WO2012050923A2 - Engineered polypeptides having enhanced duration of action - Google Patents

Engineered polypeptides having enhanced duration of action Download PDF

Info

Publication number
WO2012050923A2
WO2012050923A2 PCT/US2011/053770 US2011053770W WO2012050923A2 WO 2012050923 A2 WO2012050923 A2 WO 2012050923A2 US 2011053770 W US2011053770 W US 2011053770W WO 2012050923 A2 WO2012050923 A2 WO 2012050923A2
Authority
WO
WIPO (PCT)
Prior art keywords
seq
engineered polypeptide
sequence
exendin
polypeptide according
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2011/053770
Other languages
English (en)
French (fr)
Other versions
WO2012050923A3 (en
Inventor
Mary Erickson
David C. Litzinger
Soumitra S. Ghosh
Zijian Guo
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Amylin Pharmaceuticals LLC
Original Assignee
Amylin Pharmaceuticals LLC
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=44786115&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2012050923(A2) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority to MX2013003481A priority Critical patent/MX345245B/es
Priority to ES11767876.3T priority patent/ES2563091T3/es
Priority to CN201180057092.1A priority patent/CN103370083B/zh
Priority to BR112013007442A priority patent/BR112013007442A2/pt
Priority to EP11767876.3A priority patent/EP2621538B1/en
Priority to EA201390450A priority patent/EA201390450A1/ru
Priority to HK14101093.8A priority patent/HK1188710B/en
Priority to CA2812951A priority patent/CA2812951A1/en
Application filed by Amylin Pharmaceuticals LLC filed Critical Amylin Pharmaceuticals LLC
Priority to JP2013531784A priority patent/JP6121330B2/ja
Publication of WO2012050923A2 publication Critical patent/WO2012050923A2/en
Publication of WO2012050923A3 publication Critical patent/WO2012050923A3/en
Priority to US13/852,899 priority patent/US9593154B2/en
Anticipated expiration legal-status Critical
Priority to US15/398,627 priority patent/US20170114114A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575Hormones
    • C07K14/57563Vasoactive intestinal peptide [VIP]; Related peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575Hormones
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • A61K47/643Albumins, e.g. HSA, BSA, ovalbumin or a Keyhole Limpet Hemocyanin [KHL]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/16Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/14Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
    • A61P25/16Anti-Parkinson drugs
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/04Anorexiants; Antiobesity agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/06Antihyperlipidemics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/10Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575Hormones
    • C07K14/605Glucagons
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/20Fusion polypeptide containing a tag with affinity for a non-protein ligand
    • C07K2319/21Fusion polypeptide containing a tag with affinity for a non-protein ligand containing a His-tag
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/70Fusion polypeptide containing domain for protein-protein interaction

