109567A2 (cg-RX-API-DMAC7.html)

Families Citing this family (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2673363B1 (en) 2011-02-11 2017-08-23 The Rockefeller University Treatment of angiogenesis disorders
TWI465241B (zh) * 2012-12-19 2014-12-21 Ind Tech Res Inst 圓柏(Juniperus chinensis)萃取物或木酚素(lignan)用於製造抑制血管新生之藥物的用途
HUP1300509A2 (hu) * 2013-08-30 2015-03-30 Gabor Firneisz CXCL12 (Chemokine (C-X-C motif) Ligand 12) és IGFBP2 (Insulin-Like Growth Factor Binding Protein 2) gátlók cukorbetegséggel összefüggõ hasnyálmirigyrák kezelésénél történõ alkalmazásra
ES2688737A1 (es) * 2017-05-04 2018-11-06 Universidad Del País Vasco / Euskal Herriko Unibertsitatea Método para diagnosticar placa ateroesclerótica inestable
CN112469732A (zh) * 2018-07-17 2021-03-09 赫利世弥斯株式会社 使用胰岛素样生长因子1-加密脱氧核糖核酸构建体及肝细胞生长因子-加密脱氧核糖核酸构建体的神经病变治疗
MX2021010003A (es) * 2019-02-26 2021-12-10 Inspirna Inc Anticuerpos anti-mertk de alta afinidad y usos de los mismos.
CN111808938A (zh) * 2019-04-11 2020-10-23 南方医科大学南方医院 Atp6v0d2用于动脉粥样硬化的早期诊断或疗效监控
EP4534771A4 (en) 2022-05-31 2026-05-06 Yoshino Gypsum Co Building wall
CN121100135A (zh) * 2024-04-18 2025-12-09 苏州鲲石一号生物科技有限公司 Gas6融合蛋白及其制备方法与应用

Family Cites Families (27)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4683202A (en) 1985-03-28 1987-07-28 Cetus Corporation Process for amplifying nucleic acid sequences
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
EP0519596B1 (en) 1991-05-17 2005-02-23 Merck & Co. Inc. A method for reducing the immunogenicity of antibody variable domains
US5565332A (en) 1991-09-23 1996-10-15 Medical Research Council Production of chimeric antibodies - a combinatorial approach
US5639641A (en) 1992-09-09 1997-06-17 Immunogen Inc. Resurfacing of rodent antibodies
DE69630142D1 (de) * 1995-11-16 2003-10-30 Baylor College Medicine Verfahren zur identifizierung metastatischer sequenzen
US6545139B1 (en) * 1998-03-13 2003-04-08 Baylor College Of Medicine DNA sequence encoding the p99 gene and kits for the detection of neoplasia
US8257750B2 (en) 1999-04-30 2012-09-04 Kibow Biotech, Inc. Calcium carbonate compositions for preventing or treating hyperphosphatemia
WO2000069454A1 (en) 1999-05-17 2000-11-23 Board Of Regents, The University Of Texas System Suppression of endogenous igfbp-2 to inhibit cancer
EP1317470B1 (en) * 2000-09-14 2011-04-27 The University Of British Columbia Antisense insulin-like growth factor binding protein (igfbp)-2-oligodeoxynucleotides for prostate tumor therapy
US20040018973A1 (en) * 2002-01-25 2004-01-29 University Of Pittsburgh Nuclear matrix protein alterations associated with colon cancer and colon metastasis to the liver, and uses thereof
KR101238701B1 (ko) * 2002-08-21 2013-03-05 더 유니버시티 오브 브리티쉬 콜롬비아 암-관련 단백질을 표적으로 하는 알엔에이아이 프로브
EP1644732B1 (en) 2003-07-10 2010-02-24 Central Institute For Experimental Animals Animal model for the analysis of tumor metastasis
AU2004298604B2 (en) * 2003-12-15 2010-09-23 The Regents Of The University Of California Molecular signature of the PTEN tumor suppressor
FR2865736B1 (fr) 2004-02-02 2006-07-14 Synt Em Inhibiteurs de l'angiogenese, compositions les contenant et leur utilisation pour le traitement des maladies liees a une deregulation de l'angiogenese
US20060198789A1 (en) * 2005-01-06 2006-09-07 Zhigang Weng Target validation assay
WO2006102715A1 (en) * 2005-03-30 2006-10-05 Murdoch Childrens Research Institute Methods and agents for modulating cellular activity
WO2007056604A2 (en) * 2005-11-09 2007-05-18 Irm Llc Methods and compositions for modulating cell motility and inhibiting tumor metastasis
US9060961B2 (en) * 2006-11-09 2015-06-23 University Of Washington Molecules and methods for treatment and detection of cancer
CA2705152C (en) 2007-11-09 2016-10-11 Peregrine Pharmaceuticals, Inc. Anti-vegf antibody compositions and methods
WO2009082744A2 (en) 2007-12-22 2009-07-02 Sloan-Kettering Institute For Cancer Research Prognosis and interference-mediated treatment of breast cancer
US9179654B2 (en) * 2008-04-07 2015-11-10 Cornell Research Foundation, Inc. Inhibition of angiogenesis
PL2282778T3 (pl) * 2008-04-29 2017-08-31 Pharnext Nowe podejścia terapeutyczne do leczenia choroby alzheimera i powiązanych zaburzeń poprzez modulację angiogenezy
WO2009154790A2 (en) * 2008-06-20 2009-12-23 University Of Massachusetts Novel metastasis suppresor genes and uses thereof
JPWO2010064702A1 (ja) * 2008-12-05 2012-05-10 国立大学法人 東京大学 癌の予後を予測するためのバイオマーカー
WO2011011061A2 (en) * 2009-07-21 2011-01-27 The Board Of Trustees Of The Leland Stanford Junior University Method of regulating angiogenesis and lymphangiogenesis, and a pharmaceutical composition for effecting anti-angiogenic and anti-lymphangiogenic cancer therapy
EP2673363B1 (en) 2011-02-11 2017-08-23 The Rockefeller University Treatment of angiogenesis disorders

