WO2011138391A1 - Compositions and methods of use for therapeutic low density lipoprotein - related protein 6 (lrp6) multivalent antibodies - Google Patents
Compositions and methods of use for therapeutic low density lipoprotein - related protein 6 (lrp6) multivalent antibodies Download PDFInfo
- Publication number
- WO2011138391A1 WO2011138391A1 PCT/EP2011/057200 EP2011057200W WO2011138391A1 WO 2011138391 A1 WO2011138391 A1 WO 2011138391A1 EP 2011057200 W EP2011057200 W EP 2011057200W WO 2011138391 A1 WO2011138391 A1 WO 2011138391A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- antibody
- lrp6
- group
- scfv
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2863—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/08—Drugs for disorders of the urinary system of the prostate
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/10—Drugs for disorders of the urinary system of the bladder
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P15/00—Drugs for genital or sexual disorders; Contraceptives
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/46—Hybrid immunoglobulins
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/46—Hybrid immunoglobulins
- C07K16/468—Immunoglobulins having two or more different antigen binding sites, e.g. multifunctional antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/35—Valency
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/64—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising a combination of variable region and constant region components
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
Definitions
- the present invention relates to multivalent antibodies comprising at least two receptor binding domains for two different binding sites on LRP6.
- the invention more specifically relates to multivalent antibodies that are LRP6 antagonists.
- the Wnt/ -catenin pathway regulates diverse biological processes during development and tissue homeostasis through modulating the protein stability of ⁇ -catenin (Clevers et al., (2006) Cell 127:469-480; and Logan et al., (2004) Annu. Rev Cell Dev. Biol 20:781- 810).
- cytoplasmic ⁇ -catenin is associated with the ⁇ - catenin destruction complex that contains multiple proteins including adenomatous polyposis coli (APC), Axin, and glycogen synthase kinase 3 (GSK3).
- APC adenomatous polyposis coli
- GSK3 glycogen synthase kinase 3
- ⁇ - catenin is constitutively phosphorylated by GSK3 and degraded by the proteasome pathway.
- the Wnt signal is transduced across the plasma membrane through two distinct receptors, the serpentine receptor Frizzled, and the single-transmembrane protein LRP5 or LRP6.
- the Wnt proteins promote the assembly of the Frizzled-LRP5/6 signaling complex, and induce phosphorylation of the cytoplasmic PPPSPxS motifs of LRP5/6 by GSK3 and Casein Kinase I.
- Phosphorylated LRP5/6 bind to Axin and inactivate the ⁇ - catenin degradation complex. Stabilized ⁇ -catenin enters the nucleus, binds to the TCF family transcription factors, and turns on transcription.
- the large extracellular domain of LRP5/6 contains four YWTD-type ⁇ -propeller regions that are each followed by an EGF-like domain, and the LDLR domain.
- Each propeller region contains six YWTD motifs that form a six-bladed ⁇ -propeller structure.
- Bispecific antibodies are immunoglobulin (Ig)-based molecules that bind to two different epitopes on either the same or distinct antigens.
- the antibodies for example, could be specific for a tumor cell antigen and an effector cell such as an activated T-cell or two functional targets or epitopes.
- the present invention provides novel multivalent antibodies that bind to multiple binding sites on the LRP6 receptor.
- the invention provides LRP6 multivalent antibodies that inhibit thecanonical Wnt signaling pathway.
- the present invention is based on the discovery that the multivalent antibodies (e.g., a single LRP6 biparatopic antibody) have the ability to inhibit both propeller 1 (e.g., Wntl) and propeller 3 (e.g., Wnt 3) ligands. Furthermore, and unexpectedly, the multivalent antibody (e.g., a single LRP6 biparatopic antibody) display no significant potentiation (enhancement) of a Wnt signal. The multivalent antibody binds to distinct LRP6 ⁇ - propeller domains.
- the multivalent antibodies e.g., a single LRP6 biparatopic antibody
- Propeller 1 antibodies bind to the ⁇ -propeller 1 domain and block propellerl -dependent Wnts such as Wntl, Wnt2, Wnt6, WnfJA, Wnt7B, Wnt9, WntlOA, Wntl OB.
- Propeller 3 antibodies bind to the ⁇ -propeller 3 domain and block propeller3- dependent Wnts such as Wnt3a and Wnt3.
- LRP6 antibodies differentiate propeller 1 and propeller 3 ligands into two separate classes and bind to distinct binding sites of the LRP6 target receptor.
- LRP6 antibodies e.g., Fabs
- Multivalent antibodies inhibit both propeller 1 (e.g., Wntl) and propeller 3 (e.g., Wnt 3) ligands but without potentation.
- LRP6 Propeller 1 antibodies are expected to inhibit the interaction with other Propeller 1 binding ligands (e.g. Sclerostin, Dkkl).