Definitions

  • the present application relates to compounds having good duration of action, high potency and/or convenient dosing regimens including oral administration, and method of use thereof.
  • engineered polypeptides which incorporate an albumin binding domain in combination with a biologically active peptide.
  • the engineered polypeptides described herein can bind albumin, the compounds can be sequestered (e.g., bound to albumin) while in the circulation leading to increased duration of action, due for example to decreased renal clearance and/or degradation.
  • Diseases amendable to such treatment include obesity and overweight, diabetes, dyslipidemia, hyperlipidemia, short bowel syndrome, Alzheimer's disease, fatty liver disease, Parkinson's disease, cardiovascular disease, and other disorders of the central nervous system, or combinations thereof.
  • engineered polypeptide compounds having binding affinity for albumin and an additional therapeutic utility.
  • the compounds are engineered polypeptides which include an albumin binding domain (ABD) polypeptide as defined herein capable of binding albumin and a hormone domain (HD) polypeptide, which HD polypeptides can be biologically active and can elicit a beneficial biological response, in covalent linkage with the ABD.
  • ABD albumin binding domain
  • HD hormone domain
  • Any of the ABD or HD polypeptides described herein can be optionally covalently bonded in the engineered polypeptide through a linker L, for example LI as described herein.
  • linker L for example LI as described herein.
  • an engineered polypeptide as described herein.
  • the engineered polypeptide includes an albumin binding domain polypeptide (ABD) as described herein and a hormone domain (HD1).
  • the hormone domain includes a polypeptide which is an exendin, a fragment of an exendin, or analog of an exendin.
  • a method for treating a disease or disorder in a subject in need of treatment includes administering an engineered polypeptide as described herein to the subject.
  • a pharmaceutical composition which includes an engineered polypeptide compound described herein in combination with a pharmaceutically acceptable excipient.
  • polynucleotides encoding the engineered polypeptide and their intermediates, expression vectors bearing such polynucleotides, host cells expressing such polynucleotides, and means for their expression, synthesis, post-translational modification and isolation.
  • One advantage of the present invention is that the engineered polypeptides can be synthesized completely by recombinant methods, avoiding complex or additional synthetic or chemical steps and associated reactive reagents and catalysts. Consequently, the
  • polypeptides of the present invention can be much less expensive to synthesize than chemically derivatized compounds of prolonged duration of action.
  • a further advantage is relatively small size, which can allow for oral delivery to improve patient compliance.
  • the compounds disclosed herein demonstrate surprising efficacy in an OGTT DO A (oral glucose tolerance test for duration of action) test of at least 24 hours and even longer to 2 days in mice, which translates to 7 days or longer in humans, a robust glycemic control and body weight loss in diabetic obese (ob/ob) mice, and provide a dose-dependent reduction of food intake over at least two days in mice.
  • OGTT DO A oral glucose tolerance test for duration of action
  • Fig. 1A Blood glucose level (BGL) data histogram prior to gavage at 1-day post dosage of Cmpd 15 in OGTT DOA test. Vehicle mean pre-gavage glucose: 117 mg/dL. Legend (left to right): vehicle (open), 2 nmol/kg (diagonal upper left to lower right);
  • Fig. 2A Blood glucose level (BGL) data histogram prior to gavage at 2-day post dosage of Cmpd 15 in OGTT DOA test. Vehicle mean pre-gavage glucose: 135 mg/dL. Legend (left to right): vehicle (open), 25 nmol/kg (vertical lines); 250 nmol/kg (diagonal lines). Fig. 2B: Change in blood glucose at 30 min. Vehicle mean pre-gavage glucose: 135 mg/dL. Legend: same as Fig. 2A. * p ⁇ 0.5 vs. vehicle control; ANOVA, Dunnett's test.
  • FIG. 3A Blood glucose level (BGL) data histogram prior to gavage at 1-day post dosage of Cmpd 15 and Cmpd 8 in OGTT DOA test.
  • Vehicle mean pre-gavage glucose: 117 mg/dL.
  • Fig. 3B Change in blood glucose at 30 min. Vehicle mean pre-gavage glucose: 117 mg/dL. Legend: same as Fig. 1A. * p ⁇ 0.5 vs. vehicle control;
  • Fig. 4 Effect of Cmpd 15 in HSD fed anesthetized rats.
  • Fig 4A Glucose time course after intravenous glucose tolerance test (IVGTT). Legend: vehicle (Triangle tip up); Cmpd 15 at 240 nmol/kg (box).
  • Fig. 4B Histogram depicting glucose (AUC, 0-60 min) after IVGTT. Legend: vehicle (left); Cmpd 15 (right).
  • Fig. 4C Time course of insulin after IVGTT. Legend: As in Fig. 4A.
  • Fig. 4D Histogram depicting change in insulin (AUC, 0- 30min). Legend: As in Fig. 4B.
  • Fig 4E Time course of change in body weight after sc injection of Cmpd 15.
  • Fig. 4F Histogram of daily food intake after sc injection of Cmpd 15.
  • histogram depicts vehicle and Cmpd 15 (240 nmol/kg) in order left to right. *p ⁇ 0.05 vs. vehicle control; Dunnett's test.
  • Fig. 5 Effect of Cmpd 15 in ob/ob mice.
  • Fig. 5A Time course of change in body weight (0-10 days) after injection of Cmpd 15 at 250 nmol/kg.
  • Vehicle square
  • Cmpd 15 triangle
  • Fig. 5B Time course of change in blood glucose after dosage as described for Fig. 5 A.
  • Fig. 5C Time course of change in HbAi c after dosage as described for Fig. 5A.
  • Fig. 6 Effects of Cmpd 15 in Zucker Diabetic Fatty rats.
  • Fig. 6A Time course of change in body weight after treatment of Zucker Diabetic Fatty rats with Cmpd 15.
  • Fig. 6B Time course of plasma glucose (mg/dL) after treatment with Cmpd 15.
  • Vehicle solid box
  • Cmpd 15 (0.17 mg/kg) (triangle tip up); Cmpd 15 (0.5 mg/kg) (triangle tip down).
  • Fig. 7 Comparison in OGTT DOA. Effects of Cmpds 15, 8 and 10, compared with exendin-4, were evaluated as the change in blood glucose at 30 min (% pre-gavage). Legend: compounds in order left to right of histogram: vehicle; Cmpd 15 at 2 nmol/kg; Cmpd 15 at 25 nmol/kg; Cmpd 15 at 250 nmol/kg; Cmpd 8 at 2 nmol/kg; Cmpd 8 at 25 nmol/kg; Cmpd 8 at 250 nmol/kg; Cmpd 10 at 25 nmol/kg; Cmpd 10 at 250 nmol/kg; exendin-4 at 250 nmol/kg. * p ⁇ 0.5 vs. vehicle control; ANOVA, Dunnett's test.
  • Fig. 8 Presents a time profile of percent of compound remaining in human plasma over a 5 hour time course. Legend: Peptide (SEQ ID NO:4) (closed box); Cmpd 7 (open box); Cmpd 31 (cross); Cmpd 15 (open diamond); GLP-l(7-36)amide (closed diamond).
  • Fig. 9 Blood glucose level (BGL) data histogram prior to gavage at 1-day post dosage of Cmpd 31.
  • Vehicle mean pre-gavage glucose: 126 mg/dL.
  • vehicle open
  • Cmpd 31 25 nmol/kg ; closed
  • Fig. 10A demonstrates time course of effect of Cmpd 31 on inhibiting food intake in normal mice over 6 hours. Legend: vehicle (box); Cmpd 31 at 1 nmol/kg
  • FIG. 10B depicts histogram of results of effect of Cmpd 31 on inhibiting food intake in normal mice over 54 hours.
  • Fig. 11 Fig. 11A (Cmpd 15) and Fig. 11B (Cmpd 21) depict time course of changes in blood glucose compared to liraglutide, all given twice weekly (BIW).
  • Figs. 11 A-l IB vehicle (box); liraglutide at 250 nmol/kg BIW (closed triangle); test compound at 25 nmol/kg BIW (open triangle); test compound at 250 nmol/kg BIW
  • Fig. 11C depicts histogram showing lowering of HbAlc (% change from baseline)for Cmpd 15 and Cmpd 21 given twice weekly (BIW), compared to exendin-4 given by continuous subcutaneous infusion (CSI).
  • Fig. 11D depicts reduction in body weight (% change from baseline) for Cmpd 15 and Cmpd 21 given twice weekly (BIW), compared to exendin-4 given by continuous subcutaneous infusion (CSI).
  • CSI continuous subcutaneous infusion
  • Fig. 12 depicts pharmacokinetic (PK) profile and biological activity of exemplary engineered polypeptides Cmpd 15 and Cmpd 21 dosed subcutaneously in normal Harlan Sprague-Dawley (HSD) rats.
  • Fig. 12A depicts effect of compounds to reduce food intake.
  • Fig. 12B depicts effect of compounds to reduce body weight.
  • Fig. 12C depicts a PK profile of the compounds after a single dose.
  • vehicle (box) Cmpd 21
  • Fig. 13 depicts pharmacokinetic (PK) profile and biological activity of an exemplary engineered polypeptide Cmpd 31 compared to unconjugated exendin analog dosed intravenously in normal Harlan Sprague-Dawley (HSD) rats.
  • Fig. 13A depicts effect of compounds to reduce food intake.
  • Fig. 13B depicts effect of compounds to reduce body weight.
  • Fig. 13C depicts a PK profile of the compounds after a single dose.
  • PK pharmacokinetic
  • Fig. 14 This figure depicts a biological activity time course of an exemplary engineered polypeptide (Cmpd 15) compared to unconjugated exendin analog to lower blood glucose after oral delivery. See Example 18. Mean pre-treatment glucose: -623 mg/dL. Legend: vehicle (closed box); exendin-4 analog (open box); Cmpd 15 (diamond). DETAILED DESCRIPTION OF THE INVENTION
  • Obsity and “overweight” refer to mammals having a weight greater than normally expected, and may be determined by, e.g., physical appearance, body mass index (BMI) as known in the art, waist-to-hip circumference ratios, skinfold thickness, waist circumference, and the like.
  • BMI body mass index
  • the Centers for Disease Control and Prevention (CDC) define overweight as an adult human having a BMI of 25 to 29.9; and define obese as an adult human having a BMI of 30 or higher. Additional metrics for the determination of obesity exist. For example, the CDC states that a person with a waist-to-hip ratio greater than 1.0 is overweight.
  • Lean body mass refers to the fat-free mass of the body, i.e., total body weight minus body fat weight is lean body mass. Lean body mass can be measured by methods such as hydrostatic weighing, computerized chambers, dual-energy X-ray absorptiometry, skin calipers, magnetic resonance imaging (MRI) and bioelectric impedance analysis (BIA) as known in the art.
  • Lean body mass can be measured by methods such as hydrostatic weighing, computerized chambers, dual-energy X-ray absorptiometry, skin calipers, magnetic resonance imaging (MRI) and bioelectric impedance analysis (BIA) as known in the art.
  • “Mammal” refers to warm-blooded animals that generally have fur or hair, that give live birth to their progeny, and that feed their progeny with milk. Mammals include humans; companion animals (e.g., dogs, cats); farm animals (e.g., cows, horses, sheep, pigs, goats); wild animals;
  • the mammal is a female human. In one embodiment, the mammal is a cat or dog. In one embodiment, the mammal is a diabetic mammal, e.g., a human having type 2 diabetes. In one embodiment, the mammal is an obese diabetic mammal, e.g., an obese mammal having type 2 diabetes.
  • subject in the context of methods described herein refers to a mammal.
  • “Fragment” in the context of polypeptides refers herein in the customary chemical sense to a portion of a polypeptide.
  • a fragment can result from N-terminal deletion or C-terminal deletion of one or more residues of a parent polypeptide, and/or a fragment can result from internal deletion of one or more residues of a parent polypeptide.
  • “Fragment” in the context of an antibody refers to a portion of an antibody which can be linked to a biologically active molecule to modulate solubility, distribution within a subject, and the like.
  • exendin-4(l-30) describes a biologically active fragment of exendin-4 where the exendin C-terminal "tail" of amino acids 31-39 is deleted.
  • parent in the context of polypeptides refers, in the customary sense, to a polypeptide which serves as a reference structure prior to modification, e.g., insertion, deletion and/or substitution.
  • conjugate in the context of engineered polypeptides described herein refers to covalent linkage between component polypeptides, e.g., ABD, HDl and the like.
  • fusion in the context of engineered polypeptides described herein refers to covalent linkage between component polypeptides, e.g., ABD, HDl and the like, via either or both terminal amino or carboxy functional group of the peptide backbone.
  • Engineered polypeptides can be synthetically or recombinantly made. Typically, fusions are made using recombinant biotechnology, however, can also be made by chemical synthesis and conjugation methods.
  • Analog as used herein in the context of polypeptides refers to a compound that has insertions, deletions and/or substitutions of amino acids relative to a parent compound.
  • Analog sequence as used herein in the context of polypeptides refers to an amino acid sequence that has insertions, deletions and/or substitutions of amino acids relative to a parent amino acid sequence (e.g., wild-type sequence, native sequence). An analog may have superior stability, solubility, efficacy, half-life, and the like.
  • an analog is a compound having at least 50%, for example 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%o, 90%), 95%), 98%o, or even higher, sequence identity to the parent compound.
  • the analog has from 1 to 5 amino acid modifications selected independently from any one or combination of an insertion, deletion, addition and
  • the exendin analog can have from 1 to 5 amino acid modifications selected independently from any one or combination of an insertion, deletion, addition and substitution, and preferably retains at least 50%, for example 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or even higher, sequence identity to the parent compound, and even more preferably at least 80%>, 85%, 90%>, 95%, 98%o, or even higher, sequence identity to the parent compound, and preferably the parent compound is exendin-4, exendin-4(l-38), exendin-4(l-37). exendin-4(l-36),
  • at least amino acids corresponding to positions 1, 4, 6, 7 and 9 of exendin-4 are those as in native exendin-4, and further the one to five modifications are conservative amino acid substitutions at positions other than positions 1, 4, 6, 7 and 9 of exendin-4.
  • an exendin analog retains the amino acid at least as found in position 3, 4, 6, 5, 7, 8, 9, 10, 11, 13, 15, 18, 19, 22, 23, 25, 26, and/or 30 of exendin-4, and further preferably has no more than 1 to 5 of the remaining positions substituted with another amino acid, most preferably a chemically conservative amino acid.
  • any substitution or modification at positions 1 and/or 2 will retain resistance to DPP- IV cleavage while retaining or improving insulinotropic activity as is known in the art for exendin-4 analogs, such as desamino-histidyl-exendin-4.
  • the term “conservative” in the context of amino acid substitutions refers to substitution which maintains properties of charge type (e.g., anionic, cationic, neutral, polar and the like), hydrophobicity or hydrophilicity, bulk (e.g., van der Waals contacts and the like), and/or functionality (e.g., hydroxy, amine, sulfhydryl and the like).
  • charge type e.g., anionic, cationic, neutral, polar and the like
  • hydrophobicity or hydrophilicity e.g., van der Waals contacts and the like
  • functionality e.g., hydroxy, amine, sulfhydryl and the like.
  • non-conservative refers to an amino acid substitution which is not conservative.
  • Identity refers to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same (i.e., about 50% identity, preferably 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or higher identity over a specified region, when compared and aligned for maximum correspondence over a comparison window or designated region) as measured using a sequence comparison algorithms as known in the art, for example BLAST or BLAST 2.0.
  • sequence comparison typically one sequence acts as a reference sequence, to which test sequences are compared.
  • test and reference sequences are entered into a computer, subsequence coordinates are designated if necessary, and sequence algorithm program parameters are designated.
  • sequence algorithm program parameters Preferably, default program parameters can be used, or alternative parameters can be designated.
  • sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
  • Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, 1981, Adv. Appl. Math. 2:482, by the homology alignment algorithm of Needleman & Wunsch, 1970, J. Mol. Biol. 48:443, by the search for similarity method of Pearson & Lipman, 1988, Proc. Nat'l. Acad. Sci. USA 85:2444, by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.), or by manual alignment and visual inspection.
  • BLAST and BLAST 2.0 are used, as known in the art, to determine percent sequence identity for the nucleic acids and proteins of the invention.
  • Software for performing BLAST analyses is publicly available through the web site of the National Center for Biotechnology
  • This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighborhood word score threshold (Altschul et al, Id.). These initial neighborhood word hits act as seeds for initiating searches to find longer
  • HSPs containing them The word hits are extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, e.g., for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always>0) and N (penalty score for mismatching residues; always ⁇ 0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached.
  • the BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment.
  • engineered polypeptide compounds are provided with sequence which includes an albumin binding domain (ABD) polypeptide sequence and at least one polypeptide hormone domain (HD1) sequence.
  • ABS albumin binding domain
  • HD1 polypeptide hormone domain
  • albumin binding domain refers to polypeptides capable of binding albumin as described herein.
  • hormone domain refers to a GP-1 receptor agonist polypeptide capable of eliciting a biological response in a subject.
  • Exemplary hormone domains include, but are not limited to, an exendin, an exendin fragment, or an exendin analog.
  • an exendin, exendin analog or active fragment can be fused to an very-high-affinity albumin binding domain (ABD) derived from the albumin- binding domains of bacterial protein G of Streptococcus strain G148, while retaining sufficient exendin-4 biological activity and having an extended duration of action, for example of at least 3 days and even 5 days in a rodent, which translates to at least a one week duration or longer in a human subject.
  • “Duration of action” refers in the customary sense to allowing for more infrequent dosing in a therapeutical regimen.
  • ABD peptides have not been extensively demonstrated to be a robust platform as a therapeutic protein carrier, they are relatively hydrophobic which could interact adversely with an attached therapeutic peptide, and were not able to act as a carrier for at least one family of peptide hormones.
  • rat amylin when conjugated or fused to the ABDs described herein did not display any significant or long-acting in vivo activity in the same rodent models in which various exendin-ABD constructs were found to be active and with long duration of action.
  • Bioly active components contemplated for use in the compounds and methods described herein include the exendins.
  • the terms "biologically active compound” and the like refer in the customary sense to compounds, e.g., polypeptides and the like, which can elicit a biological response.
  • Exendins are peptides that are found in the salivary secretions of the Gila monster and the Mexican Bearded Lizard, reptiles that are endogenous to Arizona and Northern Mexico.
  • Exendin-3 is present in the salivary secretions of Heloderma horridum (Mexican Beaded Lizard)
  • exendin-4 is present in the salivary secretions of Heloderma suspectum (Gila monster). See Eng et al, 1990, J. Biol. Chem., 265:20259-62; Eng et al, 1992, J. Biol. Chem., 267:7402-7405.
  • HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 (SEQ ID NO:2).
  • exendin-4 peptide analog is a chimera of the first 32 amino acids of exendin-4 having amino acid substitutions at positions 14 and 28 followed by a 5 amino acid sequence from the C-terminus of a non-mammalian (frog) GLP1 :
  • square brackets in a peptidic compound name indicates substitution of the residue or chemical feature within the square brackets.
  • [ 14 Leu]Exendin-4, [ 14 Leu]Ex-4, and the like refer to exendin-4 having leucine at position 14.
  • the numeric position of an amino acid can be indicated by prepended or postpended numbers in a variety of ways routinely employed in the art.
  • Leu, Leul4, 14Leu, Leu and the like are synonymous in referring to leucine at position 14.
  • a C-terminal amide, or other C-terminal capping moiety can be present in compounds described herein.
  • the exendins have some sequence similarity to several members of the glucagon-like peptide family, with the highest homology, 53%, being to GLP-1 (7-36)NH 2 (Goke et al, 1993, J. Biol. Chem., 268: 19650-55) [sequence of GLP-1 (7-37)NH 2 :
  • HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG SEQ ID NO:5
  • exendins are not GLP-1 homologs.
  • exendin-4 can act at GLP-1 receptors in vitro on certain insulin-secreting cells, however, it has also been reported that exendin-4 may act at receptors not acted upon by GLP-1. Further, exendin-4 shares some but not all biological properties in vivo with GLP-1, and it has a significantly longer duration of action than GLP-1. Based on their insulinotropic activities, the use of exendin-3 and exendin- 4 for the treatment of diabetes mellitus and the prevention of hyperglycemia has been proposed (Eng, U.S. Pat. No.
  • exendin-4 has been approved in the United States and in Europe for use as a therapeutic for treating type 2 diabetes.
  • exendins are not the species homolog of mammalian GLP- 1 as was reported by Chen and Drucker who cloned the exendin gene from the Gila monster (J. Biol. Chem. 272:4108-15 (1997)).
  • the observation that the Gila monster also has separate genes for proglucagons (from which GLP-1 is processed), that are more similar to
  • exendins are not merely species homologs of GLP-1.
  • Novel exendin agonist compound sequences useful in the engineered polypeptides described herein are described in WO 99/07404 (i.e., PCT/US98/16387 filed Aug. 6, 1998), in WO 99/25727 (i.e., PCT/US98/24210, filed Nov. 13, 1998), in WO 99/25728 (i.e., PCT/US98/24273, filed Nov. 13, 1998), in WO 99/40788, in WO 00/41546, and in WO 00/41548, which are incorporated herein by reference and for all purposes along with their granted U.S. patent counterparts.
  • exendins, exendin agonists, and exendin analog agonists include: exendin fragments exendin-4 (1-30) (His Gly Glu Gly Thr Phe Thr Ser Asp Leu Ser Lys Gin Met Glu Glu Glu Ala Val Arg Leu Phe lie Glu Trp Leu Lys Asn Gly Gly); exendin-4(l-28), exendin-4(l-29), exendin-4(l-30), exendin-4(l-31) and exendin-4(l-32).
  • Analogs include substitution at the 14 Met position (i.e., 14 Met) with a non-oxidizing amino acid such as leucine. Examples include [ 14 Leu]exendin-4, [ 14 Leu]exendin-4(l-30), [ 14 Leu]exendin-4(l- 28) and [ 14 Leu, 25 Phe] exendin-4.
  • Exendin analog agonists for use in the engineered polypeptides described herein include those described in US Patent No. 7,223,725 (incorporated herein by reference and for all purposes), such as compounds of the formula: Xaai Xaa 2 Xaa 3 Gly Xaas Xaa 6 Xaa 7 Xaa 8 Xaag Xaaio Xaan Xaai 2 Xaai 3 Xaai 4 Xaais Xaa ⁇ Xaan Ala Xaaig Xaa 2 o Xaa 2 i Xaa 22 Xaa 23 Xaa 24 Xaa 2 5 Xaa 26 Xaa 27 Xaa 28 -Z 1 ; wherein Xaai is His, Arg or Tyr; Xaa 2 is Ser, Gly, Ala or Thr; Xaa 3 is Ala, Asp or Glu; Xaa 5
  • 4-pyridylalanine 4-imidazoacetyl, des-amino-histidyl (imidazopropionyl), beta-hydroxy- imidazopropionyl, N-dimethyl-histidyl or beta-carboxy-imidazopropionyl.
  • exendin analogs described herein wherein a replacement for the glycine at Xaa2 is made with any of D-Ala, Val, Leu, Lys, Aib, (1 -amino cyclopropyl) carboxylic acid, (l-aminocyclobutyl)carboxylic acid, l-aminocyclopentyl)carboxylic acid, (l-aminocyclohexyl)carboxylic acid, (l-aminocycloheptyl)carboxylic acid, or (1 -amino cyclooctyl)carboxylic acid.
  • exemplary compounds include those of the above formula wherein: Xaai is His or Arg; Xaa 2 is Gly or Ala; Xaa 3 is Asp or Glu; Xaas is Ala or Thr; Xaa 6 is Ala or Phe; Xaa 7 is Thr or Ser; Xaag is Ala, Ser or Thr; Xaag is Asp or Glu; Xaaio is Ala, or Leu; Xaan is Ala or Ser; Xaai 2 is Ala or Lys; Xaai 3 is Ala or Gin; Xaai 4 is Ala or Leu; Xaais is Ala or Glu; Xaai 6 is Ala or Glu; Xaa ⁇ is Ala or Glu; Xaaig is Ala or Val; Xaa 2 o is Ala or Arg; Xaa 2 i is Ala or Leu
  • exendin analogs described herein wherein a replacement for the glycine at Xaa 2 is made with any of D-Ala, Val, Leu, Lys, Aib, (1-aminocyclopropyl) carboxylic acid, (1 -amino cyclobutyl)carboxylic acid, l-aminocyclopentyl)carboxylic acid, (l-aminocyclohexyl)carboxylic acid, (1 -amino cycloheptyl)carboxylic acid, or ( 1 -aminocyclooctyl)carboxylic acid.
  • exemplary compounds include those set forth in WO 99/25727 identified therein as compounds 2-23.
  • Xaai 4 is Leu, He, or Val more preferably Leu
  • Xaa 25 is Trp, Phe or Tyr, more preferably Trp or Phe. These compounds will be less susceptive to oxidative degradation, both in vitro and in vivo, as well as during synthesis of the compound.
  • exendin analogs suitable for use in the present fusion polypeptides include those described in United States Patent 6528486 published March 4, 2003 (incorporated herein by reference and for all purposes).
  • exendin analogs include those consisting of an exendin or exendin analog having at least 90% homology to exendin-4 having optionally between one and five deletions at positions 34-39, and a C- terminal extension of a peptide sequence of 4-20 amino acid units covalently bound to said exendin wherein each amino acid unit in said peptide extension sequence is selected from the group consisting of Ala, Leu, Ser, Thr, Tyr, Asn, Gin, Asp, Glu, Lys, Arg, His, and Met.
  • the extension is a peptide sequence of 4-20 amino acid residues, e.g., in the range of 4-15, more preferably in the range of 4-10 in particular in the range of 4-7 amino acid residues, e.g., of 4, 5, 6, 7, 8 or 10 amino acid residues, where 6 amino acid residues are preferred.
  • the extension peptide contains at least one Lys residue, and is even more preferably from 3 to 7 lysines and even most preferably 6 lysines.
  • one analog is HGEGTFTSDLSKQMEEEAVRLFIEWLK GG PSSGAPP SKKKKK (SEQ ID NO: l 18) (also designated ([des- 36 Pro]exendin-4(l-39)- Lys 6 ).
  • Additional exemplary analogs include Lys6-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp- Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly- Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser-(Lys) 6 (H-Lys 6 -des Pro 36 exendin-4(l-39)-Lys 6 ) (SEQ ID NO: 184); His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu- Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-
  • repetition of an amino acid can be indicated by a subscripted number setting forth the number of repetitions; i.e., Lys 6 , (Lys) 6 and the like refer to hexalysyl (SEQ ID NO: 191).
  • Lys 6 i.e., Lys 6 , (Lys) 6 and the like refer to hexalysyl (SEQ ID NO: 191).
  • a replacement for the histidine corresponding to position 1 is made with any of D-histidine, desamino-histidine, 2-amino-histidine, beta-hydroxy-histidine, homohistidine.
  • exendin analogs described herein wherein a replacement for the glycine at position 2 is made with any of D-Ala, Val, Leu, Lys, Aib, (l-aminocyclopropyl)carboxylic acid, (l-aminocyclobutyl)carboxylic acid,
  • exendin analogs suitable for use in the engineered polypeptide constructs are those described in published PCT application WO2004035623 (incorporated herein by reference and for all purposes), particularly those comprised of naturally-occurring amino acids, which describes exendin analogs having at least one modified amino acid residue particularly at positions 13 Gin, 14 Met, 25 Trp or 28 Asn with reference to the
  • exendin-4(l-39) corresponding positions of exendin-4(l-39).
  • additional such analogs further comprising a 1-7 amino acid C-terminal extension that comprises at least one Lys amino acid and more preferably at least five Lys amino acid units such as six or seven Lys amino acid units.
  • exendin analogs suitable for use in the engineered polypeptide constructs are those described in published PCT application WO/2010/120476, entitled “N-Terminus Conformationally Constrained GLP-1 Receptor Agonist Compounds" (incorporated herein by reference and for all purposes), which describes exendin analogs having modified amino acid residues in the N-terminal portion of an exendin or exendin analog to create a high beta-turn characteristic in that region.
  • analogs are designed to mimic amino acid residues Hisl Gly2 Glu3 by creating a conformationally constrained region, include exendin analogs containing a thiazolidine-proline peptide mimetic at Hisl Gly2 Glu3 (see for example compounds described in Figures 17A-F therein), which can be used as a modification in exendin-4, lixisenatide, or other analogs described herein.
  • exendins in any and each of the exendins, exendin analogs and formulas described herein, specifically contemplated are those wherein a replacement for the histidine corresponding to position 1 is made with any of L-histidine, D-histidine, desamino-histidine, 2-amino- histidine, beta-hydroxy-histidine, homohistidine.
  • N-alpha-acetyl-histidine alpha- fluoromethyl-histidine, alpha-methyl-histidine, 3-pyridylalanine, 2-pyridylalanine, 4- pyridylalanine, 4-imidazoacetyl, des-amino-histidyl (imidazopropionyl), beta-hydroxy- imidazopropionyl, N-dimethyl-histidyl or beta-carboxy-imidazopropionyl.
  • exendin analogs for use in engineered polypeptide conjugates as described herein wherein the Hisl position is modified are (4-imidazoacetyl) exendin-4, (des-amino-histidyl) exendin-4 (or (imidazopropionyl) exendin-4), (beta-hydroxy-imidazopropionyl) exendin-4, (N-dimethyl-histidyl) exendin-4 and (beta-carboxy-imidazopropionyl) exendin-4.
  • exendins or exendin analogs described herein wherein a replacement for the glycine at position 2 is made with any of D-Ala, Val, Leu, Lys, Aib, (1- aminocyclopropyl)carboxylic acid, (l-aminocyclobutyl)carboxylic acid, 1- aminocyclopentyl)carboxylic acid, (1 -amino cyclohexyl)carboxylic acid,
  • any of the above exendin analogs or their active fragments are suitable for use in the present engineered polypeptides, with or without a linker to the ABD.
  • Albumin binding domain (ABD) peptides for use in the invention are those with comparably high affinity for albumin and derive from albumin-binding domains of bacterial protein G of Streptococcus strain G148.
  • ABD peptides contemplated for the engineered polypeptides described herein include those having the albumin binding motifs as described by Jonsson et al. ⁇ Protein Eng. Design & Selection, 2008, 21:515-527) as well as the ABD peptides described therein, and those motifs and ABD peptides further described in PCT Published Appl. No.
  • the ABD peptide can include an albumin binding motif ("ABM") that includes the amino acid sequence
  • X 5 is selected from Y and F;
  • Xg is selected from N, R and S;
  • X9 is selected from V, I, L, M, F and Y;
  • X 11 is selected from N, S, E and D;
  • X 12 is selected from R, K and N;
  • X 14 is selected from K and R;
  • X 20 is selected from D, N, Q, E, H, S, R and K;
  • X 23 is selected from K, I and T;
  • X 24 is selected from A, S, T, G, H, L and D;
  • X 25 is selected from H, E and D.
  • the ABD peptide binds to albumin with a K D value of the interaction that is at most 1 x 10 "6 M, and even more preferably at most 1 x 10 "9 M (even tighter affinity).
  • K D refers to a dissociation constant, as customary in the art. More preferably the
  • K D value of the interaction that is at most 1 x 10 "10 M, even more preferably is at most 1 x 10 "
  • 11 M yet even more preferably is at most 1 x 10 "12 M, and even further is at most 1 x 10 "13 M.
  • a Kd value of 1 x 10 "14 M is a K D value of the interaction that is at most 1 x 10 " 13 M.
  • the K D values can be determined as described in PCT Published Appl. No. WO
  • the albumin binding capacity of the ABD peptide can be retained despite amino acid changes so long as such changes retain sufficient tertiary structure of the ABD peptide.
  • Such changes include, for example, a substitution where an amino acid residue belonging to a certain functional grouping of amino acid residues (e.g. hydrophobic, hydrophilic, polar etc.) is exchanged for another amino acid residue from the same functional group.
  • the motif X5 is Y.
  • the ABD Xg is selected from N and R, and may in particular be R.
  • X9 is L.
  • Xn is selected from N and S, and may in particular be N.
  • X 12 is selected from R and K, such as X 12 being R or X 12 being K.
  • X 14 is K.
  • X 2 o is selected from D, N, Q, E, H, S and R, and may in particular be E.
  • X 23 is selected from K and I, and may in particular be K.
  • X 24 is selected from A, S, T, G, H and L. In a more specific embodiment X 24 is L. In an even more specific embodiment "X 23 X 24 " is KL. In another even more specific embodiment "X 23 X 24 " is TL.
  • X 24 is selected from A, S, T, G and H.
  • X 24 is selected from A, S, T, G and H and X 23 is I.
  • X 25 is H.
  • the albumin binding motif consists of an amino acid sequence selected from SEQ ID NO: 1-257.
  • the motif sequence is selected from SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:9, SEQ ID NO: 15, SEQ ID NO:25, SEQ ID NO:27, SEQ ID NO:46, SEQ ID NO:49, SEQ ID NO:53, SEQ ID NO:54, SEQ ID NO:55, SEQ ID NO: l 55, SEQ ID NO:239, SEQ ID NO :240, SEQ ID NO :241 , SEQ ID NO :242, SEQ ID NO :243 , SEQ ID NO :244 and SEQ ID NO:245 of PCT Published Appl. No. WO 2009/016043.
  • the motif sequence is selected from SEQ ID NO:3, SEQ ID NO:53 and SEQ ID NO:239 of PCT Published Appl. No. WO 2009/016043.
  • Albumin binding polypeptides containing these albumin binding motifs and thus suitable for conjugation or fusion to a hormone domain as described herein are further described herein and below and exemplified in Table 1 and the Examples. Not to be bound by theory but it is believed that the albumin binding motif can form part of a three-helix bundle protein domain.
  • the motif may essentially constitute or form part of two alpha helices with an interconnecting loop, within the three-helix bundle protein domain.
  • such a three-helix bundle protein domain is selected from the group of three-helix domains of bacterial receptor protein G from Streptococcus strain G 148.
  • the three-helix bundle protein domain of which the motif forms a part is selected from the group of domain GAl , domain GA2 and domain GA3 of protein G from Streptococcus strain G148, in particular domain GA3.
  • the motif forms part of a three- helix bundle protein domain
  • this is understood to mean that the sequence of the albumin binding motif is "inserted” into or “grafted” onto or “fused” to the sequence of the naturally occurring (or otherwise original) three-helix bundle domain, such that the motif replaces a similar structural motif in the original domain.
  • the motif is thought to constitute two of the three helices of a three-helix bundle, and can replace such a two-helix motif within any three-helix bundle.
  • the replacement of two helices of the three-helix bundle domain by the two motif helices disclosed herein is performed so as not to affect the basic structure of the polypeptide.
  • the overall folding of the backbone of the polypeptide according to this embodiment of the invention will be substantially the same as that of the three-helix bundle protein domain of which it forms a part, e.g. having the same elements of secondary structure in the same order etc.
  • a motif useful to the engineered polypeptides herein can "form part" of a three-helix bundle domain if the polypeptide according to this embodiment has the same fold as the original domain, implying that the basic structural properties are shared, those properties e.g. resulting in similar CD spectra.
  • the albumin binding domain polypeptide is a three-helix bundle protein domain, which includes the albumin binding motif as defined above and additional sequences making up the remainder of the three-helix configuration.
  • an albumin binding domain polypeptide can be fused an exendin or analogs or active fragments thereof to create the engineered polypeptides as described herein.
  • An albumin binding domain polypeptide suitable for conjugation or fusion to an exendin compound can includes the amino acid sequence : LAE AK X a X b A X c X d EL X e KY (SEQ ID NO : 182) covalently linked to an albumin binding motif (ABM) which is further covalently linked to the amino acid sequence LAALP (SEQ ID NO: 183), wherein ABM is an albumin binding motif as defined herein, X a is selected from V and E; Xb is selected from L, E and D; X c is selected from N, L and I; Xd is selected from R and K; and X e is selected from D and K.
  • an albumin binding domain polypeptide suitable for conjugation or fusion to an exendin compound is the amino acid sequence: LAEAK X a Xb A X c Xd EL X e KY (SEQ ID NO: 182) covalently linked to an albumin binding motif (ABM) which is further covalently linked to the amino acid sequence LAALP (SEQ ID NO: 183), as described above.
  • the albumin binding domain polypeptide includes the amino acid sequence LAEAK X a X b A X c X d EL X e KY GVSD X 5 YK X 8 X 9 I Xii X12 A X M TVEGV X 20 AL X 23 X 24 X25 1 LAALP (SEQ ID NO: 121), wherein X a is selected from V and E; X b is selected from L, E and D; X c is selected from N, L and I; X d is selected from R and K; X e is selected from D and K;X 5 is selected from Y and F; X 8 is selected from N, R and S; X9 is selected from V, I, L, M, F and Y; n is selected from N, S, E and D; Xi 2 is selected from R, K and N; X14 is selected from K and R; X20 is selected from D, N, Q,