Non-Patent Citations (5)

* Cited by examiner, † Cited by third party
Title
HURST, D. R. ET AL., CANCER RES, vol. 69, no. 19, 2009, pages 7495
HURWITZ, H. ET AL., N ENGL J MED, vol. 350, no. 23, 2004, pages 2335
KIM, K. J. ET AL., NATURE, vol. 362, no. 6423, 1993, pages 841
SLEEMAN, J. ET AL., EUR J CANCER, vol. 46, no. 7, 2010, pages 1177
TALMADGE, J. E. ET AL., CANCER RES, vol. 70, no. 14, 2010, pages 5649

Also Published As

Publication number Publication date
JP2022088607A (ja) 2022-06-14
ES2645366T3 (es) 2017-12-05
EP2673363A2 (en) 2013-12-18
US9493841B2 (en) 2016-11-15
DK2673363T3 (da) 2017-11-13
US8980261B2 (en) 2015-03-17
US20130323241A1 (en) 2013-12-05
EP2673363A4 (en) 2015-04-15
ES2763087T3 (es) 2020-05-27
CA3146962A1 (en) 2012-08-16
US8715660B2 (en) 2014-05-06
JP7536049B2 (ja) 2024-08-19
US12060619B2 (en) 2024-08-13
EP3604534A1 (en) 2020-02-05
JP6633029B2 (ja) 2020-01-22
US10894989B2 (en) 2021-01-19
CA2841404C (en) 2022-04-26
US20190352722A1 (en) 2019-11-21
EP2673363B1 (en) 2017-08-23
JP2014507435A (ja) 2014-03-27
JP2020054375A (ja) 2020-04-09
JP7053559B2 (ja) 2022-04-12
US20150292031A1 (en) 2015-10-15
JP2018007672A (ja) 2018-01-18
US10301684B2 (en) 2019-05-28
HK1245330A1 (en) 2018-08-24
JP6178241B2 (ja) 2017-08-09
WO2012109567A3 (en) 2012-11-01
US20130330333A1 (en) 2013-12-12
EP3301176B1 (en) 2019-09-25
US20170362664A1 (en) 2017-12-21
CA2841404A1 (en) 2012-08-16
US20210139997A1 (en) 2021-05-13
EP3301176A1 (en) 2018-04-04

Similar Documents

Publication Publication Date Title
US12060619B2 (en) Treatment of angiogenesis disorders
US20210188962A1 (en) Treatment of fibrosis
JP2020534354A (ja) トリプルネガティブ乳癌の治療方法
EP2723350B1 (en) New uses of nanog inhibitors and related methods
EP3936149A1 (en) Therapeutic and prophylactic agent for glioma, brain tumor malignancy marker, brain tumor prognostic marker, method for determining malignancy and prognosis of brain tumor and antibody inhibiting tumor proliferation
US11022608B2 (en) Compositions and methods for detecting and treating pathological fibroblast cells
HK40023089A (en) Method for identifying nucleic acids regulating metastasation
HK1245330B (en) Method for identifying nucleic acids regulating metastasation
HK1193429B (en) Treatment of angiogenesis disorders
HK1193429A (en) Treatment of angiogenesis disorders
WO2014095916A1 (en) Ninjurin-1 as therapeutic target for brain tumor
JP2018061481A (ja) 癌の予後マーカー及びその使用

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 12745124

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 2013553604

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 13984760

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

REEP Request for entry into the european phase

Ref document number: 2012745124

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2012745124

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2841404

Country of ref document: CA