- Propeller 3 antibodies are expected to inhibit the interaction with other propeller 3 binding ligands (e.g. Dkkl).
- propeller 1 and 3 binding antibodies may be expected to affect the activity of other Wnt signaling modulators e.g. R-spondins.
- Multivalent antibodies provide advantages over traditional antibodies for example, expanding the repertoire of targets, having new binding specificities, increased potency, and no signal potentiation.
- a single LRP6 multivalent antibody can bind to multiple ⁇ - propeller domains on a single LRP6 target receptor on the same cell, and inhibit Wnt signaling.
- the multivalent antibody binds to any combination of a ⁇ - propeller domains selected from the group consisting of propeller 1 , propeller 2, propeller 3, and propeller 4.
- the multivalent antibody binds to propeller 1 and propeller 3 domains of LRP6.
- a single LRP6 multivalent antibody has increased potency of action by binding to multiple ⁇ -propeller domains and inhibiting Wnt signaling mediated by each domain.
- a single LRP6 multivalent antibody inhibits both propeller 1 and propeller 3 mediated Wnt signaling binding to both propeller 1 and propeller 3 domains, respectively.
- the increased potency of action may be due to increased avidity or better binding of the LRP6 multivalent antibody.
- the invention pertains to an isolated multivalent antibody having at least two receptor binding domains for two different binding sites of a target receptor, wherein the first receptor binding domain binds to a first binding site on the target receptor and the second receptor binding domain binds to a second binding site on the same target receptor, wherein the first and second receptor binding domains are linked together such that the binding of the first and second receptor binding domains to the first and second binding sites of the target receptor inhibits a canonical Wnt signal
- the multivalent antibody has an affinity for target receptor of approximately nanomolar affinity, or of approximately 1 picomolar affinity.
- the multivalent antibody is a multivalent antibody, a bivalent antibody, a bispecific antibody, or a biparatopic antibody.
- the first and second receptor binding domains is an IgG antibody, an scFv fragment, a single chain diabody, an antibody mimetic, or an antibody variable domain.
- the first and second receptor binding domains are linked together by a linker with a spatial distribution that permits the first and second receptor binding domains to bind to the first and second binding sites, respectively.
- the linker is a Gly-Ser linker.
- the multivalent antibody has the functional activity of inhibiting a canonical Wnt signal transduction pathway such as the Wntl signal pathway and/or the Wnt3 signal transduction pathway. In one embodiment, the multivalent antibody has the functional activity of depleting a cell population, inhibiting or reducing proliferation of a cell population, inhibiting or reducing secretion of inflammatory mediators from a cell population, inhibiting or reducing secretion of cytoplasmic granules from a cell population, wherein the cell population is selected from the group consisting of tumor cells, T cells B cells, and Wnt dependent cells.
- the invention in another aspect, pertains to an isolated multivalent antibody having at least two receptor binding domains for two different binding sites of an LRP6 target receptor, where the first receptor binding domain binds to a first binding site on the target receptor and the second receptor binding domain binds to a second binding site on the same LRP6 target receptor.
- the first and second receptor binding domains are linked together such that the binding of the first and second receptor binding domains to the first and second binding sites of the LRP6 target receptor inhibits a canonical Wnt signal transduction pathway, and the antibody or antigen binding fragment displays no significant potentiation of a Wnt signal.
- the antibody has an affinity for target receptor of approximately nanomolar affinity. In another embodiment, the antibody has an affinity for target receptor of approximately 1 picomolar affinity.
- the first receptor binding domain is an IgG antibody and the second receptor binding domain is an scFv fragment, where the IgG antibody and scFv fragment are linked together by a linker with a spatial distribution that permits the IgG antibody and scFv fragment to bind to the first and second epitopes of LRP6, respectively.
- the linker is a Gly-Ser linker selected from the group consisting of
- the first epitope of the LRP6 target receptor is a ⁇ -propeller 1 domain and the second epitope of the LRP6 target receptor is a ⁇ -propeller 3 domain.
- the antibody or antigen binding fragment binds to the LPR6 ⁇ -propeller 1 domain and comprises a heavy chain CDRl selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 21, and SEQ ID NO: 47; a CDR2 selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 22, and SEQ ID NO: 48; and a CDR3 selected from the group consisting of SEQ ID NO: 3, SEQ ID NO: 23, and SEQ ID NO: 49; and a light chain CDR1 selected from the group consisting of SEQ ID NO: 4, SEQ ID NO: 24, and SEQ ID NO: 50; a CDR2 selected from the group consisting of SEQ ID NO: 5, SEQ ID NO: 25, and SEQ ID NO: 51 ; and a CDR3 selected from the group
- the antibody or antigen binding fragment binds to the LPR6 ⁇ - propeller 3 domain and comprises a heavy chain CDR1 selected from the group consisting of SEQ ID NO: 69, SEQ ID NO: 93, and SEQ ID NO: 1 15; a CDR2 selected from the group consisting of SEQ ID NO: 70, SEQ ID NO: 94, and SEQ ID NO: 1 16; and a CDR3 selected from the group consisting of SEQ ID NO: 71 , SEQ ID NO: 95, and SEQ ID NO: 1 17; and a light chain CDR1 selected from the group consisting of SEQ ID NO: 72, SEQ ID NO: 96, and SEQ ID NO: 1 18; a CDR2 selected from the group consisting of SEQ ID NO: 73, SEQ ID NO: 97, and SEQ ID NO: 119; and a CDR3 selected from the group consisting of SEQ ID NO: 74, SEQ ID NO: 98, and SEQ ID NO: 120.