  • the C-terminal proline (corresponding to position 46 above) can be optionally absent. Even further for each embodiment of the ABD sequence, the leucine at position 45 can be optionally present or absent.
  • ABD sequence is a sequence of an ABD compound that is monovalent or divalent, as appropriate, that forms part of an engineered polypeptide disclosed herein.
  • Peptide hormone domain (HD1) sequence is a sequence of a peptide hormone domain (HD1) compound that is monovalent or divalent, as appropriate, that forms part of an engineered polypeptide disclosed herein.
  • Exendin sequence is a sequence of an exendin compound that is monovalent or divalent, as appropriate, that forms part of an engineered polypeptide disclosed herein.
  • Exendin analog sequence is a sequence of an exendin analog compound that is monovalent or divalent, as appropriate, that forms part of an engineered polypeptide disclosed herein.
  • Exendin active fragment sequence is a sequence of an exendin active fragment compound that is monovalent or divalent, as appropriate, that forms part of an engineered polypeptide disclosed herein.
  • Exendin analog active fragment sequence is a sequence of an exendin analog active fragment compound that is monovalent or divalent, as appropriate, that forms part of an engineered polypeptide disclosed herein.
  • Albumin binding motif (ABM) sequence is a sequence of an ABM that is monovalent or divalent, as appropriate, that forms part of an engineered polypeptide disclosed herein. Unless stated otherwise, it is understood that where an engineered polypeptide "comprises” a compound (e.g., an ABD or HD1), the sequence of the engineered polypeptide includes the sequence of the compound (e.g. an ABD sequence or an HD1 sequence).
  • the ABD peptide binds to albumin with a K D value of the interaction that is at most 1 x 10 "6 M and even more preferably at most 1 x 10 "9 M (even tighter affinity). More preferably the K D value of the interaction that is at most 1 x 10 ⁇ 10 M, even more preferably is at most 1 x 10 "11 M, yet even more preferably is at most 1 x 10 ⁇ 12 M, and even further is at most 1 x 10 ⁇ 13 M.
  • the values are most preferably for affinity to human serum albumin ("HSA").
  • albumin binding polypeptide X a is V.
  • polypeptide X b is L. In one embodiment of this polypeptide X c is N. In one embodiment of this polypeptide X d is R. In one embodiment of this polypeptide X e is D.
  • X a is E. In certain embodiments X b is D. In certain embodiments, X c is I. In certain embodiments, X d is K. In certain embodiments, X a
  • albumin binding domain polypeptide is LAEAKEDAIKELDKYGVSDYYKRLISKAKTVEGVKALISEILAALP (SEQ ID NO: 122). In certain embodiments, the albumin binding domain polypeptide is
  • albumin binding domain polypeptide is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoe
  • LAEAKEDAIKELDKYGVSDYYKNLINKAKTVEGVEALISEILAALP (SEQ ID NO: 124).
  • sequence of the albumin binding polypeptide is selected from SEQ ID NO:260, SEQ ID NO:310 and SEQ ID NO:496 in PCT Published Appl. No.
  • the sequence of the albumin binding polypeptide is selected from SEQ ID NO:260, SEQ ID NO:270, SEQ ID NO:272, SEQ ID NO:291 , SEQ ID NO:294, SEQ ID NO:298, SEQ ID NO:299, SEQ ID NO:300, SEQ ID NO:400, SEQ ID NO:484, SEQ ID NO:485, SEQ ID NO:486, SEQ ID NO:487, SEQ ID NO:488, SEQ ID NO:489 and SEQ ID NO:490 in PCT Published Appl. No. WO 2009/016043, and sequences having 85% or greater identity thereto.
  • Exemplary ABD species include, but are not limited to, the compounds with sequence set forth in Table 1 following and the Examples. See also PCT Published Appl. No. WO 2009/016043, incorporated herein by reference in its entirety and for all purposes.
  • An ABD peptide sequence useful in compounds, methods and pharmaceuticals compositions described herein can be a fragment or analog of an ABD peptide sequence disclosed herein or known in the art so long as it contains an albumin binding motif sequence and binds albumin with the affinity described herein.
  • albumin binding and "binding affinity for albumin” as used herein refer to a property of a polypeptide which may be tested for example by the use of surface plasmon resonance technology, such as in a Biacore instrument as known in the art.
  • albumin binding affinity may be tested in an experiment in which albumin, or a fragment thereof, is immobilized on a sensor chip of the instrument, and the sample containing the polypeptide to be tested is passed over the chip.
  • the polypeptide to be tested is immobilized on a sensor chip of the instrument, and a sample containing albumin, or a fragment thereof, is passed over the chip.
  • Albumin may, in this regard, be a serum albumin from a mammal, such as human serum albumin. The skilled person may then interpret the results obtained by such experiments to establish at least a qualitative measure of the binding affinity of the polypeptide for albumin. If a quantitative measure is desired, for example to determine a K D value for the interaction, surface plasmon resonance methods may also be used. Binding values may for example be defined in a
  • Biacore2000 instrument (GE Healthcare). Albumin is suitably immobilized on a sensor chip of the measurement, and samples of the polypeptide whose affinity is to be determined are prepared by serial dilution and injected. K D values may then be calculated from the results using for example the 1 : 1 Langmuir binding model of the BIAevaluation 4.1 software provided by the instrument manufacturer (GE Healthcare).
  • the albumin binding polypeptide according to this aspect binds to albumin such that the k 0ff value of the interaction is at most 5 x 10 ⁇ 5 s "1 , such as at most 5 x lo-V 1 .
  • the amino acid sequence of the albumin binding polypeptide portion of an engineered polypeptide includes an ABD selected from any one of the sequences described herein, including those from Table 1 or the listing herein and further including their des- Pro46 forms.
  • the albumin binding polypeptide according to this aspect further includes one or more additional amino acid residues positioned at the N- and/or the C- terminal of the ABD sequence defined or exemplified herein.
  • additional amino acid residues may play a role in further enhancing the binding of albumin by the polypeptide, and improving the conformational stability of the folded albumin binding domain, but may equally well serve other purposes, related for example to one or more of production, purification, stabilization in vivo or in vitro, coupling, labeling or detection of the
  • polypeptide as well as any combination thereof.
  • additional amino acid residues may include one or more amino acid residue(s) added for purposes of chemical coupling, e.g. to the HD1.
  • the amino acids directly preceding or following the alpha helix at the N-or C-terminus of the ABD amino acid sequence may thus in one embodiment affect the conformational stability.
  • an amino acid residue which may contribute to improved conformational stability is a serine residue positioned at the N-terminal of the ABD amino acid sequence as defined above.
  • the N-terminal serine residue may in some cases form a canonical S-X-X-E capping box, by involving hydrogen bonding between the gamma oxygen of the serine side chain and the polypeptide backbone NH of the glutamic acid residue.
  • This N-terminal capping may contribute to stabilization of the first alpha helix of the three helix domain constituting the albumin binding polypeptide according to the first aspect of the disclosure.
  • the additional amino acids include at least one serine residue at the N-terminal of the polypeptide.
  • the ABD amino acid sequence is in other words preceded by one or more serine residue(s).
  • the additional amino acids include a glycine residue at the N-terminal of the ABD sequence. It is understood that the ABD amino acid sequence may be preceded by one, two, three, four or any suitable number of amino acid residues.
  • the ABD amino acid sequence may be preceded by a single serine residue, a single glycine residue or a combination of the two, such as a glycine-serine (GS) combination or a glycine-serine-serine (GSS) combination.
  • GS glycine-serine
  • GSS glycine-serine-serine
  • the additional amino acid residues include an alanine acid at the N-terminal of the ABD polypeptide defined herein, or in combination with serine as an alanine-serine sequence at the N-terminal of the ABD sequences above. In yet another embodiment, the additional amino acid residues include a glutamic acid at the N-terminal of the ABD polypeptide defined herein.
  • C-terminal capping may be exploited to improve stability of the third alpha helix of the three helix domain constituting the albumin binding polypeptide.
  • the C- terminal proline residue present at the C-terminal of the ABD amino acid sequence defined above may at least partly function as a capping residue.
  • a lysine residue following the proline residue at the C-terminal may contribute to further stabilization of the third helix of the albumin binding polypeptide, by hydrogen bonding between the epsilon amino group of the lysine residue and the carbonyl groups of the amino acids located two and three residues before the lysine in the polypeptide backbone, e.g. the carbonyl groups of the leucine and alanine residues of the ABD amino acid sequence defined above.
  • the additional amino acids include a lysine residue at the C-terminal of the polypeptide.
  • the additional amino acids may be related to the production of the albumin binding polypeptide.
  • one or more optional amino acid residues following the C-terminal proline may provide advantages when the albumin binding polypeptide according to the first aspect is produced by chemical peptide synthesis.
  • Such additional amino acid residues may for example prevent formation of undesired substances, such as diketopiperazine at the dipeptide stage of the synthesis.
  • One example of such an amino acid residue is glycine.
  • the additional amino acids include a glycine residue at the C-terminal of the polypeptide, directly following the proline residue or following an additional lysine and/or glycine residue as accounted for above.
  • polypeptide production may benefit from amidation of the C-terminal proline residue of the ABD amino acid sequence.
  • the C-terminal proline includes an additional amine group at the carboxyl carbon.
  • the additional amino acid residues includes a cysteine residue at the N- and/or C-terminal of the polypeptide.
  • a cysteine residue may directly precede and/or follow the ABD amino acid sequence as defined herein or may precede and/or follow any other additional amino acid residues as described above.
  • a cysteine residue may directly precede and/or follow the ABD amino acid sequence as defined herein or may precede and/or follow any other additional amino acid residues as described above.
  • a cysteine residue to the polypeptide chain, a thiol group for site directed conjugation of the albumin binding polypeptide may be obtained.
  • a selenocysteine residue may be introduced at the C-terminal of the polypeptide chain, in a similar fashion as for the introduction of a cysteine residue, to facilitate site-specific conjugation (Cheng et al, Nat Prot 1 :2, 2006).
  • the albumin binding polypeptide includes no more than two cysteine residues. In another embodiment, the albumin binding polypeptid
  • the additional amino acid residues of the albumin binding polypeptide includes a "tag” for purification or detection of the polypeptide, such as a hexahistidyl (His 6 ) tag, or a "myc" (“c-Myc”) tag or a "FLAG” tag for interaction with antibodies specific to the tag and/or to be used in purification.
  • a tag for purification or detection of the polypeptide, such as a hexahistidyl (His 6 ) tag, or a "myc" (“c-Myc”) tag or a "FLAG” tag for interaction with antibodies specific to the tag and/or to be used in purification.
  • the ABD includes LAEAKVLANRELDKYGVSDFYKRLINKAKTVEGVEALKLHILAALP (SEQ ID NO : 35), and its N-terminally extended ABD sequence forms including
  • ASLAEAKVLANRELDKYGVSDFYK LINKAKTVEGVEALKLHILAALP SEQ ID NO: 179. Also preferred are the
  • polypeptides where the C-terminal proline, glycine or both is absent in each of the above ABD sequences are also preferred. sequences where the ABD includes the des-proline forms, which can improve yields compared to the parent forms
  • LAEAKVLANRELDKYGVSDFYKRLINKAKTVEGVEALKLHILAAL (SEQ ID NO:35), and its N-terminally extended ABD sequence forms including SLAEAKVLANRELD KYGVSDFYKRLINKAKTVEGVEALKLHILAAL (SEQ ID NO: 177) and
  • the linker to exendin-4 or exendin analog is a glycine including linker as disclosed herein, for example G, GGG, GGS, GGGS (SEQ ID NO: 192), TGGGGAS (SEQ ID NO: 193), TGGGGGAS (SEQ ID NO: 194), or TGGGGSAS (SEQ ID NO: 195).
  • the linker to the C- terminus of exendin-4 or exendin analog is a glycine including linker as disclosed herein, for example G, GGG, GGS, GGGS, TGGGGAS, TGGGGGAS, and TGGGGSAS.
  • a glycine can be added to the C-terminus to counter potential problems with racemization of the C-terminal amino acid residue.
  • the C-terminal amino acid can in its (alpha-amino group) amidated form, e.g. proline versus proline amide, rather than ending with a glycine.
  • amidation of the C-terminal amino acid can be performed by several methods known in the art, e.g. use of amidating PAM enzyme.
  • the ABD can provide an increase in the solubility in aqueous solution of a poor or low soluble exendin variant. This property can be imparted by the ABD itself or because of the ensuing complex of the engineered polypeptide bound to highly soluble albumin in vivo or in vitro, which association increases the solubility of the engineered polypeptide in aqueous solution.
  • compositions including an exendin compound which per se has a solubility in water of no more than lmg/ml, or no more than 2 mg/ml or no more than 5mg/ml, covalently coupled to an albumin binding domain as a fusion protein or conjugate as described herein, wherein the compound and the albumin binding polypeptide, fusion protein or conjugate are covalently coupled and the solubility of the engineered polypeptide is greater than that of the unfused (or not conjugated) native exendin compound.
  • Serum albumin is the most abundant protein in mammalian sera (40 g/L; approximately 0.7 mM in humans) where it binds a variety of molecules including but not limited to lipids and bilirubin (Peters T, 1985, Advances in Protein
  • serum albumin is directly proportional to the size of the animal, where for example human serum albumin (HSA) has a half-life of 19 days and rabbit serum albumin has a half-life of about 5 days (McCurdy TR et al, J. Lab. Clin. Med. 143:115,2004).
  • HSA human serum albumin
  • rabbit serum albumin has a half-life of about 5 days (McCurdy TR et al, J. Lab. Clin. Med. 143:115,2004).
  • Human serum albumin is widely distributed throughout the body, in particular in the intestinal and blood compartments, where it is mainly involved in the maintenance of osmolality. Structurally, albumins are single-chain proteins including three homologous domains and totaling 584 or 585 amino acids
  • Albumins contain 17 disulfide bridges and a single reactive thiol, C34, but lack N-linked and O-linked carbohydrate moieties (Peters, 1985, Id.; Nicholson JP et al, 2000, Br JAnaesth 85:599).
  • the lack of glycosylation simplifies recombinant expression of albumin. This property of albumin, together with the fact that its three-dimensional structure is known (He, XM and Carter, DC, Nature 358:209 1992), has made it an attractive candidate for use in recombinant fusion proteins.
  • Such fusion proteins generally combine a therapeutic protein (which would be rapidly cleared from the body upon administration of the protein per se) and a plasma protein (which exhibits a natural slow clearance) in a single polypeptide chain (Sheffield WP, Curr. Drug Targets Cardiovacs. Haematol. Disord. 1: 1 2001). Such fusion proteins may provide clinical benefits in requiring less frequent injection and higher levels of therapeutic protein in vivo.
  • the engineered polypeptides herein are not conjugated to albumin, but instead contain motifs that allow non-covalent binding to albumin.
  • albumin half-life It has been observed that the half-life of albumin in different species generally adheres to allometric scaling based on animal weight. For example, the albumin half-life in mouse, rat, rabbit and human has been estimated as 1, 1.9, 5.6 and 19 days, respectively. Indeed, power fitting analysis (Davies & Morris, 1993, Pharm. Res. (N. Y.) 10: 1093-1095) provides the equation:
  • each of the polypeptides disclosed herein are also contemplated to include a methionine at the N-terminus in frame with the naturally-occurring first amino acid thereof, e.g., Met-exendin-4, which is exendin-4 with an added N-terminal methionine. It is further understood that where a C-terminal Gly appears in a engineered polypeptide sequence set forth herein, the residue may be lost during subsequent amidation.
  • Some embodiments are intermediates in synthesis, for example, such as those having a "His tag" which is used for affinity purification as is known in the art, and that can optionally be subsequently removed to yield a mature engineered polypeptide suitable for therapeutic use.
  • an exendin analog can have at least 70%, for example 70%, 75%, 80%, 85%, 90%, 95%, 98% or even higher, sequence identity relative to a parent exendin sequence.
  • the parent exendin is exendin-4, and the exendin analog may have at least 70%, for example 70%, 75%, 80%, 85%, 90%, 95%, 98% or even higher, sequence identity relative to exendin- 4.
  • GLP-1 (glucagon- like peptide 1) is not an exendin; and the sequence of GLP-1 is specifically excluded from exendin sequences suitable for the engineered polypeptides described herein.
  • compounds are provided having a linker, for example LI, as described herein, covalently linking a polypeptide hormone domain with an ABD peptide.
  • a first linker covalently links HDl within the engineered
  • the polypeptide hormone domain (e.g., HDl as described herein) can be covalently linked to the ABD peptide via a peptide linker.
  • Any linker is optional; i.e., any linker may simply be a bond.
  • the chemical structure of a linker is not critical because it serves mainly a spacer function.
  • the linker includes from 1 to 30 amino acids linked by peptide bonds. The amino acids can be selected from the 20 naturally occurring (i.e., physiological) amino acids. Alternatively, non-natural amino acids can be incorporated either by chemical synthesis, post-translational chemical modification or by in vivo incorporation by
  • the linker is made up of a majority of amino acids that are sterically unhindered, such as glycine, alanine and/or serine.
  • “Sterically unhindered” refers, in the customary sense, to a amino acid having a small side chain, e.g., 0-2 non-hydrogen atoms, such that steric hinderance is minimized relative to amino acids having larger side chains, e.g., Leu, Trp, Tyr, Phe, and the like.
  • Polyglycines are particularly useful, e.g. (Gly) 3 , (Gly) 4 (SEQ ID NO: 125), (Gly) 5 (SEQ ID NO: 126), as are polyalanines, poly(Gly-Ala) and poly(Gly-Ser).
  • Charged polyglycines can be useful, and include e.g., poly (Gly n -Glu) (SEQ ID NO: 127), poly(Gly n - Lys) (SEQ ID NO: 128), poly(Glyicillin -Asp) (SEQ ID NO: 129), and poly(Glysack-Arg) (SEQ ID NO: 130) motifs (where n can be 1 to 6).
  • poly (Gly n -Glu) SEQ ID NO: 127
  • poly(Gly n - Lys) SEQ ID NO: 128)
  • poly(Glyicillin -Asp) SEQ ID NO: 129
  • poly(Glygrocket) SEQ ID NO: 130
  • Combinations of Gly and Ala are particularly useful as are combination of Gly and Ser.
  • the peptide linker is selected from the group of a glycine rich peptide, e.g., Gly-Gly-Gly; the sequences [Gly-Ser] n (SEQ ID NO: 135), [Gly- Gly- Ser] n (SEQ ID NO: 136), [Gly-Gly-Gly- Ser] n (SEQ ID NO: 137) and [Gly-Gly-Gly-Gly-Gly-Ser] n (SEQ ID NO: 138), where n is 1, 2, 3, 4, 5 or 6, for example [Gly-Gly-Gly-Gly Ser] 3 .
  • Glycine rich peptide refers to a polypeptide which includes a plurality of glycine residues, preferably a majority of glycine residues, more preferably a preponderance of glycine residues.
  • charged linkers may be used.
  • Such charges linkers may be contain a significant number of acidic residues (e.g., Asp, Glu, and the like), or may contain a significant number of basic residues (e.g., Lys, Arg, and the like), such that the linker has a pi lower than 7 or greater than 7, respectively.
  • acidic residues e.g., Asp, Glu, and the like
  • basic residues e.g., Lys, Arg, and the like
  • Such linkers may impart advantageous properties to the engineered polypeptides disclosed herein, such as modifying the peptides pi (isoelectric point) which can in turn improve solubility and/or stability characteristics of such polypeptides at a particular pH, such as at physiological pH (e.g., between pH 7.2 and pH 7.6, inclusive), or in a pharmaceutical composition including such polypeptides.
  • solubility for a peptide can be improved by formulation in a composition having a pH that is at least or more than plus or minus one pH unit from the pi of the peptide.
  • an “acidic linker” is a linker that has a pi of less than 7; between 6 and 7, inclusive; between 5 and 6, inclusive; between 4 and 5, inclusive; between 3 and 4, inclusive; between 2 and 3, inclusive; or between 1 and 2, inclusive.
  • a “basic linker” is a linker that has a pi of greater than 7; between 7 and 8, inclusive; between 8 and 9, inclusive; between 9 and 10, inclusive; between 10 and 11, inclusive; between 11 and 12 inclusive, or between 12 and 13, inclusive.
  • an acidic linker will contain a sequence that is selected from the group of [Gly-Glu] n (SEQ ID NO: 139); [Gly- Gly-Glu] n (SEQ ID NO: 140); [Gly-Gly-Gly- Glu] n (SEQ ID NO: 141); [Gly-Gly-Gly-Gly- Glu] n (SEQ ID NO: 142), [Gly-Asp] n (SEQ ID NO: 143); [Gly-Gly-Asp] n (SEQ ID NO: 144); [Gly-Gly-Gly- Asp] n (SEQ ID NO: 145); [Gly-Gly-Gly-Gly-Asp] n (SEQ ID NO: 146), where n is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more; for example, [Gly-Gly-Glu] 6 .
  • a basic linker will contain a sequence that is selected from the group of [Gly-Lys] n (SEQ ID NO: 147); [Gly-Gly- Lys] n (SEQ ID NO: 148); [Gly-Gly-Gly- Lys] n (SEQ ID NO: 149); [Gly- Gly-Gly-Gly- Lys] n (SEQ ID NO: 150), [Gly- Arg] n (SEQ ID NO: 151); [Gly-Gly- Arg] n (SEQ ID NO: 152); [Gly-Gly-Gly- Arg] n (SEQ ID NO: 153); [Gly-Gly-Gly-Gly- Arg] n (SEQ ID NO: 154) where n is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more; for example, [Gly-Gly-Lys] 6 .
  • linkers may be prepared which possess certain structural motifs or characteristics, such as an alpha helix.
  • a linker may contain a sequence that is selected from the group of [Glu-Ala-Ala-Ala-Lys] n (SEQ ID NO: 155), where n is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more; for example, [Glu-Ala-Ala-Ala-Lys] 3 , [Glu-Ala-Ala-Ala-Lys] 4 , or [Glu-Ala-Ala-Ala-Lys]5.
  • [Glu-Ala-Ala-Ala-Lys] amino acid
  • a biocompatible linker other than a peptide linker may be used to covalently attach the C-terminus of an exendin to the N-terminus of the ABD or ABM sequence.
  • the linker can be a biocompatible polymer, preferably water soluble, and more preferably about 50kD to about 5000kD, or about 50KD to 500kD, or about lOOkD to 500kD.
  • An exemplary biocompatible, water soluble polymer linker is a PEG linker, such as -(CH 2 -CH 2 -0) n - where n is such that the PEG linker can have a molecular weight of 100 to 5000 kD, preferably 100 to 500 kD.
  • Such a linker may be -NH-CH 2 -CH 2 -(0-CH 2 -CH 2 ) n -0-CH 2 -CO-, where n is such that the PEG linker molecular weight is lOOkD to 5000kD, preferably lOkD to 500kD.
  • Other biocompatible polymers can be used, such as including but not limited to polysaccharides, polypropylene glycol, and co-polymers of propylene and ethylene glycols.
  • Typically such a linker will include a reactive group at each end that can be the same or different reactive group. Such linkers with reactive groups are known and available.
  • the reactive group is reactive with either an N-terminal amino or C-terminal carboxy group of a peptide.
  • a reactive group can be an a butylaldehyde, a propionaldehyde, an aldehyde, a succinimide or a maleimide moiety, as is known in the art.
  • linkers suitable for use in accordance with the invention may possess one or more of the characteristics and motifs described above and herein.
  • a linker may include an acidic linker as well as a structural motif, such as an alpha helix.
  • a linker may include a basic linker and a structural motif, such as an alpha helix.
  • a linker may include an acidic linker, a basic linker, and a structural motif, such as an alpha helix.
  • engineered polypeptides in accordance with the invention may possess more than one linker, and each such linker may possess one or more of the characteristics described herein.
  • linkers described herein are exemplary, and linkers within the scope of this invention may be much longer and may include other residues.
  • expressly excluded are engineered polypeptides in which the exendin sequence is linked directly to the ABD sequence without a linker.
  • the engineered polypeptide includes an ABD sequence at the C-terminal, and a HDl sequence at the N-terminal.
  • the N-terminal is an exendin sequence, an exendin fragment sequence or an exendin analog sequence.
  • the engineered polypeptide can have the structure HDl-ABD.
  • the engineered polypeptide is to be read in the N-terminus to C-terminus orientation.
  • the terms HDl-ABD, HDl -LI -ABD, HDl-ABD, and the like mean, in the absence of an express indication of the N-terminus and/or the C- terminus, that the exendin sequence or analog thereof resides at the N-terminus of the engineered polypeptide, and the ABD resides at the C-terminus.
  • the engineered polypeptide is to be read according to the express indication of the termini.
  • the terms HDl-ABD, HDl -LI -ABD, HDl-ABD, and the like mean, in the absence of an express indication of the N-terminus and/or the C- terminus, that the exendin sequence or analog thereof resides at the N-terminus of the engineered polypeptide, and the ABD resides at the C-terminus.
  • the terms N- terminus and/or C-terminus is expressly indicated, then the engineered polypeptide
  • HDlc-term-ABD, HD 1 -L 1 - ABD -term and the like mean that the ABD resides at the
  • N-terminus of the engineered polypeptide, and HDl resides at the C-terminus.
  • the engineered polypeptide described herein has an affinity for serum albumin which is different than the affinity of the ABD polypeptide alone, i.e., in the absence of a fused hormone domain.
  • the engineered polypeptide can have a binding affinity for serum albumin such that the dissociation constant K D is, for example, less than about 10 "6 M, 10 "7 M, 10 "8 M, 10 "9 M, 10 "10 M, 10 "11 M, 10 "12 M, 10 "13 M, 10 "14 M or even 10 "15 M.
  • the affinity is not excessively tight such that the engineered polypeptide can dissociate from the albumin and elicit a biological response, for example binding to a receptor, for example, an exendin receptor.
  • a engineered polypeptide described herein is superior to a corresponding compound having a different moiety that can extend plasma half-life (e.g., PEG or of Fc or albumin) conjugated with a hormone domain(s).
  • plasma half-life e.g., PEG or of Fc or albumin
  • the term "superior" refers to a variety of functional properties which could be weighed in the evaluation of a treatment for a disease or disorder.
  • the engineered polypeptide described herein could require less biologically active (hormone domain) component, for example IX, 2X, 3X, 4X, 5X, or even less, than the corresponding compound having a different moiety conjugated with the hormone domain(s).
  • the engineered polypeptide described herein could have higher potency, for example, 1.5X, 2X, 3X, 4X, 5X, 1 OX, 20X, 50X, or even higher potency.
  • Engineered polypeptide compounds contemplated herein include the compounds as set forth in Table 2 following. One preferred compound is Cmpd 31.
  • any N-terminal methionine is absent.
  • the N-terminal methionine can be present primarily as a convenience for bacterial expression.
  • engineered peptides of the present invention can be expressed in a eukaryotic host cell (e.g. yeast (e.g. Pichia), mammalian, baculovirus) or other host cell having post-translational N-terminal proteolytic processing to yield an N- terminal amino acid as found in a naturally occurring mature peptide counterpart of the desired hormone or ABD sequence, i.e. without the added methionine or other leader sequence.
  • yeast e.g. Pichia
  • an N-terminal sequence used for expression and/or secretion (and even purification) can be one that can be removed post-translationally, e.g. as by use of a protease such as TEV.
  • HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSTGGGGSASLAEAKVLANRE LDKYGVSDFYKRLINKAKTVEGVEALKLHILAALP (SEQ ID NO:55)
  • HGEGTFTSDLSKQMEEEAVRLFIEWLKQGGPSKEIISTGGGGSASLAEAKVLANRELD KYGVSDFYKRLINKAKTVEGVEALKLHILAALP SEQ ID NO:57
  • HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKKTGGGGSASLAEAK VLANRELDKYGVSDFYKRLINKAKTVEGVEALKLHILAALP (SEQ ID NO:59)
  • HGEGTFT SDL SKQLEEE AVRLFIE WLKNGGP S S G APPP S GGGL AE AKVL ANRELDKYG VSDFYKRLINKAKTVEGVEALKLHILAALP (SEQ ID NO:61)
  • HGEGTFTSDLSKQLEEEAVRLFIEWLKQGGPSKEIISTGGGGSASLAEAKVLANRELDK YGVSDYYKNIINRAKTVEGVRALKLHILAALP SEQ ID NO:65
  • HGEGTFTSDLSKQLEEEAVRLFIEWLKQGGPSKEIISTGGGGSGGGSGGGSGGGSASLA EAKVLANRELDKYGVSDYYKNIINRAKTVEGVRALKLHILAALP (SEQ ID NO:66)
  • HGEGTFT SDL SKQLEEE AVRLFIE WLKNGGP S S G APPP S GGGL AE AKVL ANRELDKYG VSDYYKNIINRAKTVEGVRALKLHILAALP (SEQ ID NO:77)
  • HGEGTFT SDL SKQLEEE AVRLFIE WLKNGGP S S G APPP S GGGL AE AKVL ANRELDKYG VSDFYKRLINKAKTVEGVEALKLHILAALP (SEQ ID NO:78)
  • HGEGTFTSDLSKQLEEEAVRLFIEWLKQGGPSKEIISGGGLAEAKVLANRELDKYGVS DFYKRLINKAKTVEGVEALKLHILAALP (SEQ ID NO:79)
  • HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGGLAEAKVLANRELDKYGVSDFYKRLIN KAKTVEGVEALKLHILAALP (SEQ ID NO: 80)
  • HGEGTFTSDLSKQLEEEAVRLFIEWLKNGGGLAEAKVLANRELDKYGVSDFYKRLIN KAKTVEGVEALKLHILAALP (SEQ ID NO:81)
  • HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSGGGLAEAKVLANRELDKY GVSDFYKRLINKAKTVEGVEALKLHILAALP SEQ ID NO: 82
  • HGEGTFTSDLSKQMEEEAVRLFIEWLKQGGPSKEIISGGGLAEAKVLANRELDKYGVS DFYKRLINKAKTVEGVEALKLHILAALP (SEQ ID NO:83)
  • HGEGTFT SDL SKQMEEE AVRLFIE WLKNGGP S S G APP SKKKKKKGGGL AE AKVL ANR ELDKYGVSDFYKRLINKAKTVEGVEALKLHILAALP (SEQ ID NO: 84)
  • HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGGLAEAKVLANRELDKYGVSDYYKNIIN RAKTVEGVRALKLHILAALP (SEQ ID NO: 86)
  • HGEGTFT SDL SKQLEEE AVRLFIE WLKNGGP S S G APPP S GGGL AE AKVL ANRELDKYG VSDYYKNIINRAKTVEGVRALKLHILAALP (SEQ ID NO:87)
  • HGEGTFTSDLSKQLEEEAVRLFIEWLKQGGPSKEIISGGGLAEAKVLANRELDKYGVS DYYKNIINRAKTVEGVRALKLHILAALP (SEQ ID NO:88)
  • HGEGTFTSDLSKQLEEEAVRLFIEWLKNGGGLAEAKVLANRELDKYGVSDYYKNIINR AKTVEGVRALKLHILAALP (SEQ ID NO: 89)
  • HGEGTFTSDLSKQLEEEAVRLFIEWLKNGGGLAEAKVLANRELDKYGVSDYYKNIINR AKTVEGVRALKLHILAALP (SEQ ID NO:90)
  • HGEGTFTSDLSKQMEEEAVRLFIEWLKQGGPSKEIISGGGLAEAKVLANRELDKYGVS DYYKNIINRAKTVEGVRALKLHILAALP (SEQ ID NO:92)
  • HGEGTFT SDL SKQMEEE AVRLFIE WLKNGGP S S G APP SKKKKKKGGGL AE AKVL ANR ELDKYGVSDYYKNIINRAKTVEGVRALKLHILAALP (SEQ ID NO:93)
  • HGEGTFTSDLSKQLEEEAVRLFIEWLKQGGPSKEIISGGSLAEAKVLANRELDKYGVSD FYKRLINKAKTVEGVEALKLHILAALP (SEQ ID NO:96)
  • HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGSLAEAKVLANRELDKYGVSDFYKRLIN KAKTVEGVEALKLHILAALP (SEQ ID NO:97)
  • HGEGTFTSDLSKQLEEEAVRLFIEWLKNGGSLAEAKVLANRELDKYGVSDFYKRLINK AKTVEGVEALKLHILAALP (SEQ ID NO:98)
  • HGEGTFTSDLSKQMEEEAVRLFIEWLKQGGPSKEIISGGSLAEAKVLANRELDKYGVS DFYKRLINKAKTVEGVEALKLHILAALP (SEQ ID NO: 100)
  • HGEGTFT SDL SKQMEEE AVRLFIE WLKNGGP S S G APP SKKKKKKGGSLAE AKVL ANR ELDKYGVSDFYKRLINKAKTVEGVEALKLHILAALP (SEQ ID NO: 101)
  • HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGSLAEAKVLANRELDKYGVSDYYKNIIN RAKTVEGVRALKLHILAALP (SEQ ID NO: 102) Sequence
  • HGEGTFTSDLSKQLEEEAVRLFIEWLK GGPSSGAPPPSGGSLAEAKVLANRELDKYG VSDYYK IINRAKTVEGVRALKLHILAALP SEQ ID NO: 103
  • HGEGTFTSDLSKQLEEEAVRLFIEWLKQGGPSKEIISGGSLAEAKVLANRELDKYGVSD YYKNIINRAKTVEGVRALKLHILAALP SEQ ID NO: 1044
  • HGEGTFTSDLSKQLEEEAVRLFIEWLKNGGSLAEAKVLANRELDKYGVSDYYKNIINR AKTVEGVRALKLHILAALP (SEQ ID NO: 105)
  • HGEGTFTSDLSKQLEEEAVRLFIEWLKNGGSLAEAKVLANRELDKYGVSDYYKNIINR AKTVEGVRALKLHILAALP (SEQ ID NO: 106)
  • HGEGTFTSDLSKQMEEEAVRLFIEWLKQGGPSKEIISGGSLAEAKVLANRELDKYGVS D YYKNIINRAKTVEGVRALKLHILAALP (SEQ ID NO: 108)
  • HGEGTFT SDL SKQMEEE AVRLFIE WLKNGGP S S G APP SKKKKKKGGSL AE AKVL ANR ELDKYGVSD YYKNIINRAKTVEGVRALKLHILAALP (SEQ ID NO: 109)
  • the engineered polypeptides described herein can be designed at the amino acid level. These sequences can then be back translated using a variety of software products known in the art such that the nucleotide sequence is optimized for the desired expression host, e.g. based protein expression, codon optimization, restriction site content. For example, the nucleotide sequence can be optimized for E. coli based protein expression and for restriction site content. Based on the nucleotide sequence of interest, overlapping oligonucleotides can be provided for multistep PCR, as known in the art. These oligonucleotides can be used in multiple PCR reactions under conditions well known in the art to build the cDNA encoding the protein of interest. For one example is IX Amplitaq Buffer, 1.3 mM MgCl 2 , 200uM dNTPs, 4 U Amplitaq Gold, 0.2 uM of each primer
  • Restriction sites can be added to the ends of the PCR products for use in vector ligation as known in the art. Specific sites can include Ndel and Xhol, such that the cDNA can then be in the proper reading frame in a pET45b expression vector (Novagen). By using these sites, any N-terminal His Tag that are in this vector can be removed as the translation start site would then be downstream of the tag.
  • Expression constructs Once expression constructs are completed, verification can be conduct by sequencing using e.g., T7 promoter primer, T7 terminator primer and standard ABI BigDye Term v3.1 protocols as known in the art. Sequence information can be obtained from e.g., an ABI 3730 DNA Analyzer and can be analyzed using Vector NTI v.10 software (Invitrogen). Expression constructs can be designed in a modular manner such that linker sequences can be easily cut out and changed, as known in the art.
  • Protease recognition sites known in the art or described herein, can be incorporated into constructs useful for the design, construction, manipulation and production of recombinant engineering polypeptides described herein.
  • constructs useful in the production of engineered polypeptides contemplated herein include constructs encoding the polypeptides set forth in Table 4 following.
  • engineered polypeptide compounds described herein may be prepared using biological, chemical, and/or recombinant DNA techniques that are known in the art. Exemplary methods are described herein and in US Patent No. 6,872,700; WO 2007/139941; WO 2007/140284; WO 2008/082274; WO
  • the engineered polypeptides compounds described herein may be prepared using standard solid-phase peptide synthesis techniques, such as an automated or semiautomated peptide synthesizer. Briefly and generally, the ABD and therapeutic hormonal peptide can be made separately and then conjugated together or can be made as a single polypeptide.
  • the albumin binding polypeptide, therapeutic hormone or engineered polypeptide may alternatively be produced by non-biological peptide synthesis using amino acids and/or amino acid derivatives having reactive side-chains protected, the non-biological peptide synthesis including step-wise coupling of the amino acids and/or the amino acid derivatives to form a polypeptide according to the first aspect having reactive side-chains protected, removing the protecting groups from the reactive side-chains of the polypeptide, and folding of the polypeptide in aqueous solution.
  • normal amino acids e.g.
  • glycine, alanine, phenylalanine, isoleucine, leucine and valine) and pre-protected amino acid derivatives are used to sequentially build a polypeptide sequence, in solution or on a solid support in an organic solvent.
  • the protecting groups are removed and the polypeptide is allowed to fold in an aqueous solution.
  • Each polypeptide according to the present disclosure reversibly folds, with the ABD domain reversibly folding into a three helix bundle domain without added factors, and hence folds spontaneously.
  • the engineered conjugate may be produced by a method including producing an albumin binding polypeptide according to any method, e.g. as described herein, such as by non-biological peptide synthesis, and conjugating the produced ABD polypeptide with the therapeutic hormone defined herein, the ABDs herein folding completely reversibly. This was assessed by circular dichroism spectra analysis; one spectrum taken at 20°C and a second spectrum after heating to 90 °C followed by return to 20 °C. During this procedure the Tm, as known in the art, was determined and found to be unchanged after the folding of the denatured polypeptide.
  • an alpha-N-carbamoyl protected amino acid and an amino acid attached to the growing peptide chain on a resin are coupled at RT in an inert solvent (e.g., dimethylformamide, N-methylpyrrolidinone, methylene chloride, and the like) in the presence of coupling agents (e.g., dicyclohexylcarbodiimide, 1-hydroxybenzo- triazole, and the like) in the presence of a base (e.g., diisopropylethylamine, and the like).
  • an inert solvent e.g., dimethylformamide, N-methylpyrrolidinone, methylene chloride, and the like
  • coupling agents e.g., dicyclohexylcarbodiimide, 1-hydroxybenzo- triazole, and the like
  • a base e.g., diisopropylethylamine, and the like
  • the alpha- N-carbamoyl protecting group is removed from the resulting peptide-resin using a reagent (e.g., trifluoroacetic acid, piperidine, and the like) and the coupling reaction repeated with the next desired N-protected amino acid to be added to the peptide chain.
  • a reagent e.g., trifluoroacetic acid, piperidine, and the like
  • Suitable N-protecting groups are well known in the art, such as t-butyloxycarbonyl (tBoc)
  • Solid phase peptide synthesis can be used for the engineered polypeptides, since in general solid phase synthesis is a straightforward approach with excellent scalability to commercial scale, and is generally compatible with relatively long engineered polypeptides.
  • Solid phase peptide synthesis may be carried out with an automatic peptide synthesizer (Model 430A, Applied Biosystems Inc., Foster City, CA) using the NMP/HOBt (Option 1) system and tBoc or Fmoc chemistry (See APPLIED BIOSYSTEMS USER'S MANUAL FOR THE ABI 430A PEPTIDE SYNTHESIZER, Version 1.3B Jul. 1, 1988, section 6, pp.
  • Boc-peptide- resins may be cleaved with HF (-5°C to 0°C, 1 hour).
  • the peptide may be extracted from the resin with alternating water and acetic acid, and the filtrates lyophilized.
  • the Fmoc-peptide resins may be cleaved according to standard methods (e.g., Introduction to Cleavage
  • Peptides may also be assembled using an Advanced Chem Tech Synthesizer (Model MPS 350, Louisville, Ky.).
  • the compounds (exendins, ABDs, linkers, engineered polypeptides) described herein may also be prepared using recombinant DNA techniques using methods known in the art, such as Sambrook et al, 1989, MOLECULAR CLONING: A LABORATORY MANUAL, 2d Ed., Cold Spring Harbor.
  • Non-peptide compounds may be prepared by art-known methods.
  • phosphate-containing amino acids and peptides containing such amino acids may be prepared using methods known in the art, such as described in Bartlett et al, 1986, Biorg. Chem., 14:356-377.
  • Compounds can be conjugated using art methods or as described herein
  • the engineered polypeptides may alternatively be produced by recombinant techniques well known in the art. See, e.g., Sambrook et al, 1989 ⁇ Id.). These engineered polypeptides produced by recombinant technologies may be expressed from a polynucleotide.
  • a polynucleotide One skilled in the art will appreciate that the polynucleotides, including DNA and RNA, that encode such engineered polypeptides may be obtained from the wild-type cDNA, e.g.
  • exendin-4 taking into consideration the degeneracy of codon usage, and may further engineered as desired to incorporate the indicated substitutions.
  • These polynucleotide sequences may incorporate codons facilitating transcription and translation of mRNA in microbial hosts. Such manufacturing sequences may readily be constructed according to the methods well known in the art. See, e.g., WO 83/04053, incorporated herein by reference in its entirety and for all purposes.
  • the polynucleotides above may also optionally encode an N-terminal methionyl residue.
  • Non-peptide compounds useful in the present invention may be prepared by art-known methods. For example, phosphate-containing amino acids and peptides containing such amino acids may be prepared using methods known in the art. See, e.g., Bartlett and Landen, 1986, Bioorg. Chem. 14: 356-77.
  • a variety of expression vector/host systems may be utilized to contain and express a engineered polypeptide coding sequence. These include but are not limited to
  • microorganisms such as bacteria transformed with recombinant bacteriophage, plasmid or cosmid DNA expression vectors; yeast transformed with yeast expression vectors; insect cell systems infected with virus expression vectors (e.g., baculovirus); plant cell systems transfected with virus expression vectors (e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV) or transformed with bacterial expression vectors (e.g., Ti or pBR322 plasmid); or animal cell systems.
  • virus expression vectors e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV
  • bacterial expression vectors e.g., Ti or pBR322 plasmid
  • Mammalian cells that are useful in recombinant protein productions include but are not limited to VERO cells, HeLa cells, Chinese hamster ovary (CHO) cell lines, COS cells (such as COS-7), WI 38, BHK, HepG2, 3T3, RIN, MDCK,
  • polynucleotide sequences are useful in generating new and useful viral and plasmid DNA vectors, new and useful transformed and transfected procaryotic and eucaryotic host cells (including bacterial, yeast, and mammalian cells grown in culture), and new and useful methods for cultured growth of such host cells capable of expression of the present engineered polypeptides.
  • the polynucleotide sequences encoding engineered polypeptides herein may be useful for gene therapy in instances where underproduction of engineered polypeptides would be alleviated, or the need for increased levels of such would be met.
  • the present invention also provides for processes for recombinant DNA production of the present engineered polypeptides.
  • a process for producing the engineered polypeptides from a host cell containing nucleic acids encoding the engineered polypeptide including: (a) culturing the host cell containing polynucleotides encoding the engineered polypeptide under conditions facilitating the expression of the DNA molecule; and (b) obtaining the engineered polypeptides.
  • Host cells may be prokaryotic or eukaryotic and include bacteria, mammalian cells (such as Chinese Hamster Ovary (CHO) cells, monkey cells, baby hamster kidney cells, cancer cells or other cells), yeast cells, and insect cells.
  • mammalian cells such as Chinese Hamster Ovary (CHO) cells, monkey cells, baby hamster kidney cells, cancer cells or other cells
  • yeast cells such as yeast cells, and insect cells.
  • Mammalian host systems for the expression of the recombinant protein also are well known to those of skill in the art. Host cell strains may be chosen for a particular ability to process the expressed protein or produce certain post-translation modifications that will be useful in providing protein activity. Such modifications of the polypeptide include, but are not limited to, acetylation, carboxylation, glycosylation, phosphorylation, lipidation and acylation. Post-translational processing, which cleaves a "prepro" form of the protein, may also be important for correct insertion, folding and/or function. Different host cells, such as CHO, HeLa, MDCK, 293, WI38, and the like, have specific cellular machinery and characteristic mechanisms for such post-translational activities, and may be chosen to ensure the correct modification and processing of the introduced foreign protein.
  • a yeast system may be employed to generate the engineered polypeptides of the present invention.
  • the coding region of the engineered polypeptides DNA is amplified by PCR.
  • a DNA encoding the yeast pre-pro-alpha leader sequence is amplified from yeast genomic DNA in a PCR reaction using one primer containing nucleotides 1-20 of the alpha mating factor gene and another primer complementary to nucleotides 255-235 of this gene (Kurjan and Herskowitz, 1982, Cell, 30: 933-43).
  • the pre- pro-alpha leader coding sequence and engineered polypeptide coding sequence fragments are ligated into a plasmid containing the yeast alcohol dehydrogenase (ADH2) promoter, such that the promoter directs expression of a fusion protein consisting of the pre-pro-alpha factor fused to the mature engineered polypeptide.
  • ADH2 yeast alcohol dehydrogenase
  • the vector further includes an ADH2 transcription terminator downstream of the cloning site, the yeast "2-micron" replication origin, the yeast leu-2d gene, the yeast REPl and REP2 genes, the E. coli beta-lactamase gene, and an E. coli origin of replication.
  • the beta-lactamase and leu-2d genes provide for selection in bacteria and yeast, respectively.
  • the leu-2d gene also facilitates increased copy number of the plasmid in yeast to induce higher levels of expression.
  • the REPl and REP2 genes encode proteins involved in regulation of the plasmid copy number.
  • the DNA construct described in the preceding paragraph is transformed into yeast cells using a known method, e.g., lithium acetate treatment (Steams et al., 1990,. Meth. Enz. 185: 280-297).
  • the ADH2 promoter is induced upon exhaustion of glucose in the growth media (Price et al, 1987, Gene 55:287).
  • the pre-pro-alpha sequence effects secretion of the fusion protein from the cells.
  • the yeast KEX2 protein cleaves the pre -pro sequence from the mature engineered polypeptides (Bitter et al, 1984, Proc. Natl. Acad. Sci. USA 81:5330-5334).
  • Engineered polypeptides of the invention may also be recombinantly expressed in yeast, e.g. Pichia, using a commercially available expression system, e.g., the Pichia
  • the secreted engineered polypeptide is purified from the yeast growth medium by, e.g., the methods used to purify said engineered polypeptide from bacterial and mammalian cell supernatants.
  • the DNA encoding a engineered polypeptide may be cloned into a baculovirus expression vector, e.g. pVL1393 (PharMingen, San Diego, CA).
  • This engineered-polypeptide-encoding vector is then used according to the manufacturer's directions (PharMingen) or known techniques to infect Spodoptera frugiperda cells, grown for example in sF9 protein-free media, and to produce recombinant protein.
  • the protein is purified and concentrated from the media using methods known in the art, e.g.
  • heparin- Sepharose column (Pharmacia, Piscataway, New Jersey) and sequential molecular sizing columns (Amicon, Beverly, Massachusetts), and resuspended in appropriate solution, e.g. PBS.
  • SDS-PAGE analysis can be used to characterize the protein, for example by showing a single band that confirms the size of the desired engineered polypeptide, as can full amino acid amino acid sequence analysis, e.g. Edman sequencing on a Proton 2090 Peptide
  • the DNA sequence encoding the predicted mature engineered polypeptide may be cloned into a plasmid containing a desired promoter and, optionally, a leader sequence (see, e.g., Better et al, 1988, Science 240: 1041-1043). The sequence of this construct may be confirmed by automated sequencing.
  • the plasmid is then transformed into E. coli, strain MCI 061, using standard procedures employing CaC12 incubation and heat shock treatment of the bacteria (Sambrook et al., Id.). The transformed bacteria are grown in LB medium supplemented with carbenicillin, and production of the expressed protein is induced by growth in a suitable medium. If present, the leader sequence will affect secretion of the mature engineered polypeptide and be cleaved during secretion.
  • the secreted recombinant engineered polypeptide is purified from the bacterial culture media by the method described herein.
  • the engineered polypeptides may be expressed in an insect system.
  • Insect systems for protein expression are well known to those of skill in the art.
  • Autographa californica nuclear polyhedrosis virus (AcNPV) is used as a vector to express foreign genes in Spodoptera frugiperda cells or in Trichoplusia larvae.
  • the engineered polypeptide coding sequence is cloned into a nonessential region of the virus, such as the polyhedrin gene, and placed under control of the polyhedrin promoter.
  • Successful insertion of a engineered polypeptide will render the polyhedrin gene inactive and produce recombinant virus lacking coat protein coat.
  • the recombinant viruses are then used to infect S.
  • the DNA sequence encoding the engineered polypeptides may be amplified by PCR and cloned into an appropriate vector, for example, pGEX-3X
  • the pGEX vector is designed to produce a fusion protein including glutathione-S-transferase (GST), encoded by the vector, and a protein encoded by a DNA fragment inserted into the vector's cloning site.
  • GST glutathione-S-transferase
  • the primers for the PCR may be generated to include, for example, an appropriate cleavage site.
  • the recombinant fusion protein may then be cleaved from the GST portion of the fusion protein.
  • the pGEX- 3X7 engineered polypeptide construct is transformed into E.
  • coli XL-1 Blue cells (Stratagene, La Jolla, CA), and individual transformants are isolated and grown at 37 degrees C in LB medium (supplemented with carbenicillin) to an optical density at wavelength 600 nm of 0.4, followed by further incubation for 4 hours in the presence of 0.5 mM Isopropyl beta-D- Thiogalactopyranoside (Sigma Chemical Co., St. Louis, Missouri). Plasmid DNA from individual transformants is purified and partially sequenced using an automated sequencer to confirm the presence of the desired engineered polypeptide-encoding gene insert in the proper orientation.
  • the fusion protein when expected to be produced as an insoluble inclusion body in the bacteria, may be purified as described above or as follows. Cells are harvested by centrifugation; washed in 0.15 M NaCl, 10 mM Tris, pH 8, 1 mM EDTA; and treated with 0.1 mg/mL lysozyme (Sigma Chemical Co.) for 15 min. at RT. The lysate is cleared by sonication, and cell debris is pelleted by centrifugation for 10 min. at 12,000xg. The fusion protein-containing pellet is resuspended in 50 mM Tris, pH 8, and 10 mM EDTA, layered over 50% glycerol, and centrifuged for 30 min.
  • the pellet is resuspended in standard phosphate buffered saline solution (PBS) free of Mg ++ and Ca ++ .
  • PBS phosphate buffered saline solution
  • the fusion protein is further purified by fractionating the resuspended pellet in a denaturing SDS polyacrylamide gel (Sambrook et al, supra). The gel is soaked in 0.4 M KC1 to visualize the protein, which is excised and electroeluted in gel-running buffer lacking SDS. If the GST/engineered polypeptide fusion protein is produced in bacteria as a soluble protein, it may be purified using the GST Purification Module (Pharmacia Biotech).
  • the fusion protein may be subjected to digestion to cleave the GST from the mature engineered polypeptide.
  • the digestion reaction (20-40 ⁇ g fusion protein, 20-30 units human thrombin (4000 U/mg (Sigma) in 0.5 mL PBS) is incubated 16-48 hrs. at RT and loaded on a denaturing SDS-PAGE gel to fractionate the reaction products. The gel is soaked in 0.4 M KC1 to visualize the protein bands.
  • the identity of the protein band corresponding to the expected molecular weight of the engineered polypeptide may be confirmed by partial amino acid sequence analysis using an automated sequencer (Applied Biosystems Model 473 A, Foster City, CA).
  • mammalian 293 cells may be co-transfected with plasmids containing the engineered polypeptides cDNA in the pCMV vector (5 ' CMV promoter, 3' HGH poly A sequence) and pSV2neo (containing the neo resistance gene) by the calcium phosphate method.
  • the vectors should be linearized with Seal prior to transfection.
  • an alternative construct using a similar pCMV vector with the neo gene incorporated can be used.
  • Stable cell lines are selected from single cell clones by limiting dilution in growth media containing 0.5 mg/mL G418 (neomycin-like antibiotic) for 10-14 days. Cell lines are screened for engineered polypeptides expression by ELISA or Western blot, and high-expressing cell lines are expanded for large scale growth.
  • G418 neomycin-like antibiotic
  • the transformed cells are used for long-term, high-yield protein production and as such stable expression is desirable.
  • the cells may be allowed to grow for 1-2 days in an enriched media before they are switched to selective media.
  • the selectable marker is designed to confer resistance to selection, and its presence allows growth and recovery of cells that successfully express the introduced sequences. Resistant clumps of stably transformed cells can be proliferated using tissue culture techniques appropriate to the cell.
  • a number of selection systems may be used to recover the cells that have been transformed for recombinant protein production.
  • Such selection systems include, but are not limited to, HSV thymidine kinase, hypoxanthine-guanine phosphoribosyltransferase and adenine phosphoribosyltransferase genes, in tk-, hgprt- or aprt- cells, respectively.
  • antimetabolite resistance can be used as the basis of selection for dhfr, that confers resistance to methotrexate; gpt, that confers resistance to mycophenolic acid; neo, that confers resistance to the aminoglycoside, G418; also, that confers resistance to chlorsulfuron; and hygro, that confers resistance to hygromycin.
  • Additional selectable genes that may be useful include trpB, which allows cells to utilize indole in place of tryptophan, or hisD, which allows cells to utilize histinol in place of histidine.
  • Markers that give a visual indication for identification of transformants include anthocyanins, beta-glucuronidase and its substrate, GUS, and luciferase and its substrate, luciferin.
  • the engineered polypeptides of the present invention may be produced using a combination of both automated peptide synthesis and recombinant techniques.
  • either or both the exendin compound and the ABD, and optionally a linker can be made synthetically or recombinantly and then ligated together using methods known in the art, such as "native chemical ligation" and known variations thereof in which an amide bond is formed joining the parent compounds. See, e.g., United States Patent No. 6326468, which is incorporated herein by reference and for all purposes.
  • an engineered polypeptide of the present invention may contain a combination of modifications including deletion, substitution, insertion and derivatization by PEGylation (or other moiety, e.g. polymer, fatty acyl chain, C-terminal amidation).
  • PEGylation or other moiety, e.g. polymer, fatty acyl chain, C-terminal amidation.
  • Such an engineered polypeptide may be produced in stages. In the first stage, an intermediate engineered polypeptide containing the modifications of deletion, substitution, insertion, and any combination thereof, may be produced by recombinant techniques as described.
  • the intermediate engineered polypeptide is PEGylated (or subjected to other chemical derivatization, e.g., acylation, C-terminal amidation) through chemical modification with an appropriate PEGylating reagent (e.g., from NeKtar Transforming Therapeutics, San Carlos, CA) to yield the desired engineered polypeptide derivative.
  • an appropriate PEGylating reagent e.g., from NeKtar Transforming Therapeutics, San Carlos, CA
  • C-terminal amidation can be achieved by use of a glycine amino acid-C-terminally extended precursor, synthesized for example in yeast (e.g. Pichia) as alpha-factor fusion protein that will be secreted into culture medium.
  • yeast e.g. Pichia
  • the C-terminal glycine of the engineered polypeptide precursor can be converted to amide by enzymatic amidation, e.g. peptidylglycine alpha-amidating monooxygenase (PAM).
  • PAM monooxygenase
  • Peptides may be purified by any number of methods known in the art, including as described herein In one method peptides are purified by RP-HPLC (preparative and analytical) using a Waters Delta Prep 3000 system. A C4, C8 or C18 preparative column (10 ⁇ , 2.2X25 cm; Vydac, Hesperia, CA) may be used to isolate peptides, and purity may be determined using a C4, C8 or C18 analytical column (5 ⁇ , 0.46X25 cm; Vydac).
  • Amino acid analyses may be performed on the Waters Pico Tag system and processed using the Maxima program.
  • Peptides may be hydro lyzed by vapor-phase acid hydrolysis (115°C, 20-24 h). Hydro lysates may be derivatized and analyzed by standard methods (Cohen et al, THE PICO TAG METHOD: A MANUAL OF ADVANCED TECHNIQUES FOR AMINO ACID ANALYSIS, pp. 11-52, Millipore Corporation, Milford, Mass.
  • Fast atom bombardment analysis may be carried out by M-Scan, Incorporated (West Chester, Pa.). Mass calibration may be performed using cesium iodide or cesium iodide/glycerol. Plasma desorption ionization analysis using time of flight detection may be carried out on an Applied Biosystems Bio-Ion 20 mass spectrometer.
  • Engineered polypeptide expression assay Methods are available for assaying the level of protein expression by a host cell. Procedures useful for assaying the level of protein expression by a host cell are exemplified in the following typical protocol. About 25 ul BL21 E. coli cells are transformed with 2ul plasmid DNA (expression vector for the engineered polynucleotide). Cells can be plated and incubated overnight at 37 degrees C or at room temperature (RT) over a 48-hr period. A single colony can be selected and used to grow starter culture in 4 ml LB media with appropriate antibiotic for ⁇ 6 hrs.
  • RT room temperature
  • Glycerol stocks can be prepared by adding lOOul 80% sterile glycerol to 900ul stock, which can then be mixed gently and stored at -80C. A 250 ul sample can be removed for TCP uninduced sample. An aliquot, for example, 2 ml of Magic media containing appropriate antibiotic can be inoculated with 5 ul starter culture, which can then be incubated overnight (up to 24 hrs) at 37C, 300 rpm. As known in the art, Magic Media is autoinducing.
  • 60 ml Magic Media containing appropriate antibiotic can be inoculated with 60 ul starter culture in a 250ml or 125 ml Thompson flask, which can then be incubated overnight (up to 24 hrs) at 30C, 300rpm. After incubation, 250 ul culture can be removed from each tube and the cells pelleted. The cell can be resuspended in 1 ml 50 mM Tris pH 8, 150mM NaCl, to which can be added 0.1 volumes (lOOul) POP culture reagent and 1 ul r-lysozyme (1 :750 dilution in r- lysozyme buffer). The mixture can be mixed well and incubated at least 10 min at RT.
  • the preparation can then be centrifuge 10 min at 14000 x G.
  • the supernatant (soluble fraction) can be removed and retained, and samples can be prepared for gel analysis (15 ul + 5 ul LDS).
  • the remaining inclusion body pellet can be resuspended in 1ml 1% SDS with sonication.
  • the sample can be prepared for gel analysis (15ul + 5 ul LDS).
  • 1.0 volumes POP culture reagent and 1 ul r-lysozyme (1 :750 dilution in r-lysozyme buffer) can be added.
  • the mixture can be mixed well and incubated at least 10 min at RT. These samples may not need to be centrifuged.
  • the sample can then be prepared for gel analysis (15ul + 5 ul LDS).
  • NU-PAGE gels (4-12%) non-reduced in 1XMES buffer can be run and stained with SimplyBlue microwave protocol. Destaining can be conducted overnight, as known in the art.
  • a gel image can be retained,
  • Engineered polypeptides can be and were expressed and isolated as follows. A protein sequence of the desired engineered polypeptide was designed and back translated using commercial software to a DNA sequence for cloning into an E. coli expression vector. Nucleic acid sequences were either obtained as oligonucleotides and ligated using standard PCR amplification techniques, or were digested from existing expression constructs using standard restriction enzymes and then ligated together. Sequences expressing the protein of interest were placed in plasmid pET45 with a T7 promoter for inducible expression. After constructs were verified by sequencing, the vector DNA was purified and transformed into an expression host, typically BL21(DE3).
  • an expression host typically BL21(DE3).
  • a single colony was selected to grow a starter culture in 4 ml LB media for ⁇ 6 hrs.
  • Glycerol stocks were prepared by adding lOOul 80%> glycerol to 900ul stock and stored at -80C.
  • 500 ul of un-induced sample was retained for gel analysis.
  • a 60 ml culture e.g. MagicMediaTM E. coli Expression Medium; Invitrogen, USA; see Glenn et al, J. Biol. Chem. 2008, 283(19):12717-29
  • the cells were collected as a pellet by centrifuging, and frozen for later processing. Preparation of cell extract and first pass purification with Nickel resin was performed as follows. E. coli cell pellets were completely resuspended in a volume of lysis buffer (50 mM TrisHCl, 150 mM NaCl, pH 8.0) equal to the starting culture volume. Cells were then subjected to a microfluidizer (Microfluidics, MA) at 100 psi for three times. Cell extracts were centrifuged for 30 minutes at 16,000 x g to remove debris. EGTA (150mM stock) was added to the cell extract to a final concentration of 3 mM EGTA. The lysate was then applied to a Ni-NTA Superf ow column that had been washed and pre-equilibrated.
  • lysis buffer 50 mM TrisHCl, 150 mM NaCl, pH 8.0
  • Protein bound to the column was then washed with lysis buffer plus EGTA (50 mM TrisHCl, 150 mM NaCl, pH8.0, 3 mM EGTA) before the bound protein was eluted with 50 mL of elution buffer (25 mM TrisHCl, 50 mM NaCl, 250 mM Imidazol, pH8.0). Cleavage of His- Tag and subsequent purification was as follows. The eluted protein was concentrated with Amicon-Ultral5 centrifugal filter unit (Millipore, USA) and then diluted with 25 mM
  • TrisHCl, pH8.0, 50 mM NaCl to prepare for protease digestion which removes the HisTag from the N-terminus of the desired protein.
  • An Ni-NTA Superflow column (Qiagen, USA) was pre-equilabrated with 50 mM TrisHCl, 100 mM NaCl, 45 mM imidazole, pH8.0.
  • the TEV digest reaction was diluted 2-fold with 50 mM TrisHCl, 150 mM NaCl, pH8.0. The diluted digest reaction was carefully applied to the top of Ni-NTA column and flow-through was collected. To the column was added 10 mL of 50 mM trisHCl, 100 mM NaCl, 45 mM imidazole, pH8.0 to elute any unbound protein. The eluted proteins from the column were collected and combined, and then polished using size exclusion chromatography (2x with Superdex 75 HiLoad 26/60 column; GE Healthcare Biosciences, USA). Any remaining bacterial endotoxin was removed using EndoTrap Red (Lonza, Switzerland) according to manufacturer's instructions.
  • Inclusion Body preparation For engineered polypeptides that are found in the inclusion body fraction, the following procedure can be beneficial.
  • the cell pellet can be resuspended in a minimum of 100 ml Lysis buffer for each 50 ml culture. Upon the addition of 30ml, a 10ml pipette can be used to resuspend, then the tube can be washed out with an additional 70ml.
  • the resuspended cell solution can be multiply run, e.g., 4 passes, through a micro fluidizer@ 100 PSI (min) taking care to keep chamber in ice water through the entire process.
  • the fluidized slurry can be centrifuged at 14000 x g, 20 min (e.g., JLA 10.5, 10,000rpm, using 250 ml nalgene bottles).
  • the inclusion body pellet can be resuspended on ice in chilled lysis buffer with stir bar and stir plate for 1 hour at 4C after disruption with pipette tip.
  • the pellet can be resuspended a second time in distilled H 2 0 with stir bar and stir plate for 1 hour at 4C after disruption with pipette tip, followed by centrifugation at 14000 x g, 15 min.
  • the supernatant can be removed and discarded.
  • the resultant can be stored at - 80C.
  • Protein purification As described herein, numerous methods are known for isolation of expressed polypeptides. Preferred are secreted engineered polypeptides.
  • Inclusion body pellets can be solubilized in appropriate volume of solubilization buffer (8M urea or 8M guanidine, 50 mM Tris, 10 mM DTT, pH 7.75) for 1 hour at RT.
  • the solubilized pellets can be centrifuged for 20 min at 27 OOOg.
  • Filtered (e.g., 0.4 um) supernatant can be transferred drop by drop into appropriate volume of refolding buffer (50 mM Tris-HCl, 1 M urea, 0.8 M arginine, 4 mM cysteine, 1 mM cystamine; pH 8) at RT.
  • the result can then be placed at 4°C overnight or longer with gentle mixing.
  • Samples can be concentrated and run on a gel filtration column (Superdex75 26/60) at 1-2 ml/min in 4C environment using a GE
  • Healthsciences AKTA FPLC Appropriate protein containing fractions can be identified via SDS-PAGE, pooled and run through a second gel filtration column. Pooled protein can then be concentrated in Amicon filter to appropriate concentration and assayed for endotoxin levels using, e.g., Endosafe PTS Reader (Charles River), as known in the art. Once a protein sample has passed the endotoxin criteria, it can be sterile filtered, dispensed into aliquots and run through quality control assays. Quality control assays can include analytical HPLC-SEC, non reducing SDS PAGE and RP HPLC - MS to obtain approximate mass.
  • Proteins can be obtained in IxPBS (137 mM sodium chloride, 2.7 mM potassium chloride, 4.3 mM disodium phosphate, 1.4 mM monopotassium phosphate, pH7.2), distributed into aliquots and flash frozen for storage at -70 to -80 °C.
  • IxPBS 137 mM sodium chloride, 2.7 mM potassium chloride, 4.3 mM disodium phosphate, 1.4 mM monopotassium phosphate, pH7.2
  • Obesity and overweight are common and serious public health problems in the United States and throughout the world.
  • Upper body obesity is the strongest risk factor known for type 2 diabetes mellitus and is a strong risk factor for cardiovascular disease.
  • Obesity is a recognized risk factor for hypertension, atherosclerosis, congestive heart failure, stroke, gallbladder disease, osteoarthritis, sleep apnea, reproductive disorders such as polycystic ovarian syndrome, cancers of the breast, prostate, and colon, and increased incidence of complications of general anesthesia. See, e.g., Kopelman, 2000, Nature 404:635-43.
  • Obesity reduces life-span and carries a serious risk of the co-morbidities listed above, as well disorders such as infections, varicose veins, acanthosis nigricans, eczema, exercise intolerance, insulin resistance, hypertension hypercholesterolemia, cholelithiasis, orthopedic injury, and thromboembolic disease. See e.g., Rissanen et al, 1990, Br. Med. J, 301:835-7. Obesity is also a risk factor for the group of conditions called insulin resistance syndrome, or "Syndrome X" and metabolic syndrome. The worldwide medical cost of obesity and associated disorders is enormous.
  • the pathogenesis of obesity is believed to be multi-factoral.
  • a problem is that, in obese subjects, nutrient availability and energy expenditure do not come into balance until there is excess adipose tissue.
  • the central nervous system (CNS) controls energy balance and coordinates a variety of behavioral, autonomic and endocrine activities appropriate to the metabolic status of the animal.
  • the mechanisms or systems that control these activities are broadly distributed across the forebrain (e.g., hypothalamus), hindbrain (e.g., brainstem), and spinal cord.
  • metabolic (i.e., fuel availability) and cognitive (i.e., learned preferences) information from these systems is integrated and the decision to engage in appetitive (food seeking) and consummatory (ingestion) behaviors is either turned on (meal procurement and initiation) or turned off (meal termination).
  • the hypothalamus is thought to be principally responsible for integrating these signals and then issuing commands to the brainstem.
  • Brainstem nuclei that control the elements of the consummatory motor control system e.g., muscles responsible for chewing and swallowing.
  • these CNS nuclei have literally been referred to as constituting the "final common pathway" for ingestive behavior.
  • Diabetes and cardiovascular disease Diabetes mellitus is recognized as a complex, chronic disease in which 60% to 70% of all case fatalities among diabetic patients are a result of cardiovascular complications. Diabetes is not only considered a coronary heart disease risk equivalent but is also identified as an independent predictor of adverse events, including recurrent myocardial infarction, congestive heart failure, and death following a cardiovascular incident. The adoption of tighter glucose control and aggressive treatment for cardiovascular risk factors would be expected to reduce the risk of coronary heart disease complications and improve overall survival among diabetic patients. Yet, diabetic patients are two to three times more likely to experience an acute myocardial infarction than non- diabetic patients, and diabetic patients live eight to thirteen years less than non-diabetic patients.
  • Dyslipidemia is a disruption in the normal lipid component in the blood. It is believed that prolonged elevation of insulin levels can lead to dyslipidemia. Hyperlipidemia is the presence of raised or abnormal levels of lipids and/or lipoproteins in the blood.
  • Fatty liver disease e.g., nonalcoholic fatty liver disease (NAFLD) refers to a wide spectrum of liver disease ranging from simple fatty liver (steatosis), to nonalcoholic steatohepatitis (NASH), to cirrhosis (irreversible, advanced scarring of the liver). All of the stages of NAFLD have in common the accumulation of fat (fatty liver).
  • liver cells hepatocytes
  • exendins can be well suited as a treatment modality for this condition.
  • engineered polypeptides described herein which include an exendin or biologically active (hormone domain) peptide component, or fragment or analog thereof, can be useful in the treatment of fatty liver disorders.
  • AD Alzheimer's disease
  • AD Alzheimer's disease
  • GLP-1 has been reported to play an important role in regulating neuronal plasticity and cell survival.
  • GLP-1 has been reported to induce neurite outgrowth and to protect against excitotoxic cell death and oxidative injury in cultured neuronal cells.
  • GLP-1 and exendin-4 were reported to reduce endogenous levels of amyloid- beta peptide (A-beta protein) in mouse brain and to reduce levels of beta-amyloid precursor protein (beta-APP) in neurons. See, e.g., Perry et al, 2004, Curr. Drug Targets 5(6):565-571. Treatment with the engineered compounds disclosed herein can provide benefit to the therapeutic targets associated with Alzheimer's disease.
  • Parkinson's disease is the synonym of "primary parkinsonism", i.e. isolated parkinsonism due to a neurodegenerative process without any secondary systemic cause. Parkinsonism is characterized by symptoms of tremor, stiffness, and slowing of movement caused by loss of dopamine. Without wishing to be bound by any theory, it is believed that exendin-4 may act as a survival factor for dopaminergic neurons by functioning as a microglia-deactivating factor and suggest that exendin-4 may be a valuable therapeutic agent for neurodegenerative diseases such as PD. [0152] Metabolic syndrome X.
  • Metabolic Syndrome X is characterized by insulin resistance, dyslipidemia, hypertension, and visceral distribution of adipose tissue, and plays a pivotal role in the pathophysiology of type 2 diabetes. It has also been found to be strongly correlated with NASH, fibrosis, and cirrhosis of the liver. Accordingly, engineered polypeptides described herein can be useful in the treatment of metabolic syndrome X.
  • Steroid induced diabetes Glucocorticoids are well known to affect carbohydrate metabolism. In response to exogenous glucocorticoid administration, increased hepatic glucose production and reduced insulin secretion and insulin-stimulated glucose uptake in peripheral tissues is observed. Furthermore, glucocorticoid treatment alters the
  • proinsulin(Pl) /immunoreactive insulin(IRI) ratio as known in the art.
  • Typical characteristics of the hyperglycemia induced by glucocorticoids in subjects without diabetes include a minimal elevation of fasting blood glucose, exaggerated postprandial hyperglycemia, insensitivity to exogenous insulin, and non-responsiveness to metformin or sulfonylurea therapy.
  • engineered polypeptides described herein which include an exendin biologically active (hormone domain) peptide component, or fragment or analog thereof, can be useful in the treatment of steroid induced diabetes.
  • HIV Human Immunodeficiency Virus
  • HAV-l protease inhibitors Pro
  • PT use with the development of hyperglycemia began to appear. While approximately 1% to 6% of HIV-infected subjects who are treated with Pis will develop diabetes mellitus, a considerably larger proportion will develop insulin resistance and impaired glucose tolerance. Accordingly, engineered polypeptides described herein which include an exendin biologically active (hormone domain) peptide component, or fragment or analog thereof, can be useful in the treatment of HIV treatment-induced diabetes.
  • LAD A Latent Autoimmune Diabetes in Adults
  • Progressive autoimmune diabetes also known as latent autoimmune diabetes in adults (LAD A)
  • LAD A latent autoimmune diabetes in adults
  • LADA patients have circulating antibodies to either islet cell cytoplasmic antigen or, more frequently, glutamic acid decarboxylase. These subjects exhibit clinical features characteristic of both type 1 and type 2 diabetes.
  • insulin secretion is better preserved in the slowly progressing than in the rapidly progressing form of autoimmune diabetes, insulin secretion tends to deteriorate with time in LADA subjects.
  • engineered polypeptides described herein which include an exendin biologically active (hormone domain) peptide component, or fragment or analog thereof, can be useful in the treatment of LADA.
  • hypoglycemia Unawareness HU. Defective glucose counterregulation can occur even after only a single recent episode of hypoglycemia. Subjects who experience repeated episodes of hypoglycemia often lose their capacity to recognize the symptoms typically associated with hypoglycemia or impending insulin shock, a condition called "hypoglycemia unawareness". Because the-patient doesn't appreciate his or her own status, blood glucose levels can then fall so low that serious neurological problems ensue, including coma and seizure. Accordingly, engineered polypeptides described herein which include an exendin biologically active (hormone domain) peptide component, or fragment or analog thereof, can be useful in the treatment of HU.
  • GLP 1 receptor has been localized in the lung.
  • Exendins can elicit a biological response via GLP-1 receptor.
  • sarcoidosis is a systemic granulomatous disease that frequently involves the lung.
  • airway obstruction has become a recognized feature of the disease in the past years.
  • Sarcoidosis can affect the airway at any level and when the involvement includes small airways, it can resemble more common obstructive airway diseases, such as asthma and chronic bronchitis.
  • engineered polypeptides described herein which include an exendin biologically active (hormone domain) peptide component, or fragment or analog thereof, can be useful in the treatment of restrictive lung disease because such hormone domain peptide can improve elasticity of lung or delay rigidity.
  • SBS Short Bowel Syndrome
  • GLP-1 Glucagon- like peptide- 1
  • SBS patients are amenable to treatment with the engineered polypeptides described herein. Improvement in bowel frequency and form and obtaining bowel movements that are no longer meal-related can be achieved. An additional benefit is that total parenteral nutrition can be stopped. These compounds herein will provide substantial improvement in the bowel habits, nutritional status and quality of life of SBS patients, and further may reduce the need for parenteral nutrition and small bowel transplant.
  • a method for treating a disease or disorder in a subject is in need of treatment for the disease or disorder.
  • the subject is need of treatment is obese.
  • the disease or disorder is diabetes, overweight, obesity, Alzheimer's disease, fatty liver disease, dyslipidemia, coronary artery disease, stroke, SBS or hyperlipidemia, or other diseases discussed herein. Diabetes can include type I, type II, gestational or pre-diabetes as well as HIV or steroid induced diabetes.
  • the method of treatment includes administration to the subject of a engineered polypeptide as described herein in an amount effective to treatment the disease or disorder. Particularly useful for these diseases are compounds described herein having glucose lowering activity (e.g.
  • exendin-4 or its fragments or analogs linked to an ABD having reduction of body weight or reduction of food intake activity, lowering of HbAlc, delaying of gastric emptying, lowering of plasma glucagon, and/or intestinal motility benefit.
  • the disease or disorder is diabetes, overweight or obesity, or dyslipidemia or hyperlipidemia.
  • the engineered polypeptide can include ABD and HD1 polypeptides, and optionally a linker Kl, where HD1 is an exendin or fragment or analog thereof. Accordingly, the engineered polypeptide can have one of the following structures: HD1-ABD or HD1-L1-ABD.
  • the disease or disorder is diabetes, overweight, obesity, dyslipidemia, Alzheimer's disease, fatty liver disease, SBS or hyperlipidemia.
  • the engineered polypeptide may include an exendin or fragment or analog thereof. Accordingly, the engineered polypeptide can have one of the following structures: HD1-ABD or
  • the exendin in the engineered polypeptide is exendin- 4.
  • the exendin fragment is a fragment of exendin-4.
  • the exendin analog has at least 70%, for example 70%, 75%, 80%, 85%, 90%, 95% or even higher, identity with exendin-4.
  • Particularly useful for these diseases are compounds described herein having glucose lowering activity (e.g. exendin-4 or its fragments or analogs linked to an ABD), having reduction of body weight or reduction of food intake activity, lowering of HbAlc, delaying of gastric emptying, lowering of plasma glucagon, or intestinal motility benefit.
  • the disease or disorder is diabetes, overweight, obesity, dyslipidemia, Alzheimer's disease, fatty liver disease, SBS or hyperlipidemia.
  • the engineered polypeptide may include an exendin or fragment or analog thereof. Accordingly, the engineered polypeptide can have one of the following structures: HD1 ABD or HD1 LI ABD.
  • the exendin is exendin-4.
  • the exendin fragment is a fragment of exendin-4.
  • the exendin analog has at least 70%, for example 70%, 75%, 80%, 85%, 90%, 95% or even higher, identity with exendin-4. Particularly useful for these diseases are compounds described herein having glucose lowering activity (e.g.
  • exendin-4 or its fragments or analogs linked to an ABD having reduction of body weight or reduction of food intake activity, delaying of gastric emptying, lowering of plasma glucagon, or intestinal motility benefit.
  • the engineered polypeptide can include only exendin, or analog or fragment thereof, as a hormone domain.
  • the disease or disorder can be diabetes, overweight, obesity, dyslipidemia,
  • the engineered polypeptide may include an exendin or fragment or analog thereof. Accordingly, the engineered polypeptide can have one of the following structures: HD1 ABD or HD1 LI ABD. In some
  • the exendin is exendin-4.
  • the exendin fragment is a fragment of exendin-4.
  • the exendin analog has at least 70%, for example 70%, 75%, 80%, 85%, 90%, 95% or even higher, identity with exendin-4.
  • glucose lowering activity e.g. exendin-4 or its fragments or analogs linked to an ABD
  • ABD glucose lowering activity
  • HbAlc a lo weiring of HbAlc
  • delaying of gastric emptying lowering of plasma glucagon, or intestinal motility benefit.
  • Additional diseases and disorders which can be treated by the compounds and methods described herein include steroid-induced diabetes, HIV treatment-induced diabetes, latent autoimmune diabetes in adults (LAD A), Nonalcoholic steatohepatitis (NASH) and nonalcoholic fatty liver disease (NAFLD), hypoglycemia unawareness (HU), restrictive lung disease including sarcoidosis, and metabolic syndrome X.
  • the engineered polypeptide may include an exendin or fragment or analog thereof. Accordingly, the engineered polypeptide can have one of the following structures: HD1-ABD or HD1-L1-ABD.
  • the exendin is exendin-4.
  • the exendin fragment is a fragment of exendin-4.
  • the exendin analog has at least 70%, for example 70%, 75%, 80%, 85%, 90%, 95% or even higher, identity with exendin-4.
  • glucose lowering activity e.g. exendin-4 or its fragments or analogs linked to an ABD
  • the engineered polypeptide can include only exendin, or analog or fragment thereof, as a hormone domain.
  • the disease or disorder can be diabetes, overweight, obesity, dyslipidemia, Alzheimer's disease, fatty liver disease, hyperlipidemia, Parkinson's disease or
  • cardiovascular disease or other diseases described herein.
  • Additional diseases and disorders which can be treated by the compounds and methods described herein include steroid-induced diabetes, HIV treatment-induced diabetes, latent autoimmune diabetes in adults (LAD A), Nonalcoholic steatohepatitis (NASH) and nonalcoholic fatty liver disease (NAFLD), hypoglycemia unawareness (HU), restrictive lung disease including sarcoidosis, and metabolic syndrome X.
  • LAD A latent autoimmune diabetes in adults
  • NASH Nonalcoholic steatohepatitis
  • NAFLD nonalcoholic fatty liver disease
  • HU hypoglycemia unawareness
  • HU restrictive lung disease including sarcoidosis
  • metabolic syndrome X particularly useful for these diseases are compounds described herein having glucose lowering activity (e.g. exendin-4 or its fragments or analogs linked to an ABD).
  • GLP-1 receptor binding activity and affinity may be measured in any number of known methods. For example, in one method binding activity is measured using a binding displacement assay in which the receptor source is RINm5F cell membranes, and the ligand is [ 125 I]GLP-1 or iodinated exendin(l-39) or iodinated exendin(9-39). Homogenized RINm5F cell membranes are incubated in 20 mM HEPES buffer with 40,000 cpm [ 125 I]GLP-1 (or exendin) tracer, and varying concentrations of test compound for 2 hours at 23° C with constant mixing. Reaction mixtures are filtered through glass filter pads presoaked with 0.3% PEI solution and rinsed with ice-cold phosphate buffered saline. Bound counts are determined using a scintillation counter.
  • Binding affinities are calculated using GraphPad Prism® software (GraphPad Software, Inc., San Diego, CA).
  • In vitro assays for functional GLP-1 receptor activation can be performed using known methods and cells and tissues. For example, exendin-4 stimulation of GLP-1 receptor bearing cells can induce an increase in adenylate cyclase activation, cAMP synthesis, membrane depolarization, rise in intracellular calcium and increase in glucose-induced insulin secretion. See e.g., Holz et al, 1995, J. Biol. Chem. 270(30):17749-57.
  • Cell-based assays using the rMTC 6-23 (clone 6) cell line can be used to determine GLP-1 receptor agonist activity of a compound based on the cAMP generated.
  • the GLP-1 receptor agonist activity of a compound is quantitatively determined by correlations to cAMP production in cell-based assays with 6-23 (clone 6) cells.
  • the cell- based assay uses living 6-23 (clone 6) cells.
  • the 6-23 (clone 6) cells are available from the American Type Culture Collection as ATCC® No. CRL- 1607TM and the European Collection of Cell Cultures as ECACC No. 87042206.
  • the cell-based assay is a homogeneous time -resolved fluorescence assay (HTRF®).
  • HTRF® kits are commercially available from Cisbio International (Bedford, Mass.). Methods for using HTRF® kits are known in the art and the kits generally include instruction manuals, e.g., on how to prepare samples, standards, calibration curves, and conduct experiments. Homogeneous time- resolved fluorescence cell-based assays are described in U.S. Pat. No. 5,527,684, the disclosure of which is incorporated by reference herein, and Document Reference No.
  • the bioassay uses the rat thyroid carcinoma 6-23 (clone 6) cells in a cell-based assay using the HTRF® cAMP dynamic 2 1,000 assay kit, available from Cisbio as Catalog No. 62AM4PEB.
  • the HTRF® standards and calibrations are prepared following the instructions in the kit. Assays may be performed with or without the presence of albumin.
  • duration can be performed using an oral glucose tolerance test (OGTT) in which the drug is administered to the subject at a desired time point before the glucose is administered orally(to measure drug duration of action; OGTT DOA) and glucose blood levels are measured (e.g. readily done in mice).
  • OGTT DOA oral glucose tolerance test
  • Activity and duration can also be measured using an intravenous glucose tolerance test (IVGTT) in which the drug is administered to the subject at a desired time point before the glucose is administered IV (IVGTT DOA) and blood glucose levels are measured (e.g. can readily be done in rats).
  • IVGTT intravenous glucose tolerance test
  • IVGTT DOA intravenous glucose tolerance test
  • Preferred engineered compounds have a desired effect on blood glucose of at least 24 hours duration after a single dose of drug, preferably at least 3 days, at least 4 days, at least 5 days, at least 6 days, and at least 1 week after the single dose of drug is given.
  • an OGTT or IVGTT can be performed at the desired point after drug administration.
  • Body weight can also be measured, as well as food intake, or other pharmacological or pharmacokinetic parameter.
  • female NIH/Swiss mice (8-20 weeks old) are group housed with a 12: 12 hour ligh dark cycle with lights on at 0600. Water and a standard pelleted mouse chow diet were available ad libitum, except as noted. The morning of the experiment, animals are divided into
  • n 2 cages with 3 mice/cage.
  • a blood glucose sample is taken and immediately followed by an intraperitoneal injection of vehicle or compound in an amount ranging from about 1 nmol/kg to 25 nmol/kg.
  • Blood glucose can be measured at 30, 60, 120, 180, and 240 min and daily for a week or longer after the single dose.
  • doses are provided daily or even weekly over a longer period such as 14 or 28 days.
  • test means are compared to the control mean using Dunnett's test (Prism® v. 4.01, GraphPad Software Inc., San Diego, CA). Blood glucose can measured with a OneTouch® Ultra® (LifeScan, Inc., a Johnson & Johnson Company, Milpitas, CA). * p ⁇ 0.05 vs. vehicle control; ANOVA, Dunnett's test. Other parameters can also be measured.
  • the engineered polypeptides may be tested for their duration and extent of appetite suppression and for their duration and extent of effect on body weight loss in various known methods. For example, the polypeptides may be tested for appetite suppression in the mouse food intake assay and for their effect on body weight gain in diet-induced obesity (DIO) mice. An experimental protocol for such assays are described below.
  • Body Weight, fat redistribution, and lean body mass Assays can also be performed as follows. Diet-induced obesity (DIO) in the in the Sprague-Dawley rat is a valuable model for the study of obesity and regulation of energy homeostasis. These rats were developed from a line of (Crl:CD®(SD)BR) rats that are prone to become obese on a diet relatively high in fat and energy. See, for example,
  • DIO male rats are obtained from Charles River Laboratories, Inc. (Wilmington, MA). The rats are housed individually in shoebox cages at 22 °C in a 12/12-hour light dark cycle. Rats are maintained ad-libitum on a moderately high fat diet (32% kcal from fat; Research Diets D1226B). The animals typically achieve a mean body weight of about 500 g. Levin DIO rats are habituated to caging environment for 7 days.
  • compositions including
  • pharmaceutically acceptable carrier refers to pharmaceutical excipients, for example, pharmaceutically, physiologically, acceptable organic or inorganic carrier substances suitable for enteral or parenteral application that do not deleteriously react with the active agent.
  • suitable pharmaceutically acceptable carriers include water, salt solutions (e.g., Ringer's solution and the like), alcohols, oils, gelatins, and carbohydrates such as lactose, amylose or starch, fatty acid esters, hydroxymethycellulose, and polyvinyl pyrrolidine.
  • Such preparations can be sterilized and, if desired, mixed with auxiliary agents such as lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure, buffers, coloring, and/or aromatic substances and the like that do not deleteriously react with the compounds of the invention.
  • auxiliary agents such as lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure, buffers, coloring, and/or aromatic substances and the like that do not deleteriously react with the compounds of the invention.
  • a pharmaceutical composition which includes a engineered polypeptide as described herein in combination with a pharmaceutically acceptable excipient.
  • the pharmaceutical composition is an oral pharmaceutical composition, as described herein.
  • the pharmaceutical composition is a long lasting pharmaceutical composition.
  • the term "long lasting" in the context of administration of a pharmaceutical composition refers to duration of action.
  • a long lasting pharmaceutical composition may be administered at intervals of, for example, 1 hr, 2 hr, 4 hr, 8 hr, 12 hr, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 1 week, 2 weeks, 3 weeks, 1 month or even longer.
  • administration is twice a day (i.e., "twice daily”).
  • administration is once a day (i.e., "once daily”).
  • administration is once a week (i.e., "once weekly”).
  • the engineered polypeptide is selected from the engineered polypeptides set forth in Tables 2, 3 A and 3B herein.
  • the engineered polypeptide is selected from the engineered polypeptides set forth in Tables 2 and 3 A herein.
  • the engineered polypeptide is selected from the engineered polypeptide
  • the engineered polypeptides described herein can be administered alone or can be co-administered to a subject.
  • Co-administration is meant to include simultaneous or sequential administration of the compounds individually or in combination (more than one compound).
  • obesity can be beneficially treated with a combination therapy including leptin (e.g., metreleptin) and an amylin (e.g., pramlintide). See e.g., U.S. Published Appl. No. 2008/0207512.
  • an engineered polypeptide described herein including an ABD and an exendin compound useful for treatment of e.g., obesity and overweight can be administered alone to achieve such treatment or coadministered with either a leptin or leptin agonist, e.g. metreleptin, and/or an amylin or amylin agonist, e.g. pramlintide.
  • a leptin or leptin agonist e.g. metreleptin
  • an amylin or amylin agonist e.g. pramlintide
  • the formulations and methods described herein further provide that the exendin, exendin analog or exendin analog agonist engineered polypeptide is co-administered with one or more anti-diabetic agents, such as anti-hyperglycemia agents, e.g. insulin (including regular, short acting, long-acting, and basal insulins), amylins, pramlintide, metformin and thiazolidinediones (including rosiglitazone and pioglitazone).
  • anti-diabetic agents such as anti-hyperglycemia agents, e.g. insulin (including regular, short acting, long-acting, and basal insulins), amylins, pramlintide, metformin and thiazolidinediones (including rosiglitazone and pioglitazone).
  • the formulations and methods described herein further provide that the exendin, exendin analog or exendin analog agonist engineered polypeptide is co-administered with one or more cholesterol and/or triglyceride lowering agents.
  • exemplary agents include HMG Co A reductase inhibitors (e.g., atorvastatin, fluvastatin, lovastatin, pravastatin, rosuvastatin, simvastatin); bile ace sequestrants (e.g., colesevelam,
  • cholestyramine colestipol
  • fibrates e.g., fenofibrate, clofibrate, gemfibrozil
  • ezetimibe nicotinic acid, probucol, a lovastatin/niacin combination; an atorvastatin/amlodipine combination; and a simvastatin/ezetimibe combination.
  • compositions for use as a medicament i.e. for use in therapy, since the exendin compound is a therapeutically active compound, and surprisingly retains activity when fused to ABD.
  • Compositions including an engineered polypeptide, either liquid or dry form, and optionally at least one pharmaceutically acceptable carrier and/or excipient are also specifically contemplated and are exemplified herein.
  • the composition has an ability to associate with albumin in vivo or in vitro. In certain cases, it may be of benefit to form a complex of the composition with albumin outside of a living organism, i.e. to add exogenous albumin to the composition. Such a composition may be lyophilized, providing a formulation that is suitable for storage at ambient temperature.
  • albumin such as human serum albumin, and which may optionally be in dry form.
  • Co-administration can be achieved by separately administering the exendin, exendin agonist, or exendin analog agonist engineered polypeptide with the second agent, or by administering a single pharmaceutical formulation including the exendin, exendin agonist, or exendin analog agonist engineered polypeptide and the second agent.
  • Appropriate dosage regimens for the second agents are generally known in the art.
  • the preparations can also be co-administered, when desired, with other active substances (e.g. to reduce metabolic degradation) as known in the art or other therapeutically active agents.
  • An exendin engineered polypeptide described herein can be administered with other active anti-diabetes or anti-obesity agents, such as leptin or leptin agonists and amylin or amylin agonist compounds, e.g. the amylins, including davalintide and their analogs.
  • Amylins is a peptide hormone synthesized by pancreatic ⁇ -cells that is co- secreted with insulin in response to nutrient intake.
  • amylin The sequence of amylin is highly preserved across mammalian species, with structural similarities to calcitonin gene-related peptide (CGRP), the calcitonins, the intermedins, and adrenomedullin, as known in the art.
  • CGRP calcitonin gene-related peptide
  • the glucoregulatory actions of amylin complement those of insulin by regulating the rate of glucose appearance in the circulation via suppression of nutrient-stimulated glucagon secretion and slowing gastric emptying.
  • pramlintide a synthetic and equipotent analogue of human amylin, reduces postprandial glucose excursions by suppressing inappropriately elevated postprandial glucagon secretion and slowing gastric emptying.
  • the sequences of rat amylin, human amylin and pramlintide follow:
  • KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY (SEQ ID NO:6); KCNT ATC ATQRLANFL VHS SNNFGAILS STNVGSNT Y (SEQ ID NO:7);
  • Davalintide also known as "AC-2307” is a potent amylin agonist useful in the treatment of a variety of disease indications. See WO 2006/083254 and WO 2007/114838, each of which is incorporated by reference herein in its entirety and for all purposes.
  • Davalintide is a chimeric peptide, having an N-terminal loop region of amylin or calcitonin and analogs thereof, an alpha-helical region of at least a portion of an alpha-helical region of calcitonin or analogs thereof or an alpha-helical region having a portion of an amylin alpha-helical region and a calcitonin alpha-helical region or analog thereof, and a C- terminal tail region of amylin or calcitonin.
  • the sequences of human calcitonin, salmon calcitonin and davalintide follow:
  • KCNTATCVLGRLSQELHRLQTYPRTNTGSNTY (SEQ ID NO: l 1).
  • amylins and davalintide, and fragment and analogs thereof can require C-terminal amidation to elicit a full biological response. It is understood that amylin compounds such as those described herein which include amylins and/or davalintide, and fragment and analogs thereof, can be amidated at the C-terminal.
  • Amylin agonist compounds include native amylin peptides, amylin analog peptides, and other compounds (e.g., small molecules) that have amylin agonist activity.
  • amylin agonist compounds can be derived from natural sources, can be synthetic, or can be derived from recombinant DNA techniques.
  • Amylin agonist compounds have amylin agonist receptor binding activity and may include amino acids (e.g., natural, unnatural, or a combination thereof), peptide mimetics, chemical moieties, and the like.
  • amino acids e.g., natural, unnatural, or a combination thereof
  • peptide mimetics e.g., amino acids, unnatural, or a combination thereof
  • chemical moieties e.g., amino acids, unnatural, or a combination thereof
  • the skilled artisan will recognize amylin agonist compounds using amylin receptor binding assays or by measuring amylin agonist activity in soleus muscle assays.
  • amylin agonist compounds will have an IC 50 of about 200 nM or less, about 100 nM or less, or about 50 nM or less, in an amylin receptor binding assay, such as that described herein, in US Patent No. 5,686,411, and US Publication No. 2008/0176804, the disclosures of which are incorporated by reference herein in their entireties and for all purposes.
  • amylin agonist compounds will have an EC50 of about 20 nM or less, about nM 15 or less, about nM 10 or less, or about nM 5 or less in a soleus muscle assay, such as that described herein and in US Patent No. 5,686,411.
  • the amylin agonist compound has at least 90% or 100% sequence identity to 25 ' 28 ' 29 Pro-human-amylin.
  • the amylin agonist compound is a peptide chimera of amylin (e.g., human amylin, rat amylin, and the like) and calcitonin (e.g., human calcitonin, salmon calcitonin, and the like). Suitable and exemplary amylin agonist compounds are also described in US Publication No.
  • the compounds can be co-administered with another active agent.
  • the compounds can be co-administered with another active agent.
  • the engineered compounds herein are inherently long-acting, they are suitable for once daily, once weekly or longer administration. Accordingly, the other agent may be administered either in one or multiple doses, e.g. once daily, twice daily, three times daily, once weekly, as needed, during the period of dosing for the exendin engineered polypeptide, e.g. once weekly.
  • the engineered polypeptides may be formulated into a stable, safe pharmaceutical composition for administration to a patient.
  • Pharmaceutical formulations contemplated for use in the methods of the invention may include approximately 0.01 to 1.0% (w/v), in certain cases 0.05 to 1.0%, of the engineered polypeptide, approximately 0.02 to 0.5% (w/v) of an acetate, phosphate, citrate or glutamate buffer allowing a pH of the final composition of from about 3.0 to about 7.0; approximately 1.0 to 10% (w/v) of a
  • carbohydrate or polyhydric alcohol tonicifier and, optionally, approximately 0.005 to 1.0% (w/v) of a preservative selected from the group of m-cresol, benzyl alcohol, methyl, ethyl, propyl and butyl parabens and phenol.
  • a preservative selected from the group of m-cresol, benzyl alcohol, methyl, ethyl, propyl and butyl parabens and phenol.
  • a preservative selected from the group of m-cresol, benzyl alcohol, methyl, ethyl, propyl and butyl parabens and phenol.
  • a pharmaceutical formulation of the present engineered polypeptides may contain a range of concentrations of the compound(s), e.g., between about 0.01%) to about 98%o w/w, or between about 1 to about 98%> w/w, or preferably between 80%> and 90%) w/w, or preferably between about 0.01% to about 50%> w/w, or more preferably between about 10% to about 25% w/w in these embodiments.
  • a sufficient amount of water for injection may be used to obtain the desired concentration of solution.
  • Additional tonicifying agents such as sodium chloride, as well as other known excipients, may also be present, if desired. In some cases, such excipients are useful in maintenance of the overall tonicity of the compound.
  • An excipient may be included in the presently described formulations at various concentrations. For example, an excipient may be included in the concentration range from about 0.02% to about 20% w/w, preferably between about 0.02% and 0.5% w/w, about 0.02% to about 10% w/v, or about 1% to about 20% w/w.
  • an excipient may be included in solid (including powdered), liquid, semi-solid or gel form.
  • the pharmaceutical formulations may be composed in various forms, e.g., solid, liquid, semisolid or liquid.
  • solid as used herein, is meant to encompass all normal uses of this term including, for example, powders and lyophilized formulations.
  • the presently described formulations may be lyophilized.
  • buffer when used with reference to hydrogen-ion concentration or pH, refer to the ability of a system, particularly an aqueous solution, to resist a change of pH on adding acid or alkali, or on dilution with a solvent.
  • Characteristic of buffered solutions which undergo small changes of pH on addition of acid or base, is the presence either of a weak acid and a salt of the weak acid, or a weak base and a salt of the weak base.
  • An example of the former system is acetic acid and sodium acetate.
  • the change of pH is slight as long as the amount of hydronium or hydroxyl ion added does not exceed the capacity of the buffer system to neutralize it.
  • liquid vehicles are suitable for use in the formulations of engineered polypeptides, for example, water or an aqueous/organic solvent mixture or suspension.
  • the stability of a engineered polypeptide formulation for use as described herein is enhanced by maintaining the pH of the formulation in a range determined by methods known in the art.
  • the pH of the formulation is maintained in the range of about 3.5 to 5.0, or about 3.5 to 6.5, in some embodiments from about 3.7 to 4.3, or about 3.8 to 4.2.
  • pH may be about 4.0, about 5.0, about 6.0, about 7.0, about 8.0, about 9.0, or even higher.
  • pH may be in the physiological range, pH 6-8, preferably pH 7-7.6.
  • the buffer with the engineered polypeptide is an acetate buffer (preferably at a final formulation concentration of from about 1-5 to about 60 mM), phosphate buffer (preferably at a final formulation concentration of from about 1-5 to about to about 30 mM) or glutamate buffer (preferably at a final formulation concentration of from about 1-5 to about to about 60 mM).
  • the buffer is acetate (preferably at a final formulation concentration of from about 5 to about 30 mM).
  • a stabilizer may be included in the formulations but is not necessarily needed. If included, however, a stabilizer useful in the practice of the present invention is a
  • a suitable stabilizer useful in the practice of the present invention is approximately 1.0 to 10% (w/v) of a carbohydrate or polyhydric alcohol.
  • the polyhydric alcohols and carbohydrates share the same feature in their backbones, i.e.,— CHOH— CHOH— , which is responsible for stabilizing the proteins.
  • the polyhydric alcohols include such compounds as sorbitol, mannitol, glycerol, and polyethylene glycols (PEGs). These compounds are straight-chain molecules.
  • the carbohydrates such as mannose, ribose, sucrose, fructose, trehalose, maltose, inositol, and lactose, on the other hand, are cyclic molecules that may contain a keto or aldehyde group. These two classes of compounds have been demonstrated to be effective in stabilizing protein against denaturation caused by elevated temperature and by freeze-thaw or freeze-drying processes.
  • Suitable carbohydrates include: galactose, arabinose, lactose or any other carbohydrate which does not have an adverse affect on a diabetic patient, i.e., the carbohydrate is not metabolized to form unacceptably large concentrations of glucose in the blood.
  • Such carbohydrates are well known in the art as suitable for diabetics.
  • Sucrose and fructose are suitable for use with the compound in non-diabetic applications (e.g. treating obesity).
  • the compound is stabilized with a polyhydric alcohol such as sorbitol, mannitol, inositol, glycerol, xylitol, and
  • mannitol is the preferred polyhydric alcohol in some embodiments.
  • Another useful feature of the lyophilized formulations of the present invention is the maintenance of the tonicity of the lyophilized formulations described herein with the same formulation component that serves to maintain their stability.
  • mannitol is the preferred polyhydric alcohol used for this purpose.
  • USP United States Pharmacopeia
  • anti-microbial agents in bacteriostatic or fungistatic concentrations must be added to preparations contained in multiple dose containers. They must be present in adequate concentration at the time of use to prevent the multiplication of microorganisms inadvertently introduced into the preparation while withdrawing a portion of the contents with a hypodermic needle and syringe, or using other invasive means for delivery, such as pen injectors.
  • Antimicrobial agents should be evaluated to ensure compatibility with all other components of the formula, and their activity should be evaluated in the total formula to ensure that a particular agent that is effective in one formulation is not ineffective in another.
  • a preservative is, in the common pharmaceutical sense, a substance that prevents or inhibits microbial growth and may be added to pharmaceutical formulations for this purpose to avoid consequent spoilage of the formulation by microorganisms. While the amount of the preservative is not great, it may nevertheless affect the overall stability of the peptide.
  • the preservative for use in the pharmaceutical compositions can range from 0.005 to 1.0% (w/v), in some embodiments range for each preservative, alone or in combination with others, is: benzyl alcohol (0.1-1.0%), or m-cresol (0.1-0.6%), or phenol (0.1-0.8%) or combination of methyl (0.05-0.25%) and ethyl or propyl or butyl (0.005%- 0.03%) parabens.
  • the parabens are lower alkyl esters of para-hydroxybenzoic acid.
  • Engineered polypeptides may not have a tendency to adsorb onto the glass in a glass container when in a liquid form, therefore, a surfactant may not be required to further stabilize the pharmaceutical formulation.
  • a surfactant should be used in their formulation. These formulations may then be lyophilized. Surfactants frequently cause denaturation of protein, both of hydrophobic disruption and by salt bridge separation. Relatively low concentrations of surfactant may exert a potent denaturing activity, because of the strong interactions between surfactant moieties and the reactive sites on proteins. However, judicious use of this interaction can stabilize proteins against interfacial or surface denaturation.
  • Surfactants which could further stabilize the engineered polypeptide may optionally be present in the range of about 0.001 to 0.3% (w/v) of the total formulation and include polysorbate 80 (i.e., polyoxyethylene(20) sorbitan monooleate), CHAPS® (i.e., 3-[(3-cholamidopropyl) dimethylammonio]l-propanesulfonate), Brij® (e.g., Brij® 35, which is (polyoxyethylene (23) lauryl ether), poloxamer, or another non-ionic surfactant.
  • polysorbate 80 i.e., polyoxyethylene(20) sorbitan monooleate
  • CHAPS® i.e., 3-[(3-cholamidopropyl) dimethylammonio]l-propanesulfonate
  • Brij® e.g., Brij® 35, which is (polyoxyethylene (23) lauryl ether), poloxamer, or another non-ionic
  • Parenteral formulations preferably may be isotonic or substantially isotonic.
  • a preferred vehicle for parenteral products is water. Water of suitable quality for parenteral administration can be prepared either by distillation or by reverse osmosis. Water for injection is the preferred aqueous vehicle for use in the pharmaceutical formulations.
  • Such additional ingredients may include, e.g., wetting agents, emulsifiers, oils, antioxidants, bulking agents, tonicity modifiers, chelating agents, metal ions, oleaginous vehicles, proteins (e.g., human serum albumin, gelatin or proteins) and a zwitterion (e.g., an amino acid such as betaine, taurine, arginine, glycine, lysine and histidine).
  • proteins e.g., human serum albumin, gelatin or proteins
  • a zwitterion e.g., an amino acid such as betaine, taurine, arginine, glycine, lysine and histidine.
  • polymer solutions, or mixtures with polymers provide the opportunity for controlled release of the peptide.
  • Such additional ingredients should not adversely affect the overall stability of the pharmaceutical formulation of the present invention.
  • Containers are also an integral part of the formulation of an injection and may be considered a component, for there is no container that is totally inert, or does not in some way affect the liquid it contains, particularly if the liquid is aqueous. Therefore, the selection of a container for a particular injection must be based on a consideration of the composition of the container, as well as of the solution, and the treatment to which it will be subjected.
  • Adsorption of the peptide to the glass surface of the vial can also be minimized, if necessary, by use of borosilicate glass, for example, Wheaton Type I borosilicate glass #33 (Wheaton Type 1-33) or its equivalent (Wheaton Glass Co.).
  • borosilicate glass for example, Wheaton Type I borosilicate glass #33 (Wheaton Type 1-33) or its equivalent (Wheaton Glass Co.).
  • Other vendors of similar borosilicate glass vials and cartridges acceptable for manufacture include Kimbel Glass Co., West Co., Bunder Glas GMBH and Form a Vitrum.
  • the biological and chemical properties of the compound may be stabilized by formulation and lyophilization in a Wheaton Type 1-33 borosilicate serum vial to a final concentration of 0.1 mg/ml and 10 mg/ml of the compound in the presence of 5% mannitol, and 0.02% Tween 80.
  • each vial is preferably sealed with a rubber stopper closure held in place by an aluminum band.
  • Stoppers for glass vials such as, West 4416/50, 4416/50 (Teflon faced) and
  • stoppers can be used as the closure for pharmaceutical for injection.
  • these stoppers are compatible with the peptide as well as the other components of the formulation.
  • the inventors have also discovered that these stoppers pass the stopper integrity test when tested using patient use patterns, e.g., the stopper can withstand at least about 100 injections.
  • the peptide can be lyophilized in to vials, syringes or cartridges for subsequent reconstitution.
  • Liquid formulations of the present invention can be filled into one or two chambered cartridges, or one or two chamber syringes.
  • the manufacturing process for the above liquid formulations generally involves compounding, sterile filtration and filling steps.
  • the compounding procedure involves dissolution of ingredients in a specific order (preservative followed by stabilizer/tonicity agents, buffers and peptide) or dissolving at the same time.
  • any suitable sterilization process can be used in developing the peptide pharmaceutical formulation of the present invention.
  • Typical sterilization processes include filtration, steam (moist heat), dry heat, gases (e.g., ethylene oxide, formaldehyde, chlorine dioxide, propylene oxide, beta-propiolactone, ozone, chloropicrin, peracetic acid methyl bromide and the like), exposure to a radiation source, and aseptic handling.
  • Filtration is the preferred method of sterilization for liquid formulations of the present invention.
  • the sterile filtration involves filtration through 0.45 um and 0.22 um (1 or 2) which may be connected in series. After filtration, the solution is filled into appropriate vials or containers.
  • the engineered polypeptides described herein are administered peripherally to the subjects.
  • the liquid pharmaceutical formulations of the present invention are intended for parenteral administration. Suitable routes of administration include intramuscular, intravenous, subcutaneous, intradermal, intraarticular, intrathecal and the like.
  • the subcutaneous route of administration is preferred.
  • mucosal delivery is also preferred.
  • routes include, but are not limited to, oral, nasal, sublingual, pulmonary and buccal routes which may include administration of the peptide in liquid, semi-solid or solid form.
  • administration via these routes can require substantially more compound to obtain the desired biological effects due to decreased bioavailability compared to parenteral delivery.
  • parenteral controlled release delivery can be achieved by forming polymeric microcapsules, matrices, solutions, implants and devices and administering them parenterally or by surgical means.
  • controlled release formulations are described in U.S. Pat. Nos. 6,368,630, 6,379,704, and 5,766,627, which are incorporated herein by reference. These dosage forms may have a lower bioavailability due to entrapment of some of the peptide in the polymer matrix or device. See e.g., U.S. Pat. Nos. 6,379,704, 6,379,703, and 6,296,842, each of which is incorporated herein by reference in its entirety and for all purposes.
  • the compounds may be provided in dosage unit form containing an amount of the engineered polypeptide that will be effective in one or multiple doses.
  • an effective amount of the engineered polypeptide will vary with many factors including the age and weight of the subject, the subject's physical condition, the condition to be treated, and other factors known in the art.
  • An effective amount of the engineered polypeptides will also vary with the particular combination administered. As described herein, administration of the engineered
  • polypeptides in combination may allow for a reduced amount of any of the administered engineered polypeptides to be an effective amount.
  • Administration can be by oral route, including transcellular, paracellular or receptor-mediated routes.
  • the engineered polypeptides containing an exendin as described herein are orally available, in part because of their relatively small size and relative stability to gut enzymes. It has been reported that tight junctions between intestinal cells opened by absorption/permeation enhancers are less than 20 nm wide. See e.g., Chao et al, 1998, J. Drug Targeting, 6:37-43. Accordingly, a sufficiently small (for example, less than 10 kD or 15 kD) engineered polypeptide as described herein can transit the gut wall and bind albumin in the portal system, thereby gaining access to the circulation.
  • Oral delivery of the engineered polypeptides of the present invention may be twice daily, once daily, once other day, once every three days, once weekly, once in two weeks, one in three weeks, or even once a month.
  • Oral delivery systems suitable for other peptides can be used.
  • the oral delivery system may have a relatively rapid uptake profile, e.g. from 1 to 4 hours, in which case the inherently long-duration of action of the engineered polypeptide provides the extended duration of action desired, such as for once daily or once weekly administration.
  • the duration of action can be selected, for example, by choice of ABD and its affinity for albumin. While not wishing to be bound by theory, it is believed that higher affinity to albumin will yield longer circulation times providing longer duration of action.
  • Oral delivery can be tested using known in vitro and in vivo methods.
  • a mouse can be orally gavaged with a solution containing an engineered polypeptide formulated with or without a permeation/absorption enhancer and/or protease inhibitor in order to test orally availability and effect of any added excipient.
  • Either or both pharmacodynamic (therapeutic effects) and pharmacokinetic (drug properties) can be measured over time, such as drug plasma levels, acute or chronic glucose and/or HbAlc lowering, insulin plasma levels, food intake inhibition, weight loss, and/or lipid levels.
  • pharmacodynamic therapeutic effects
  • pharmacokinetic drug properties
  • compositions provided herein include compositions wherein the active ingredient is contained in a therapeutically effective amount, i.e., in an amount effective to achieve its intended purpose.
  • the actual amount effective for a particular application will depend, inter alia, on the condition being treated.
  • such compositions when administered in methods to treat diabetes, such compositions will contain an amount of active ingredient effective to achieve the desired result (e.g. decreasing fasting blood glucose in a subject).
  • an amount of active ingredient effective to achieve the desired result e.g. decrease the body mass.
  • the dosage and frequency (single or multiple doses) of compound administered can vary depending upon a variety of factors, including route of administration; size, age, sex, health, body weight, body mass index, and diet of the recipient; nature and extent of symptoms of the disease being treated (e.g., the disease responsive to compounds described herein; fasting blood glucose); presence of other diseases or other health-related problems; kind of concurrent treatment; and complications from any disease or treatment regimen.
  • Other therapeutic regimens or agents can be used in conjunction with the methods and compounds of the invention.
  • Therapeutically effective amounts for use in humans may be determined from animal models. For example, a dose for humans can be formulated to achieve a
  • the dosage in humans can be adjusted by monitoring one or more physiological parameters, including but not limited to blood sugar and body mass, and adjusting the dosage upwards or downwards, as described above and known in the art.
  • Dosages may be varied depending upon the requirements of the patient and the compound being employed.
  • the dose administered to a patient should be sufficient to affect a beneficial therapeutic response in the patient over time.
  • the size of the dose also will be determined by the existence, nature, and extent of any adverse side effects.
  • treatment is initiated with smaller dosages, which are less than the optimum dose of the compound. Thereafter, the dosage is increased by small increments until the optimum effect under circumstances is reached.
  • the dosage range is 0.001% to 10% w/v. In another embodiment, the dosage range is 0.1 % to 5% w/v.
  • typical doses may contain from a lower limit of about 1 ug, 5 ug, 10 ug, 50 ug, 100 ug to 150ug per day to an upper limit of about to 50 ug, to 100 ug, to 150 ug, to 200 ug or even to 300 ug of the pharmaceutical compound per week in view of the extended half-life of the engineered polypeptides herein.
  • the doses may be delivered in discrete unit doses at the desired interval, e.g. daily or weekly.
  • Dosage amounts and intervals can be adjusted individually to provide levels of the administered compound effective for the particular clinical indication being treated. This will provide a therapeutic regimen that is commensurate with the severity of the individual's disease state.
  • an effective prophylactic or therapeutic treatment regimen can be planned that does not cause substantial toxicity and yet is entirely effective to treat the clinical symptoms demonstrated by the particular patient.
  • This planning should involve the careful choice of active compound by considering factors such as compound potency, relative bioavailability, patient body weight, presence and severity of adverse side effects, preferred mode of administration, and the toxicity profile of the selected agent.
  • the surprising dose-sparing property of the engineered polypeptides of the present invention provides for a superior pharmaceutical agent. Also surprising in the case of the exendin-containing engineered polypeptides are their oral availability.
  • the superior properties including dose-sparing allow for lower dosing, thus less or less severe side-effects and improved cost of goods, and/or more cost-effective and simpler formulations for once daily or once weekly administration not currently achieved by the parent compounds alone.
  • the ratio between toxicity and therapeutic effect for a particular compound is its therapeutic index and can be expressed as the ratio between LD 50 (the amount of compound lethal in 50% of the population) and ED 50 (the amount of compound effective in 50% of the population).
  • LD 50 the amount of compound lethal in 50% of the population
  • ED 50 the amount of compound effective in 50% of the population.
  • Therapeutic index data obtained from cell culture assays and/or animal studies can be used in formulating a range of dosages for use in humans.
  • the dosage of such compounds preferably lies within a range of plasma concentrations that include the ED 50 with little or no toxicity.
  • the dosage may vary within this range depending upon the dosage form employed and the route of administration utilized. See, e.g. Fingl et al, In: THE PHARMACOLOGICAL BASIS OF
  • THERAPEUTICS Ch. l, p.l, 1975.
  • the exact formulation, route of administration, and dosage can be chosen by the individual physician in view of the patient's condition and the particular method in which the compound is used.
  • fusion of an ABD albumin binding domain with a hormone domain as described herein can provide decreased immunogenicity as judged by a reduction in immune response relative to the hormone domain without ABD fusion. See e.g., WO 2009/016043, incorporated herein by reference in its entirety and for all purposes.
  • Peptides useful in the examples following include: HaPGTFTSDLSKQMEEE AVRLFIEWLK GGPSSGAPPPSTGGGGSASLAEAKVLANRELDKYGVSDFYKRLINK AKTVEGVEALKLHILAALP; HAEGTFTSDVSSYLEGQAAKEFIAWLVKLAEAKVLAN RELDKYGVSDFYKRLINKAKTVEGVE ALKLHILAALP (SEQ ID NO : 164);
  • HGEGTFTSDLSKQMEEEAVRLFIEWLKLAEAKVLANRELDKYGVSDFYKRLINKAK TVEGVEALKLHILAALP (SEQ ID NO: 165); HGEGTFTSDLSKQMEEEAVRLFIEW LKNGGPSSGAPPPSGGSLKNAKEDAIAELKKAGITSDFYFNAVNKAKTVEEVNALKN EILKALP (Cmpd 22) (SEQ ID NO: 168); H(Aib)QGTFTSDYSKYLDEQAAKEFIAWLMN TYGVSDFYKRLINKAKTVEGVEALKLHILAALP (SEQ ID NO: 171);
  • HSQGTFTSDYSKYLDEQAAKEFIAWLMNTYGVSDFYKRLINKAKTVEGVEALKLHIL AALP (SEQ ID NO: 172); HSQGTFTSDYSKYLDEQAAKEFIAWLMNTGGGSYGVSD FYKRLINKAKTVEGVEALKLHILAALP (SEQ ID NO: 173); HaPGTFTSDLSKQMEEE AVRLFIEWLKNGGPSSGAPPPSTGGGGSASLAEAKVLANRELDKYGVSDFYKRLINK AKTVEGVEALKLHILAALP (Cmpd 14), and [[Lys27#]HGEGTFTSDLSKQMEEEA VRLFIE WLKNGGP S S G APPP S ] [L AE AKVL ANRELDKYG VSDF YKRLINKAKT VEG VE ALKLHILAALP-GGG-#] (Cmpd 30).
  • a lower case single-letter amino acid abbreviation (SEQ ID NO
  • Example 1 Purification of exendin analog- ABD engineered polypeptide.
  • Method Exemplary Cmpd 15 (SEQ ID NO: 163) was initially produced having an N-terminal extension which incorporates a His 6 (SEQ ID NO:49) "tag" as known in the art, with sequence: MAHHHHHHVGTGSNENLYFQHGEGTFTSDLSKQLEEEAVRLFIEW LKQGGPSKEIISTGGGGSASLAEAKVLANRELDKYGVSDFYKRLINKAKTVEGVEAL KLHILAALP (SEQ ID NO:50).
  • Preparation of cell extract Preparation of cell extract.
  • cell pellets from 50 mL of cell cultures were completely resuspended in 60 mL of lysis buffer (50 mM TrisHCl, 150 mM NaCl, pH 8.0). Resuspended cells were run through a microfluidizer (Microfluidics, MA) at 100 PSI three times. Cell extracts were centrifuged for 30 min at 16,000 x g to remove debris. EGTA (150 mM stock) was added to cell extract to a final concentration of 3 mM.
  • lysis buffer 50 mM TrisHCl, 150 mM NaCl, pH 8.0
  • Resuspended cells were run through a microfluidizer (Microfluidics, MA) at 100 PSI three times. Cell extracts were centrifuged for 30 min at 16,000 x g to remove debris. EGTA (150 mM stock) was added to cell extract to a final concentration of 3 mM.
  • Ni-NTA chromatography Ten mL of 50% suspension of Ni-NTA superflow was packed to a 15 mL empty column. The column was washed with 10 mL of water, 50 mL of lysis buffer, and 20 mL of lysis buffer with 3 mM EGTA (50 mM TrisHCl, 150 mM NaCl, pH8.0, 3 mM EGTA). Cell extract was carefully added on the top of Ni-NTA column, and the flow-through was collected. The column was washed with 30 mL of lysis buffer with
  • EGTA 50 mM TrisHCl, 150 mM NaCl, pH8.0, 3 mM EGTA.
  • Ten mL of elution buffer 25 mM TrisHCl, 50 mM NaCl, 250 mM imidazole, pH8.0 was added to the top of column, and the elution fractions (2 mL/fraction) were collected. SDS-PAGE was run to check the flow through and each fraction. Fractions containing the His-tagged compound were pooled.
  • TEV protease digestion His 6 -tagged compound was diluted three fold with 25 mM TrisHCl, 50 mM NaCl, pH8.0. ⁇ -mercaptoethanol (0.1%) and 2% of Turbo TEV protease (2 mg/mL, 10,000 units/mg, Accelagen), were added, and the result was mixed and incubated at RT for 2 hours and at 4°C over night.
  • Equilibration Buffer was added, and mixing was conducted by gently shaking the tube for approximately 5 seconds. The supernatant was centrifuged and aspirated. This step was repeated two additional times. Protein sample (5.5 mL) was added to the resin and incubated for 90 minutes at RT, with gentle rocking or rotating of the tube while incubating. The result was centrifuged at 1200 x g for 5 minutes, and the supernatant was transferred to a clean tube.
  • Exendin-ABD engineered polypeptides of the invention retained sufficient exendin activity in an in vitro cell activation assay. Additionally, the engineered polypeptides provided dramatically improved duration of action for blood glucose lowering and body weight loss, as when compared to exendin-4, when administered as a single dose to a mammal. Surprisingly, duration of action can be extended to at least 1 day, even at least 4 days, and even at least 7 days, or longer, in a rodent model, which translates to at least one week duration of action in a human subject, thus suitable for twice daily, once daily, three times weekly, twice weekly or even once weekly administration. [0241] Functional activity of the compounds disclosed herein can be determined using a cell line expressing GLP-1 receptor.
  • Efficacy of peptides is determined relative to cell treatment with lOuM forskolin (a constitutive activator of adenylate cyclase), and potency (EC 50 ) of peptides is determined by the analysis of a concentration-response curve using non-linear regression analysis fitted to a 4-parameter model.
  • the results of the GLP-1 receptor functional activity (cAMP induction) for potency (EC 50 ) are provided in the following Table 5, where values normalized to an exendin-4 standard. The ABD domain did not bind nor activate the GLP-1 receptor. Table 5.
  • Fig. 6A depicts the time course of the change in body weight (% vehicle corrected) after treatment.
  • Fig. 6B depicts the time course of plasma glucose.
  • Example 10 Activity of Cmpds on OGTT DOA (Duration of Action) at 24 hours
  • Exendin-4 (unconjugated) was ineffective in this assay when dosed at t-24 hours, and even at higher doses.
  • Cmpd 14 with proline at position 3 was essentially inactive in the in vitro functional assay and inactive (and perhaps weight promoting) in the glucose lowering OGTT assay (data not shown).
  • Characterization of the binding of engineered polypeptide compounds to albumin can be performed by any number of methods, including that of Biacore described herein.
  • binding measurements were conducted with a BioRad ProteOn XPR36 system (Bio-Rad Laboratories, Hercules CA, USA; ProteOn XPR36 Protein Interaction Array System catalog number #176-0100), using a GLC sensor chip at 25 degrees C.
  • the GLC chip was activated for 5 minutes using a 1 : 1 mixture of sulfo-NHS/EDC diluted 30-fold from the initial stock in water as shown below.
  • Each albumin sample was diluted to 25 ug/ml in 10 mM Na acetate pH 5.0 and injected for 5 minutes over separate sensor surfaces. Each surface was then blocked with 1 M ethanolamine pH 8.5. Each albumin was coupled at a density of 2000-5000 in resonance units.
  • the binding of an engineered polypeptide was tested using 5 nM as the highest concentration in a three-fold dilution series.
  • the running buffer contained 10 mM HEPES pH 7.4, 150 mM NaCl, 3 mM EDTA and 0.005% tween-20. All samples were tested using a 3 -fold dilution series. Each concentration series was tested in duplicate. The dissociation phase for the highest concentration was monitored for 3 hours.
  • the engineered polypeptide Given the picomolar affinity of ABD and the engineered polypeptides to some species of serum albumin, e.g. human serum albumin, the engineered polypeptide is believed to be effectively fully bound to albumin present in the assay (and thus also in vivo in circulating blood). Because of the extremely high affinity of compound binding to albumin (as above) and the presence of high concentration of serum albumin in the blood, it is expected that the compounds will exist essentially in the bound state in vivo yet surprisingly provide sufficient exendin functions (as demonstrated herein).
  • Example 13 Compounds are Stable to Human Plasma and Human Plasma Enzymes
  • each collected sample was extracted by slow addition of 100 ⁇ cold 0.2% formic acid:acetonitrile, while mixing. After addition of the acetonitrile solution, the sample was vortex mixed at high speed for 15 seconds. The extracted samples were stored at -20° C. for at least 20 minutes and then centrifuged at 1 l,000 x g for 10 minutes at 5 degrees C. The supernatant of each sample was transferred to a new microcentrifuge tube, centrifuged again, and finally transferred for LC/MS analysis.
  • enzyme stop solution 50% acetonitrile in water with 0.1% TFA
  • a positive control compound known to cause vacuole formation was scored as 3.
  • ED50's were ⁇ 10 nmol/kg for Cmpd 31 and 2 nmol/kg for [Leu 14] exendin-4.
  • Example 16 Effect of an exendin- albumin binding domain polypeptide in diabetic ob/ob mice
  • Figure l lC depicts lowering of HbAlc (% change from baseline)for Cmpd 15 and Cmpd 21 given twice weekly (BIW), compared to exendin-4 given by continuous subcutaneous infusion (CSI).
  • Figure 1 ID depicts reduction in body weight (% change from baseline) for Cmpd 15 and Cmpd 21 given twice weekly (BIW), compared to exendin-4 given by continuous subcutaneous infusion (CSI).
  • Cmpd 15 and Cmpd 21 were each more effective than liraglutide [N-epsilon-(gamma-Glu(N-alpha-hexadecanoyl))-Lys26,Arg34]- GLP-l-(7-37)-acid, a long-acting albumin binding GLP-1 derivative, in HbAlc lowering and body weight loss (data not shown).
  • Fig. 11C significant HbAlc lowering attends treatment and in Fig. 1 ID significant body weight loss attends treatment, with 25 and 250 nmol/kg of each compound provided intraperitoneally (IP) twice each week for 28 days.
  • IP intraperitoneally
  • Points represent mean ⁇ s.d. (standard deviation).
  • the effects observed for the 25nmol/kg biw (twice weekly) dose was greater than that observed for exendin-4 given at ⁇ 7.2nmol/kg/d by continuous infusion (CSI), a dose known to provide a maximal efficacy for exendin-4.
  • CSI continuous infusion
  • Cmpd 15 was significantly greater and Cmpd 21 was twice as effective, as the maximally efficacious dose of exendin-4.
  • blood glucose measures described herein employed a OneTouch® Ultra® device (LifeScan, Inc. Miliptas, CA).
  • PK pharmacokinetic
  • PD pharmacodynamic
  • Figure 12A depicts effect of Cmpd 15 and Cmpd 21 to reduce food intake.
  • Figure 12B depicts effect of Cmpd 15 and Cmpd 21 to reduce body weight.
  • Figure 12C depicts a PK profile of Cmpd 15 and Cmpd 21 after a single dose. Points represent mean ⁇ sd.
  • Cmpd 15 has an apparent half-life of 54 hours and Cmpd 21 has an apparent half-life of 61 hours, in rats by this subcutaneous delivery.
  • Cmpd 21 has an apparent half-life of 61 hours, in rats by this subcutaneous delivery.
  • the compounds have use for at least twice daily (e.g. morning and night), at least daily, twice weekly, and even once weekly administration, especially in human subjects.
  • the compounds have use for at least twice daily (e.g. morning and night), at least daily, twice weekly, and even once weekly administration, especially in human subjects.
  • Example 18 Oral Delivery of Engineered Polypeptides Achieves Systemic Distribution
  • Oral delivery with intestinal uptake was investigated using a representative engineered compound.
  • Diabetic db/db mice were dosed orally (peroral via gavage) with 240 nmol/kg of the following compounds, an exendin analog [Leul4,Gln28]Exendin-4-(l-32)- fGLP-1 -(33-37) acid and Cmpd 15.
  • the data demonstrate that the engineered peptides are orally bioavailable, even in a formulation PBS/propylene glycol (50:50) absent other specific excipients that might enhance delivery and uptake.
  • Cmpd Compared to the exendin analog, Cmpd
  • Embodiment 1 An engineered polypeptide comprising: an albumin binding domain polypeptide (ABD) sequence and a first peptide hormone domain (HD1) sequence selected from an exendin sequence, an exendin analog sequence, an exendin active fragment sequence or an exendin analog active fragment sequence.
  • ABS1 albumin binding domain polypeptide
  • HD1 first peptide hormone domain
  • Embodiment 2 The engineered polypeptide according to embodiment 1, further comprising a first linker (LI) covalently linking said ABD sequence and said HD1 sequence.
  • Embodiment 3 The engineered polypeptide according to any one of embodiments 1 to 2, wherein said engineered polypeptide comprises said ABD sequence as a C-terminal moiety and said HD1 sequence as an N-terminal moiety.
  • Embodiment 4 The engineered polypeptide according to embodiment 3, having the structure HD1-ABD.
  • Embodiment 5. The engineered polypeptide according to embodiment 3, having the structure HD1-L1-ABD.
  • Embodiment 6 The engineered polypeptide according to any one of the embodiments 1 to 5, wherein said HD1 sequence consists of said exendin sequence or said exendin analog sequence.
  • Embodiment 7 The engineered polypeptide according to embodiment 6, wherein said exendin sequence is exendin-4 sequence.
  • Embodiment 8 The engineered polypeptide according to embodiment 6, wherein said exendin active fragment sequence is the sequence of exendin-4(l-28), exendin- 4(1-29), exendin-4(l-30), exendin-4(l-31) or exendin-4(l-32) (SEQ ID NO:2). [0272] Embodiment 9.
  • sequence of said exendin or exendin analog comprises a sequence selected from the group consisting of (SEQ ID NO:3), (SEQ ID NO:4), (SEQ ID NO:2), (SEQ ID NO: l 11), (SEQ ID NO: 112), (SEQ ID NO: 113), (SEQ ID NO: 114), (SEQ ID NO: 115), (SEQ ID NO: 116), (SEQ ID NO: 117), and (SEQ ID NO: 118).
  • exendin analog sequence has at least 70% identity with exendin-4 sequence or to an exendin analog sequence selected from the group consisting of any one of sequences (SEQ ID NO:3), (SEQ ID NO:4), (SEQ ID NO:2), (SEQ ID NO: 111), (SEQ ID NO: 112), (SEQ ID NO: 113), (SEQ ID NO: 114), (SEQ ID NO: 115), (SEQ ID NO : 116), (SEQ ID NO : 117), and (SEQ ID NO : 118) .
  • Embodiment 11 The engineered polypeptide according to any one of embodiments 1 to 10, wherein said exendin analog sequence comprises from 1 to 5 amino acid modifications relative to exendin-4 sequence , or to an exendin analog with sequence selected from the group consisting of (SEQ ID NO:3), (SEQ ID NO:4), (SEQ ID NO:2), (SEQ ID NO: 111), (SEQ ID NO: 112), (SEQ ID NO: 113), (SEQ ID NO: 114), (SEQ ID NO: l 15), (SEQ ID NO: l 16), (SEQ ID NO: l 17), and (SEQ ID NO: l 18), said modifications independently selected from any one or combination of an insertion, deletion, addition and substitution.
  • Embodiment 12 The engineered polypeptide according to any one of embodiments 1 to 11, wherein said ABD sequence comprises an albumin binding motif (ABM) sequence.
  • ABSM albumin binding motif
  • Embodiment 13 The engineered polypeptide according to any one of embodiments 1 to 11, wherein said ABD sequence comprises an albumin binding motif (ABM) sequence that consists of amino acid sequence: GVSD X5 YK X8 X9 I XI 1 XI 2 A X14 TVEGV X20 AL X23 X24 X25 I (SEQ ID NO: l 19), wherein, X5 is selected from Y and F; X8 is selected from N, R and S; X9 is selected from V, I, L, M, F and Y; XI 1 is selected from N, S, E and D; X12 is selected from R, K and N; X14 is selected from K and R; X20 is selected from D, N, Q, E, H, S, R and K; X23 is selected from K, I and T; X24 is selected from A, S, T, G, H, L and D; and X25 is selected from H, E and D.
  • ABSM
  • Embodiment 14 The engineered polypeptide according to any one of embodiments 1 to 13, wherein said ABD sequence comprises an albumin binding motif (ABM) sequence that does not consist of the amino acid sequence
  • Embodiment 15 The engineered polypeptide according to any one of embodiments 1 to 14, wherein said ABD sequence comprises the amino acid sequence:
  • LAEAK Xa Xb A Xc Xd EL Xe KY (SEQ ID NO: 182) covalently linked to an albumin binding motif (ABM) sequence which is further covalently linked to amino acid sequence LAALP (SEQ ID NO: 183), wherein Xa is selected from V and E; Xb is selected from L, E and D; Xc is selected from N, L and I; Xd is selected from R and K; and Xe is selected from D and K. [0279] Embodiment 16.
  • ABD sequence comprises the amino acid sequence: LAEAK Xa Xb A Xc Xd EL Xe KY GVSD X5 YK X8 X9 I XI 1 X12 A X14 TVEGV X20 AL X23 X24 X25 I LAALP (SEQ ID NO: 121), wherein Xa is selected from V and E; Xb is selected from L, E and D; Xc is selected from N, L and I; Xd is selected from R and K; Xe is selected from D and K; X5 is selected from Y and F; X8 is selected from N, R and S; X9 is selected from V, I, L, M, F and Y; XI 1 is selected from N, S, E and D; X12 is selected from R, K and N; X14 is selected from K and R; X20 is selected from D, N, Q, E, H
  • Embodiment 18 The engineered polypeptide according to any one of
  • Embodiment 19 The engineered polypeptide according to any one of
  • ABD sequence further comprises an N-terminal addition selected from A, AS, G or GS.
  • Embodiment 20 The engineered polypeptide according to embodiment 16, wherein said ABD sequence comprises the amino acid sequence
  • Embodiment 21 The engineered polypeptide according to embodiment 16, wherein said ABD sequence comprises a sequence selected from the group consisting of: (SEQ ID NO: 23), (SEQ ID NO: 24), (SEQ ID NO: 25), (SEQ ID NO: 26), (SEQ ID NO: 27), (SEQ ID NO: 28), (SEQ ID NO: 29), (SEQ ID NO: 30), (SEQ ID NO: 31), (SEQ ID NO: 32), (SEQ ID NO: 33), (SEQ ID NO: 34), (SEQ ID NO: 35), (SEQ ID NO: 122), (SEQ ID NO: 123) and (SEQ ID NO: 124).
  • Embodiment 22 comprises a sequence selected from the group consisting of: (SEQ ID NO: 23), (SEQ ID NO: 24), (SEQ ID NO: 25), (SEQ ID NO: 26), (SEQ ID NO: 27), (SEQ ID NO: 28), (SEQ ID NO: 29), (SEQ ID NO: 30), (SEQ ID NO: 31
  • sequence of said ABD has at least 85% identity with the sequence of an ABD with sequence selected from the group consisting of (SEQ ID NO:23), (SEQ ID NO:24), (SEQ ID NO:25), (SEQ ID NO:26), (SEQ ID NO:27), (SEQ ID NO:28), (SEQ ID NO:29), (SEQ ID NO:30), (SEQ ID NO:31), (SEQ ID NO:32), (SEQ ID NO:33), (SEQ ID NO:34), (SEQ ID NO:35), (SEQ ID NO: 122), (SEQ ID NO: 123) and (SEQ ID NO: 124).
  • Embodiment 23 The engineered polypeptide according to any one of embodiments 16 to 22, wherein in said ABD sequence the C-terminal proline is absent.
  • Embodiment 24 The engineered polypeptide according to any one of embodiments 16 to 23, wherein in said ABD sequence the leucine at position 45 is absent.
  • Embodiment 25 The engineered polypeptide according to any one of embodiments 2 to 24, wherein said linker LI is a peptide linker of from 1 to 30 amino acids.
  • Embodiment 26 The engineered polypeptide according to any one of embodiments 2 to 25, wherein said linker LI is selected from the 20 naturally occurring amino acids.
  • Embodiment 27 The engineered polypeptide according to any one of embodiments 2 to 25, wherein said linker LI comprises a non-natural amino acid incorporated by chemical synthesis, post-translational chemical modification or by in vivo incorporation by recombinant expression in a host cell.
  • Embodiment 28 The engineered polypeptide according to any one of embodiments 2 to 27, wherein said linker LI amino acids are selected from glycine, alanine, proline, asparagine, glutamine, and lysine.
  • Embodiment 29 The engineered polypeptide according to any one of embodiments 2 to 28, wherein said linker LI comprises a majority of amino acids that are sterically unhindered.
  • Embodiment 30 The engineered polypeptide according to any one of embodiments 2 to 29, wherein said linker LI comprises polyglycine, polyalanine, poly(Gly- Ala) or poly(Gly-Ser).
  • linker LI comprises the sequence (Gly)3, (Gly)4 (SEQ ID NO: 196), or (Gly)5 (SEQ ID NO: 197).
  • Embodiment 32 The engineered polypeptide according to any one of embodiments 2 to 29, wherein said linker LI comprises the sequence (Gly)3Lys(Gly)4 (SEQ ID NO: 131); (Gly)3AsnGlySer(Gly)2 (SEQ ID NO: 132); (Gly)3Cys(Gly)4 (SEQ ID NO: 131).
  • Embodiment 33 The engineered polypeptide according to any one of embodiments 2 to 32, wherein said linker LI comprises combinations of Gly and Ala.
  • Embodiment 34 The engineered polypeptide according to any one of embodiments 2 to 32, wherein said linker LI comprises combination of Gly and Ser.
  • Embodiment 35 The engineered polypeptide according to any one of embodiments 2 to 34, wherein said linker LI is selected from the group consisting of a glycine rich peptide.
  • Embodiment 36 The engineered polypeptide according to any one of the embodiments 2 to 35, wherein said linker LI comprises an N-terminal TG dipeptide.
  • Embodiment 37 The engineered polypeptide according to any one of embodiments 2 to 36, wherein said linker LI comprises a C-terminal AS dipeptide.
  • Embodiment 38 The engineered polypeptide according to any one of embodiments 2 to 37, wherein said linker LI comprises an N-terminal TG dipeptide and a C- terminal AS dipeptide.
  • Embodiment 39 The engineered polypeptide according to any one of embodiments 2 to 38, wherein said linker LI comprises a sequence selected from the group consisting of TG-(GGGS)1 (SEQ ID NO: 198), TG-(GGGS)2 (SEQ ID NO: 199), TG
  • Embodiment 40 The engineered polypeptide according to embodiment 39, wherein said linker LI TG dipeptide or AS dipeptide are absent or are replaced by a pair of amino acids selected from T, A, S, and G.
  • Embodiment 41 The engineered polypeptide according to any one of embodiments 1 to 40, which binds to serum albumin with a dissociation constant less than about 10-6 mol/L.
  • Embodiment 42 The engineered polypeptide according to embodiment 41, which binds to serum albumin with a dissociation constant less than about 10-9 mol/L.
  • Embodiment 43 The engineered polypeptide according to embodiment 42, which binds to serum albumin with a dissociation constant less than about 10-12 mol/L.
  • Embodiment 44 The engineered polypeptide according to any one of embodiments 1 to 43, wherein the polypeptide has a duration of action of at least 1 day.
  • Embodiment 45 The engineered polypeptide according to embodiment 44, wherein the polypeptide has a duration of action of at least 3 days.
  • Embodiment 46 The engineered polypeptide according to embodiment 45, wherein the polypeptide has a duration of action of at least 6 days.
  • Embodiment 47 The engineered polypeptide according to any one of embodiments 1 to 46, wherein the polypeptide has a duration of action of at least 6 days in a human subject.
  • Embodiment 48 The engineered polypeptide of any one of embodiments 1 to 47 comprising (SEQ ID NO:40), (SEQ ID NO:41), (SEQ ID NO:42), (SEQ ID NO:43), (SEQ ID NO:51), (SEQ ID NO: 163), (SEQ ID NO:99), (SEQ ID NO: 169), (SEQ ID NO:170), (SEQ ID NO: 95), (SEQ ID NO: 97), (SEQ ID NO: 96), (SEQ ID NO:55), (SEQ ID NO:53), (SEQ ID NO:62), (SEQ ID NO:67), (SEQ ID NO:166), (SEQ ID NO: 167), (SEQ ID NO:51), (SEQ ID NO:52), (SEQ ID NO:53), (SEQ ID NO:40), (SEQ
  • Embodiment 49 The engineered polypeptide of any one of embodiments 1 to 47 comprising (SEQ ID NO:40), (SEQ ID NO:41), (SEQ ID NO:42), (SEQ ID NO:43), (SEQ ID NO:51), (SEQ ID NO: 163), (SEQ ID NO:99), (SEQ ID NO: 169), (SEQ ID NO:170), (SEQ ID NO: 95), (SEQ ID NO: 97), (SEQ ID NO: 96), (SEQ ID NO:55), (SEQ ID NO:53), (SEQ ID NO:62), (SEQ ID NO:67), (SEQ ID NO: 166) or (SEQ ID NO: 167).
  • Embodiment 50 The engineered polypeptide of any one of embodiments 1 to 47 comprising (SEQ ID NO:40), (SEQ ID NO:41), (SEQ ID NO:42), (SEQ ID NO:43), (SEQ ID NO:51), (SEQ ID NO: 163), (SEQ ID NO:99), (SEQ ID NO: 169), (SEQ ID NO:170), (SEQ ID NO: 95), (SEQ ID NO: 97), (SEQ ID NO: 96) or (SEQ ID NO:55).
  • Embodiment 51 A method for treating a disease or disorder in a subject, comprising administering a engineered polypeptide according to any one of embodiments 1- 50 to a subject in need thereof in an amount effective to treat said disease or disorder.
  • Embodiment 52 The method according to embodiment 51 , wherein said disease or disorder is diabetes, overweight, obesity, Alzheimer's disease, short bowel syndrome, fatty liver disease, dyslipidemia, coronary artery disease, stroke, hyperlipidemia or Parkinson's disease.
  • said disease or disorder is diabetes, overweight, obesity, Alzheimer's disease, short bowel syndrome, fatty liver disease, dyslipidemia, coronary artery disease, stroke, hyperlipidemia or Parkinson's disease.
  • Embodiment 53 The method according to embodiment 52, wherein said disease or disorder is diabetes, overweight, obesity, short bowel syndrome or Parkinson's disease.
  • Embodiment 54 The method according to embodiment 53, wherein said disease or disorder is type I diabetes, type II diabetes or prediabetes.
  • Embodiment 55 The method according to embodiment 52, wherein said disease or disorder is type II diabetes.
  • Embodiment 56 The method according to embodiment 52, wherein said disease or disorder is dyslipidemia or hyperlipidemia.
  • Embodiment 57 The method according to embodiment 52, wherein the subject in need of such treatment is obese.
  • Embodiment 58 A pharmaceutical composition comprising an engineered polypeptide according to any one of embodiments 1-50 and a pharmaceutically acceptable excipient.
  • Embodiment 59 The pharmaceutical composition according to embodiment 58, wherein said pharmaceutical composition is an oral pharmaceutical composition.
  • Embodiment 60 The pharmaceutical composition according to any one of embodiments 58 to 59, wherein said pharmaceutical composition is a sustained release or long lasting pharmaceutical composition.
  • Embodiment 61 The pharmaceutical composition according to any one of embodiments 58 to 60, wherein said pharmaceutical composition is a once daily
  • Embodiment 62 The pharmaceutical composition according to any one of embodiment 58 to 60, wherein said pharmaceutical composition is a twice daily
  • Embodiment 63 The pharmaceutical composition according to any one of embodiments 58 to 60, wherein said pharmaceutical composition is a once weekly pharmaceutical composition.
  • Embodiment 64 The pharmaceutical composition according to any one of embodiments 58 to 63 for treating a disease or disorder in a subject.
  • Embodiment 65 The pharmaceutical composition of embodiment 64 wherein the disease or disorder is diabetes, overweight, obesity, Alzheimer's disease, fatty liver disease, short bowel syndrome, dyslipidemia, coronary artery disease, stroke, hyperlipidemia or Parkinson's disease.
  • Embodiment 66 The pharmaceutical composition of embodiment 65 wherein said disease or disorder is diabetes, overweight, obesity, short bowel syndrome, or
  • Embodiment 67 The pharmaceutical composition of embodiment 66, wherein said disease or disorder is type I diabetes, type II diabetes or prediabetes.
  • Embodiment 68 The engineered polypeptide or pharmaceutical composition of any one of embodiments 1 to 67, wherein the engineered polypeptide or pharmaceutical composition provides once weekly administration.
  • Embodiment 69 The engineered polypeptide or pharmaceutical composition of any one of embodiments 1 to 67, wherein the engineered polypeptide or pharmaceutical composition provides once daily administration.
  • Embodiment 70 The engineered polypeptide or pharmaceutical composition of any one of embodiments 1 to 67, wherein the engineered polypeptide or pharmaceutical composition provides twice daily administration.
  • Embodiment 71 The pharmaceutical composition of any one of embodiments 58 to 70, wherein the engineered polypeptide comprises (SEQ ID NO:40), (SEQ ID NO:41), (SEQ ID NO:42), (SEQ ID NO:43), (SEQ ID NO:51), (SEQ ID NO: 163), (SEQ ID NO:99), (SEQ ID NO: 169), (SEQ ID NO: 170), (SEQ ID NO: 95), (SEQ ID NO: 97), (SEQ ID NO: 96), (SEQ ID NO:55), (SEQ ID NO:53), (SEQ ID NO:62), (SEQ ID NO:67), (SEQ ID NO: 166), (SEQ ID NO: 167), (SEQ ID NO:51), (SEQ ID NO:52), (SEQ ID NO:53),
  • Embodiment 72 The pharmaceutical composition of any one of embodiments 58 to 71, wherein the engineered polypeptide comprises (SEQ ID NO:40), (SEQ ID NO:41), (SEQ ID NO:42), (SEQ ID NO:43), (SEQ ID NO:51), (SEQ ID NO: 163), (SEQ ID NO:99), (SEQ ID NO: 169), (SEQ ID NO: 170), (SEQ ID NO: 95), (SEQ ID NO: 97), (SEQ ID NO: 96), (SEQ ID NO:55), (SEQ ID NO:53), (SEQ ID NO:62), (SEQ ID NO:67), (SEQ ID NO : 166) or (SEQ ID NO : 167) .
  • the engineered polypeptide comprises (SEQ ID NO:40), (SEQ ID NO:41), (SEQ ID NO:42), (SEQ ID NO:43), (SEQ ID NO:51), (SEQ ID NO: 163), (SEQ ID NO:99), (SEQ ID NO
  • Embodiment 73 The pharmaceutical composition of any one of embodiments 58 to 71, wherein the engineered polypeptide comprises (SEQ ID NO:40), (SEQ ID NO:41), (SEQ ID NO:42), (SEQ ID NO:43), (SEQ ID NO:51), (SEQ ID NO: 163), (SEQ ID NO:99), (SEQ ID NO: 169), (SEQ ID NO: 170), (SEQ ID NO: 95), (SEQ ID NO: 97), (SEQ ID NO: 96) or (SEQ ID NO:55).
  • Embodiment 74 The pharmaceutical composition of any one of claims 58 to 67 wherein the engineered polypeptide comprises the sequence of (SEQ ID NO:95).

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Molecular Biology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Endocrinology (AREA)
  • Zoology (AREA)
  • Toxicology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Diabetes (AREA)
  • Vascular Medicine (AREA)
  • Neurology (AREA)
  • Neurosurgery (AREA)
  • Biomedical Technology (AREA)
  • Obesity (AREA)
  • Hematology (AREA)
  • Epidemiology (AREA)
  • Cardiology (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Child & Adolescent Psychology (AREA)
  • Urology & Nephrology (AREA)
  • Psychology (AREA)
  • Emergency Medicine (AREA)
  • Hospice & Palliative Care (AREA)
  • Psychiatry (AREA)
PCT/US2011/053770 2010-09-28 2011-09-28 Engineered polypeptides having enhanced duration of action Ceased WO2012050923A2 (en)

Priority Applications (11)

Application Number Priority Date Filing Date Title
JP2013531784A JP6121330B2 (ja) 2010-09-28 2011-09-28 作用持続時間が増した改変ポリペプチド
EA201390450A EA201390450A1 (ru) 2010-09-28 2011-09-28 Полипептиды с увеличенной продолжительностью действия
ES11767876.3T ES2563091T3 (es) 2010-09-28 2011-09-28 Polipéptidos modificados genéticamente que tienen duración de acción potenciada
CN201180057092.1A CN103370083B (zh) 2010-09-28 2011-09-28 具有增强的作用持续时间的工程化多肽
BR112013007442A BR112013007442A2 (pt) 2010-09-28 2011-09-28 polipeptídeos construídos tendo duração de ação realçada
EP11767876.3A EP2621538B1 (en) 2010-09-28 2011-09-28 Engineered polypeptides having enhanced duration of action
HK14101093.8A HK1188710B (en) 2010-09-28 2011-09-28 Engineered polypeptides having enhanced duration of action
MX2013003481A MX345245B (es) 2010-09-28 2011-09-28 Polipeptidos manipulados que tienen duracion de accion incrementada.
CA2812951A CA2812951A1 (en) 2010-09-28 2011-09-28 Engineered polypeptides having enhanced duration of action
US13/852,899 US9593154B2 (en) 2010-09-28 2013-03-28 Engineered polypeptides having enhanced duration of action
US15/398,627 US20170114114A1 (en) 2010-09-28 2017-01-04 Engineered polypeptides having enhanced duration of action

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US38739110P 2010-09-28 2010-09-28
US61/387,391 2010-09-28
US42208510P 2010-12-10 2010-12-10
US61/422,085 2010-12-10

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US13/852,899 Continuation US9593154B2 (en) 2010-09-28 2013-03-28 Engineered polypeptides having enhanced duration of action

Publications (2)

Publication Number Publication Date
WO2012050923A2 true WO2012050923A2 (en) 2012-04-19
WO2012050923A3 WO2012050923A3 (en) 2012-07-19

Family

ID=44786115

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2011/053770 Ceased WO2012050923A2 (en) 2010-09-28 2011-09-28 Engineered polypeptides having enhanced duration of action

Country Status (11)

Country Link
US (2) US9593154B2 (https=)
EP (2) EP3028720A1 (https=)
JP (1) JP6121330B2 (https=)
CN (2) CN106986940A (https=)
BR (1) BR112013007442A2 (https=)
CA (1) CA2812951A1 (https=)
EA (1) EA201390450A1 (https=)
ES (1) ES2563091T3 (https=)
HK (1) HK1225307A1 (https=)
MX (1) MX345245B (https=)
WO (1) WO2012050923A2 (https=)

Cited By (27)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2830665A1 (en) * 2012-03-28 2015-02-04 Affibody AB Oral administration
US20150133373A1 (en) * 2012-03-28 2015-05-14 Amylin Pharmaceuticals, Llc Transmucosal delivery of engineered polypeptides
WO2016064817A1 (en) 2014-10-22 2016-04-28 Armo Biosciences, Inc. Methods of using interleukin-10 for treating diseases and disorders
US9593154B2 (en) 2010-09-28 2017-03-14 Astrazeneca Pharmaceuticals Lp Engineered polypeptides having enhanced duration of action
US9670261B2 (en) 2012-12-21 2017-06-06 Sanofi Functionalized exendin-4 derivatives
US9694053B2 (en) 2013-12-13 2017-07-04 Sanofi Dual GLP-1/glucagon receptor agonists
US9751926B2 (en) 2013-12-13 2017-09-05 Sanofi Dual GLP-1/GIP receptor agonists
US9750788B2 (en) 2013-12-13 2017-09-05 Sanofi Non-acylated exendin-4 peptide analogues
US9758561B2 (en) 2014-04-07 2017-09-12 Sanofi Dual GLP-1/glucagon receptor agonists derived from exendin-4
WO2017153575A1 (en) * 2016-03-10 2017-09-14 Medimmune Limited Glucagon and glp-1 co-agonists for the treatment of obesity
US9771406B2 (en) 2014-04-07 2017-09-26 Sanofi Peptidic dual GLP-1/glucagon receptor agonists derived from exendin-4
US9775904B2 (en) 2014-04-07 2017-10-03 Sanofi Exendin-4 derivatives as peptidic dual GLP-1/glucagon receptor agonists
US9789165B2 (en) 2013-12-13 2017-10-17 Sanofi Exendin-4 peptide analogues as dual GLP-1/GIP receptor agonists
US9823255B2 (en) 2013-06-17 2017-11-21 Armo Biosciences, Inc. Method for assessing protein identity and stability
US9932381B2 (en) 2014-06-18 2018-04-03 Sanofi Exendin-4 derivatives as selective glucagon receptor agonists
US9943568B2 (en) 2013-04-18 2018-04-17 Armo Biosciences, Inc. Methods of using pegylated interleukin-10 for treating cancer
US9982029B2 (en) 2015-07-10 2018-05-29 Sanofi Exendin-4 derivatives as selective peptidic dual GLP-1/glucagon receptor agonists
US10010588B2 (en) 2013-08-30 2018-07-03 Armo Biosciences, Inc. Methods of using pegylated interleukin-10 for treating hyperlipidemia
US10195274B2 (en) 2015-05-28 2019-02-05 Armo Biosciences Inc. Method of modulating a chimeric antigen receptor t cell immune response by administering IL-10
US10293043B2 (en) 2014-06-02 2019-05-21 Armo Biosciences, Inc. Methods of lowering serum cholesterol
US10350270B2 (en) 2014-10-14 2019-07-16 Armo Biosciences, Inc. Interleukin-15 compositions and uses thereof
US10398761B2 (en) 2015-08-25 2019-09-03 Armo Biosciences, Inc. Methods of using combinations of PEG-IL-10 and IL-15 for treating cancers
US10618970B2 (en) 2015-02-03 2020-04-14 Armo Biosciences, Inc. Method of treating cancer with IL-10 and antibodies that induce ADCC
US10758592B2 (en) 2012-10-09 2020-09-01 Sanofi Exendin-4 derivatives as dual GLP1/glucagon agonists
US10806797B2 (en) 2015-06-05 2020-10-20 Sanofi Prodrugs comprising an GLP-1/glucagon dual agonist linker hyaluronic acid conjugate
US11413332B2 (en) 2013-11-11 2022-08-16 Armo Biosciences, Inc. Methods of using interleukin-10 for treating diseases and disorders
EP3374504B1 (en) * 2015-11-09 2025-03-19 CureVac SE Optimized nucleic acid molecules

Families Citing this family (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
PT2621515T (pt) 2010-09-28 2017-07-12 Aegerion Pharmaceuticals Inc Polipéptido quimérico de leptina de foca-ser humano com solubilidade aumentada
CN103957926B (zh) 2011-07-08 2018-07-03 安米林药品有限责任公司 具有增强的作用持续时间和降低的免疫原性的工程改造的多肽
CA2998528A1 (en) 2015-09-22 2017-03-30 The Regents Of The University Of California Modified cytotoxins and their therapeutic use
US10286079B2 (en) 2015-09-22 2019-05-14 The Regents Of The University Of California Modified cytotoxins and their therapeutic use
CN108697768B (zh) 2015-12-23 2022-07-22 约翰霍普金斯大学 长效glp-1r激动剂作为神经系统病状和神经退行性病状的治疗方法
KR20200135618A (ko) * 2019-05-23 2020-12-03 ㈜ 디앤디파마텍 폴리펩티드를 포함하는 비알코올성 지방간 질환의 예방 또는 치료용 약학 조성물
JP7505713B2 (ja) 2019-02-22 2024-06-25 ロヨラ メリーマウント ユニバーシティ アミロイドペプチドバリアント
US20230250147A1 (en) * 2020-07-02 2023-08-10 Sanofi Glp-1r agonistic peptides with reduced activity
CN115925951B (zh) * 2022-11-30 2024-05-24 上海交通大学医学院附属仁济医院 Cd70特异性诊疗一体化分子影像探针的制备方法及应用

Citations (34)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1983004053A1 (en) 1982-05-06 1983-11-24 Applied Molecular Genetics, Inc. The manufacture and expression of large structural genes
US5424286A (en) 1993-05-24 1995-06-13 Eng; John Exendin-3 and exendin-4 polypeptides, and pharmaceutical compositions comprising same
US5527684A (en) 1991-01-28 1996-06-18 Cis Bio International Method of measuring the luminescence emitted in a luminescent assay
US5686411A (en) 1991-03-08 1997-11-11 Amylin Pharmaceuticals, Inc. Amylin agonist peptides and uses therefor
US5766627A (en) 1993-11-16 1998-06-16 Depotech Multivescular liposomes with controlled release of encapsulated biologically active substances
WO1999007404A1 (en) 1997-08-08 1999-02-18 Amylin Pharmaceuticals, Inc. Novel exendin agonist compounds
WO1999025727A2 (en) 1997-11-14 1999-05-27 Amylin Pharmaceuticals, Inc. Novel exendin agonist compounds
WO1999025728A1 (en) 1997-11-14 1999-05-27 Amylin Pharmaceuticals, Inc. Novel exendin agonist compounds
WO1999040788A1 (en) 1998-02-13 1999-08-19 Amylin Pharmaceuticals, Inc. Inotropic and diuretic effects of exendin and glp-1
WO2000041548A2 (en) 1999-01-14 2000-07-20 Amylin Pharmaceuticals, Inc. Methods for glucagon suppression
WO2000041546A2 (en) 1999-01-14 2000-07-20 Amylin Pharmaceuticals, Inc. Novel exendin agonist formulations and methods of administration thereof
US6296842B1 (en) 2000-08-10 2001-10-02 Alkermes Controlled Therapeutics, Inc. Process for the preparation of polymer-based sustained release compositions
US6319685B1 (en) 1984-09-27 2001-11-20 Unigene Laboratories, Inc. Alpha-amidating enzyme compositions and processes for their production and use
US6326468B1 (en) 1997-06-13 2001-12-04 Gryphon Sciences Solid phase native chemical ligation of unprotected or n-terminal cysteine protected peptides in aqueous solution
US6368630B1 (en) 1992-03-12 2002-04-09 Alkermes Controlled Therapeutics, Inc. Modulated release from biocompatible polymers
US6379703B1 (en) 1998-12-30 2002-04-30 Alkermes Controlled Therapeutics Inc., Ii Preparation of microparticles having a selected release profile
US6379704B2 (en) 2000-05-19 2002-04-30 Alkermes Controlled Therapeutics Inc. Ii Method for preparing microparticles having a selected polymer molecular weight
US6528486B1 (en) 1999-07-12 2003-03-04 Zealand Pharma A/S Peptide agonists of GLP-1 activity
WO2004035623A2 (en) 2002-10-02 2004-04-29 Zealand Pharma A/S Stabilized exendin-4 compounds
US6858576B1 (en) 1996-08-08 2005-02-22 Amylin Pharmaceuticals, Inc. Methods for regulating gastrointestinal motility
US6956026B2 (en) 1997-01-07 2005-10-18 Amylin Pharmaceuticals, Inc. Use of exendins for the reduction of food intake
WO2006083254A1 (en) 2004-02-11 2006-08-10 Amylin Pharmaceuticals, Inc. Amylin family peptides and methods for making and using them
US7223725B1 (en) 1997-11-14 2007-05-29 Amylin Pharmaceuticals, Inc. Exendin agonist compounds
US20070238669A1 (en) 2006-01-11 2007-10-11 Bristol-Myers Squibb Company Human glucagon-like-peptide-1 modulators and their use in the treatment of diabetes related conditions
WO2007114838A1 (en) 2006-03-31 2007-10-11 Amylin Pharmaceuticals, Inc. Amylin and amylin agonists for treating psychiatric diseases and disorders
WO2007140284A2 (en) 2006-05-26 2007-12-06 Bristol-Myers Squibb Company N-terminally modified glp-1 receptor modulators
WO2007139941A2 (en) 2006-05-26 2007-12-06 Amylin Pharmaceuticals, Inc. Composition and methods for treatment of congestive heart failure
WO2008082274A1 (en) 2007-01-05 2008-07-10 Hanmi Pharmaceutical Co., Ltd. An insulinotropic complex using an immunoglobulin fragment
US20080176804A1 (en) 2004-03-04 2008-07-24 Amylin Pharmaceuticals, Inc. Methods for Affecting Body Composition
US20080207512A1 (en) 2004-11-01 2008-08-28 Amylin Pharmaceuticals, Inc. Methods for Treating Obesity and Obesity Related and Disorders
WO2009011544A2 (en) 2007-07-16 2009-01-22 Hanmi Pharmaceutical Co., Ltd. Insulinotropic peptide derivative wherein its n-terminal amino acid is modified
WO2009016043A2 (en) 2007-07-31 2009-02-05 Affibody Ab New albumin binding compositions, methods and uses
WO2010120476A2 (en) 2009-04-01 2010-10-21 Amylin Pharmaceuticals, Inc. N-terminus conformationally constrained glp-1 receptor agonist compounds
US20110097751A1 (en) 2008-05-23 2011-04-28 Amylin Pharmaceuticals, Inc. Glp-1 receptor agonist bioassays

Family Cites Families (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
SE509359C2 (sv) 1989-08-01 1999-01-18 Cemu Bioteknik Ab Användning av stabiliserade protein- eller peptidkonjugat för framställning av ett läkemedel
US6514500B1 (en) * 1999-10-15 2003-02-04 Conjuchem, Inc. Long lasting synthetic glucagon like peptide {GLP-!}
EP1240337B1 (en) 1999-12-24 2006-08-23 Genentech, Inc. Methods and compositions for prolonging elimination half-times of bioactive compounds
CN102977191B (zh) * 2005-11-28 2016-08-10 宾夕法尼亚州大学理事会 有效的c3补体抑制素类似物
EP2046820B1 (en) * 2006-08-01 2010-10-20 Pieris AG Muteins of tear lipocalin and methods for obtaining the same
JP2009003340A (ja) 2007-06-25 2009-01-08 Oki Data Corp 画像形成装置
SG189682A1 (en) * 2008-03-31 2013-05-31 Glaxo Group Ltd Drug fusions and conjugates
WO2010054699A1 (en) * 2008-11-17 2010-05-20 Affibody Ab Conjugates of albumin binding domain
EP2398825B1 (en) * 2009-02-19 2017-10-25 Glaxo Group Limited Single variable domain against serum albumin
CA2812951A1 (en) 2010-09-28 2012-04-19 Amylin Pharmaceuticals, Llc Engineered polypeptides having enhanced duration of action
HK1208155A1 (en) * 2012-03-28 2016-02-26 Amylin Pharmaceuticals, Llc Transmucosal delivery of engineered polypeptides

Patent Citations (36)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1983004053A1 (en) 1982-05-06 1983-11-24 Applied Molecular Genetics, Inc. The manufacture and expression of large structural genes
US6319685B1 (en) 1984-09-27 2001-11-20 Unigene Laboratories, Inc. Alpha-amidating enzyme compositions and processes for their production and use
US5527684A (en) 1991-01-28 1996-06-18 Cis Bio International Method of measuring the luminescence emitted in a luminescent assay
US5686411A (en) 1991-03-08 1997-11-11 Amylin Pharmaceuticals, Inc. Amylin agonist peptides and uses therefor
US6368630B1 (en) 1992-03-12 2002-04-09 Alkermes Controlled Therapeutics, Inc. Modulated release from biocompatible polymers
US5424286A (en) 1993-05-24 1995-06-13 Eng; John Exendin-3 and exendin-4 polypeptides, and pharmaceutical compositions comprising same
US5766627A (en) 1993-11-16 1998-06-16 Depotech Multivescular liposomes with controlled release of encapsulated biologically active substances
US6858576B1 (en) 1996-08-08 2005-02-22 Amylin Pharmaceuticals, Inc. Methods for regulating gastrointestinal motility
US6956026B2 (en) 1997-01-07 2005-10-18 Amylin Pharmaceuticals, Inc. Use of exendins for the reduction of food intake
US6326468B1 (en) 1997-06-13 2001-12-04 Gryphon Sciences Solid phase native chemical ligation of unprotected or n-terminal cysteine protected peptides in aqueous solution
WO1999007404A1 (en) 1997-08-08 1999-02-18 Amylin Pharmaceuticals, Inc. Novel exendin agonist compounds
US7223725B1 (en) 1997-11-14 2007-05-29 Amylin Pharmaceuticals, Inc. Exendin agonist compounds
WO1999025728A1 (en) 1997-11-14 1999-05-27 Amylin Pharmaceuticals, Inc. Novel exendin agonist compounds
WO1999025727A2 (en) 1997-11-14 1999-05-27 Amylin Pharmaceuticals, Inc. Novel exendin agonist compounds
WO1999040788A1 (en) 1998-02-13 1999-08-19 Amylin Pharmaceuticals, Inc. Inotropic and diuretic effects of exendin and glp-1
US6379703B1 (en) 1998-12-30 2002-04-30 Alkermes Controlled Therapeutics Inc., Ii Preparation of microparticles having a selected release profile
WO2000041546A2 (en) 1999-01-14 2000-07-20 Amylin Pharmaceuticals, Inc. Novel exendin agonist formulations and methods of administration thereof
US6872700B1 (en) 1999-01-14 2005-03-29 Amylin Pharmaceuticals, Inc. Methods for glucagon suppression
WO2000041548A2 (en) 1999-01-14 2000-07-20 Amylin Pharmaceuticals, Inc. Methods for glucagon suppression
US6528486B1 (en) 1999-07-12 2003-03-04 Zealand Pharma A/S Peptide agonists of GLP-1 activity
US6379704B2 (en) 2000-05-19 2002-04-30 Alkermes Controlled Therapeutics Inc. Ii Method for preparing microparticles having a selected polymer molecular weight
US6296842B1 (en) 2000-08-10 2001-10-02 Alkermes Controlled Therapeutics, Inc. Process for the preparation of polymer-based sustained release compositions
WO2004035623A2 (en) 2002-10-02 2004-04-29 Zealand Pharma A/S Stabilized exendin-4 compounds
WO2006083254A1 (en) 2004-02-11 2006-08-10 Amylin Pharmaceuticals, Inc. Amylin family peptides and methods for making and using them
US20080274952A1 (en) 2004-02-11 2008-11-06 Amylin Pharmaceuticals, Inc. Amylin Family Peptides And Methods For Making And Using Them
US20080176804A1 (en) 2004-03-04 2008-07-24 Amylin Pharmaceuticals, Inc. Methods for Affecting Body Composition
US20080207512A1 (en) 2004-11-01 2008-08-28 Amylin Pharmaceuticals, Inc. Methods for Treating Obesity and Obesity Related and Disorders
US20070238669A1 (en) 2006-01-11 2007-10-11 Bristol-Myers Squibb Company Human glucagon-like-peptide-1 modulators and their use in the treatment of diabetes related conditions
WO2007114838A1 (en) 2006-03-31 2007-10-11 Amylin Pharmaceuticals, Inc. Amylin and amylin agonists for treating psychiatric diseases and disorders
WO2007140284A2 (en) 2006-05-26 2007-12-06 Bristol-Myers Squibb Company N-terminally modified glp-1 receptor modulators
WO2007139941A2 (en) 2006-05-26 2007-12-06 Amylin Pharmaceuticals, Inc. Composition and methods for treatment of congestive heart failure
WO2008082274A1 (en) 2007-01-05 2008-07-10 Hanmi Pharmaceutical Co., Ltd. An insulinotropic complex using an immunoglobulin fragment
WO2009011544A2 (en) 2007-07-16 2009-01-22 Hanmi Pharmaceutical Co., Ltd. Insulinotropic peptide derivative wherein its n-terminal amino acid is modified
WO2009016043A2 (en) 2007-07-31 2009-02-05 Affibody Ab New albumin binding compositions, methods and uses
US20110097751A1 (en) 2008-05-23 2011-04-28 Amylin Pharmaceuticals, Inc. Glp-1 receptor agonist bioassays
WO2010120476A2 (en) 2009-04-01 2010-10-21 Amylin Pharmaceuticals, Inc. N-terminus conformationally constrained glp-1 receptor agonist compounds

Non-Patent Citations (52)

* Cited by examiner, † Cited by third party
Title
"APPLIED BIOSYSTEMS USER'S MANUAL FOR THE ABI 430A PEPTIDE SYNTHESIZER", 1 July 1988, APPLIED BIOSYSTEMS, INC., pages: 49 - 70
"Coronary Therapeutics 2002", 20 September 2002, OAK BROOK, article "Diabetic Coronary Artery Disease & Intervention"
"Introduction to Cleavage Techniques", 1990, APPLIED BIOSYSTEMS, INC., pages: 6 - 12
ACUTE CORONARY SYNDROME SUMMIT: A STATE OF THE ART APPROACH, 21 September 2002 (2002-09-21)
ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410
ALTSCHUL ET AL., NUCI. ACIDS RES., vol. 25, 1977, pages 3389 - 3402
AUSUBEL ET AL.,: "Current Protocols in Molecular Biology", 1995
AVIS ET AL.: "Pharmaceutical Dosage Forms: Parenteral Medications, 2nd ed.", vol. 1, 1992, MERCEL DEKKER
BARTLETT ET AL., BIORG. CHEM., vol. 14, 1986, pages 356 - 377
BARTLETT, LANDEN, BIOORG. CHEM., vol. 14, 1986, pages 356 - 77
BETTER ET AL., SCIENCE, vol. 240, 1988, pages 1041 - 1043
BITTER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 81, 1984, pages 5330 - 5334
CHAO ET AL., J. DRUG TARGETING, vol. 6, 1998, pages 37 - 43
CHENG ET AL., NAT PROT, vol. 1, 2006, pages 2
COHEN ET AL., THE PICO TAG METHOD: A MANUAL OF ADVANCED TECHNIQUES FOR AMINO ACID ANALYSIS, 1989, pages 11 - 52
COOPER ET AL., BIOCHEM. BIOPHYS. ACTA, vol. 1014, 1989, pages 247 - 258
DAVIES, MORRIS, PHARNI. RES. (N.Y., vol. 10, 1993, pages 1093 - 1095
DUGAICZYK L ET AL., PROC. NATL. ACAD. SCI. USA, vol. 79, 1982, pages 71
E. W. MARTIN, REMINGTON'S PHARMACEUTICAL SCIENCES
ENG ET AL., J. BIOL. CHEM., vol. 265, 1990, pages 20259 - 62
ENG ET AL., J. BIOL. CHEM., vol. 267, 1992, pages 7402 - 7405
ENGELHARD ET AL., PROC. NATL. ACAD. SCI. USA, vol. 91, 1994, pages 3224 - 3227
FINGL ET AL.: "THE PHARMACOLOGICAL BASIS OF THERAPEUTICS", 1975, pages: 1
GLENN ET AL., J. BIOL. CHEM., vol. 283, no. 19, 2008, pages 12717 - 29
GOKE ET AL., J. BIOL. CHEM., vol. 268, 1993, pages 19650 - 55
HARGROVE ET AL., REGULATORY PEPTIDES, vol. 141, 2007, pages 113 - 119
HE, XM, CARTER, DC, NATURE, vol. 358, 1992, pages 209
HENIKOFF, HENIKOFF, PROC. NATL. ACAD. SCI. USA, vol. 89, 1989, pages 10915
HOLZ ET AL., J. BIOL. CHEM., vol. 270, no. 30, 1995, pages 17749 - 57
J BIOL. CHEM., vol. 272, 1997, pages 4108 - 15
JONSSON ET AL., PROTEIN ENG. DESIGN & SELECTION, vol. 21, 2008, pages 515 - 527
KOPELMAN, NATURE, vol. 404, 2000, pages 635 - 43
KUNKEL ET AL., NEUROGASTROENTEROL. MOTIL., 2011
KURJAN, HERSKOWITZ, CELL, vol. 30, 1982, pages 933 - 43
LEVIN ET AL., AM. J. PHYSIOL., vol. 273, 1997, pages R725 - R730
LEVIN, AM. J. PHYSIOL., vol. 267, 1994, pages R527 - R535
MCCURDY TR, J LAB. CLIN. MED., vol. 143, 2004, pages 115
MORLEY, FLOOD ET AL., AM. J. PHYSIOL., vol. 267, 1994, pages R178 - R184
NCCDLCMAN, WUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 443
NICHOLSON JP ET AL., BR J ANAESTH, vol. 85, 2000, pages 599
PEARSON, LIPMAN, PROC. NAT'L. ACAD. SCI. USA, vol. 85, 1988, pages 2444
PERRY ET AL., CIIRR. DRUG TARGETS, vol. 5, no. 6, 2004, pages 565 - 571
PETERS T, ADVANCES IN PROTEIN CHEMISTRY, vol. 37, 1985, pages 161
PRICE ET AL., GENE, vol. 55, 1987, pages 287
RISSANEN ET AL., BR. MED. J., vol. 301, 1990, pages 835 - 7
ROSE, BROACH: "Meth. Enz.", vol. 185, 1990, ACADEMIC PRESS, INC., pages: 234 - 79
SAMBROOK ET AL.: "MOLECULAR CLONING: A LABORATORY MANUAL, 2d Ed.,", 1989, COLD SPRING HARBOR
SHEFFIELD WP, CURR. DRUG TARGETS CARDIOVACS. HAEMATOL. DISORD., vol. 1, 2001, pages 1
SMITH ET AL., J VIROL., vol. 46, 1983, pages 584
SMITH, WATERMAN, ADV. APPL. MATH., vol. 2, 1981, pages 482
STEAMS ET AL., METH. ENZ., vol. 185, 1990, pages 280 - 297
WANG ET AL., J. OFPARENTERAL SCI. AND TECH., vol. 42, 1988, pages 2 S

Cited By (37)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9593154B2 (en) 2010-09-28 2017-03-14 Astrazeneca Pharmaceuticals Lp Engineered polypeptides having enhanced duration of action
US20150133373A1 (en) * 2012-03-28 2015-05-14 Amylin Pharmaceuticals, Llc Transmucosal delivery of engineered polypeptides
EP2844269A4 (en) * 2012-03-28 2016-01-06 Amylin Pharmaceuticals Llc TRANSMUCOSAL ADMINISTRATION OF MANIPULATED POLYPEPTIDES
EP2830665A1 (en) * 2012-03-28 2015-02-04 Affibody AB Oral administration
US10758592B2 (en) 2012-10-09 2020-09-01 Sanofi Exendin-4 derivatives as dual GLP1/glucagon agonists
US9670261B2 (en) 2012-12-21 2017-06-06 Sanofi Functionalized exendin-4 derivatives
US9745360B2 (en) 2012-12-21 2017-08-29 Sanofi Dual GLP1/GIP or trigonal GLP1/GIP/glucagon agonists
US10253079B2 (en) 2012-12-21 2019-04-09 Sanofi Functionalized Exendin-4 derivatives
US10357545B2 (en) 2013-04-18 2019-07-23 Armo Biosciences, Inc. Methods of using interleukin-10 for treating solid tumors
US9943568B2 (en) 2013-04-18 2018-04-17 Armo Biosciences, Inc. Methods of using pegylated interleukin-10 for treating cancer
US9823255B2 (en) 2013-06-17 2017-11-21 Armo Biosciences, Inc. Method for assessing protein identity and stability
US10209261B2 (en) 2013-06-17 2019-02-19 Armo Biosciences Inc. Method for assessing protein identity and stability
US10010588B2 (en) 2013-08-30 2018-07-03 Armo Biosciences, Inc. Methods of using pegylated interleukin-10 for treating hyperlipidemia
US11413332B2 (en) 2013-11-11 2022-08-16 Armo Biosciences, Inc. Methods of using interleukin-10 for treating diseases and disorders
US9750788B2 (en) 2013-12-13 2017-09-05 Sanofi Non-acylated exendin-4 peptide analogues
US9694053B2 (en) 2013-12-13 2017-07-04 Sanofi Dual GLP-1/glucagon receptor agonists
US9751926B2 (en) 2013-12-13 2017-09-05 Sanofi Dual GLP-1/GIP receptor agonists
US9789165B2 (en) 2013-12-13 2017-10-17 Sanofi Exendin-4 peptide analogues as dual GLP-1/GIP receptor agonists
US9771406B2 (en) 2014-04-07 2017-09-26 Sanofi Peptidic dual GLP-1/glucagon receptor agonists derived from exendin-4
US9775904B2 (en) 2014-04-07 2017-10-03 Sanofi Exendin-4 derivatives as peptidic dual GLP-1/glucagon receptor agonists
US9758561B2 (en) 2014-04-07 2017-09-12 Sanofi Dual GLP-1/glucagon receptor agonists derived from exendin-4
US10293043B2 (en) 2014-06-02 2019-05-21 Armo Biosciences, Inc. Methods of lowering serum cholesterol
US9932381B2 (en) 2014-06-18 2018-04-03 Sanofi Exendin-4 derivatives as selective glucagon receptor agonists
US10350270B2 (en) 2014-10-14 2019-07-16 Armo Biosciences, Inc. Interleukin-15 compositions and uses thereof
US10143726B2 (en) 2014-10-22 2018-12-04 Armo Biosciences, Inc. Methods of using interleukin-10 for treating diseases and disorders
US10653751B2 (en) 2014-10-22 2020-05-19 Armo Biosciences Inc. Methods of treating cancer metastasis by using interleukin-10
WO2016064817A1 (en) 2014-10-22 2016-04-28 Armo Biosciences, Inc. Methods of using interleukin-10 for treating diseases and disorders
US10618970B2 (en) 2015-02-03 2020-04-14 Armo Biosciences, Inc. Method of treating cancer with IL-10 and antibodies that induce ADCC
US10195274B2 (en) 2015-05-28 2019-02-05 Armo Biosciences Inc. Method of modulating a chimeric antigen receptor t cell immune response by administering IL-10
US10806797B2 (en) 2015-06-05 2020-10-20 Sanofi Prodrugs comprising an GLP-1/glucagon dual agonist linker hyaluronic acid conjugate
US9982029B2 (en) 2015-07-10 2018-05-29 Sanofi Exendin-4 derivatives as selective peptidic dual GLP-1/glucagon receptor agonists
US10398761B2 (en) 2015-08-25 2019-09-03 Armo Biosciences, Inc. Methods of using combinations of PEG-IL-10 and IL-15 for treating cancers
EP3374504B1 (en) * 2015-11-09 2025-03-19 CureVac SE Optimized nucleic acid molecules
CN108697769A (zh) * 2016-03-10 2018-10-23 免疫医疗有限公司 用于治疗肥胖症的胰高血糖素和glp-1共激动剂
US10676517B2 (en) 2016-03-10 2020-06-09 Medimmune Limited Glucagon and GLP-1 co-agonists for the treatment of obesity
AU2017229530B2 (en) * 2016-03-10 2020-05-07 Medimmune Limited Glucagon and GLP-1 co-agonists for the treatment of obesity
WO2017153575A1 (en) * 2016-03-10 2017-09-14 Medimmune Limited Glucagon and glp-1 co-agonists for the treatment of obesity

Also Published As

Publication number Publication date
WO2012050923A3 (en) 2012-07-19
CN103370083A (zh) 2013-10-23
CA2812951A1 (en) 2012-04-19
JP6121330B2 (ja) 2017-04-26
MX345245B (es) 2017-01-23
US20140107019A1 (en) 2014-04-17
CN103370083B (zh) 2016-11-16
MX2013003481A (es) 2013-10-25
EP3028720A1 (en) 2016-06-08
BR112013007442A2 (pt) 2019-09-24
EP2621538B1 (en) 2015-12-16
US20170114114A1 (en) 2017-04-27
EA201390450A1 (ru) 2013-07-30
CN106986940A (zh) 2017-07-28
EP2621538A2 (en) 2013-08-07
HK1225307A1 (en) 2017-09-08
JP2013545724A (ja) 2013-12-26
US9593154B2 (en) 2017-03-14
HK1188710A1 (zh) 2014-05-16
ES2563091T3 (es) 2016-03-10

Similar Documents

Publication Publication Date Title
EP2621538B1 (en) Engineered polypeptides having enhanced duration of action
EP2729481B1 (en) Engineered polypeptides having enhanced duration of action with reduced immunogenicity
JP6412183B2 (ja) 作用持続時間が増した改変ポリペプチド
US20150133373A1 (en) Transmucosal delivery of engineered polypeptides
EP2729160B1 (en) Engineered polypeptides having enhanced duration of action and reduced immunogenicity
WO2013148871A1 (en) Engineered polypeptides
US20180344813A1 (en) Engineered polypeptides having enhanced duration of action with reduced immunogenicity
HK1188710B (en) Engineered polypeptides having enhanced duration of action
HK1196624B (en) Engineered polypeptides having enhanced duration of action with reduced immunogenicity
HK1196624A (en) Engineered polypeptides having enhanced duration of action with reduced immunogenicity
HK1196093B (en) Engineered polypeptides having enhanced duration of action and reduced immunogenicity
HK1196093A (en) Engineered polypeptides having enhanced duration of action and reduced immunogenicity
HK1188924A (en) Leptin-abd fusion polypeptides with enhanced duration of action
HK1188924B (en) Leptin-abd fusion polypeptides with enhanced duration of action

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 11767876

Country of ref document: EP

Kind code of ref document: A2

WWE Wipo information: entry into national phase

Ref document number: MX/A/2013/003481

Country of ref document: MX

ENP Entry into the national phase

Ref document number: 2013531784

Country of ref document: JP

Kind code of ref document: A

Ref document number: 2812951

Country of ref document: CA

NENP Non-entry into the national phase

Ref country code: DE

REEP Request for entry into the european phase

Ref document number: 2011767876

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2011767876

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 201390450

Country of ref document: EA

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112013007442

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112013007442

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20130328