- the IgG heavy chain antibody is selected from the group consisting of SEQ ID NO: 18, 66, and 101 and the light chain is selected from the group consisting of SEQ ID NO: 17, 86, and 85.
- the scFv is selected from the group consisting of SEQ ID NO: 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, and 164.
- the scFv fragment comprises at least one amino acid mutation that improves stability of the scFv compared with the unmutated scFv fragment, wherein the amino acid mutation is selected from Figures 29-32.
- the multivalent antibody has the functional activity of inhibiting a canonical Wnt signal transduction pathway selected from the group consisting of Wntl signal pathway and Wnt3 signal transduction pathway.
- the multivalent antibody has the functional activity of depleting a cell population, inhibiting or reducing proliferation of a cell population, inhibiting or reducing secretion of inflammatory mediators from a cell population, inhibiting or reducing secretion of cytoplasmic granules from a cell population, wherein the cell population is selected from the group consisting of tumor cells, T cells B cells, and Wnt dependent cells.
- the invention pertains to an isolated biparatopic antibody comprising an IgG antibody that binds to a ⁇ -propeller 1 domain on an LRP6 target receptor and a scFv that binds to a ⁇ -propeller 3 domain on the LRP6 target, where the IgG antibody and the scFv are linked by a linker such that the binding of the IgG antibody and the scFv to the ⁇ -propeller 1 domain and the ⁇ -propeller 3 domains, respectively inhibits a canonical Wnt signal transduction pathway, and where the biparatopic antibody displays no significant potentiation of a Wnt signal.
- the antibody has an affinity for target receptor of approximately nanomolar affinity. In another embodiment, the antibody has an affinity for target receptor of approximately 1 picomolar affinity.
- the linker comprises a spatial distribution that permits binding of the IgG antibody and the scFv fragment to bind the ⁇ -propeller 1 domain of LRP6 and the ⁇ - propeller 3 domain of LRP6, respectively.
- the scFv is linked by a Ser-Gly linker to the Fc binding site of the IgG antibody, where the Ser-Gly linker is selected from the group consisting of (Gly 4 Ser)4, and (Gly 4 Ser)3.
- the Fc binding site of the IgG antibody is a CH3 domain.
- the scFv is linked by a Ser-Gly linker to the light chain of the IgG antibody, where the Ser- Gly linker is selected from the group consisting of (Gly 4 Ser) 4 , and (Gly 4 Ser)3.
- the scFv comprises at least one amino acid mutation that improves stability of the scFv compared with the unmutated scFv fragment, wherein the amino acid mutation is selected from Figures 29-32.
- the antibody comprises a heavy chain variable region CDR1 of SEQ ID NO: 1 ; a heavy chain variable region CDR2 of SEQ ID NO: 2; a heavy chain variable region CDR3 of SEQ ID NO: 3; a light chain variable region CDR1 of SEQ ID NO: 4; a light chain variable region CDR2 of SEQ ID NO: 5; and a light chain variable region CDR3 of SEQ ID NO: 6, wherein the antibody binds to a ⁇ -propeller 1 domain of LRP6; and a scFv heavy chain variable region CDR1 of SEQ ID NO: 69; a heavy chain variable region CDR2 of SEQ ID NO: 70; a heavy chain variable region CDR3 of SEQ ID NO: 71; a light chain variable region CDR1 of SEQ ID NO: 72; a light chain variable region CDR2 of SEQ ID NO: 73; and a light chain variable region CDR3 of SEQ ID NO: 74, wherein the scFv bind
- the antibody further comprises a Lys deletion from position 454 of SEQ ID NO: 166. In one embodiment, the antibody further comprises a Pro to Ala mutation at position 677 of SEQ ID NO: 166. In one embodiment, the antibody comprises a heavy chain sequence selected from the group consisting of SEQ ID NOs: 166, 171, 173, 175, 195, 201 and 207 in combination with a light chain sequence selected from the group consisting of SEQ ID NOs: 170, 193, 199, and 205.
- the antibody comprises a combination of heavy and light chain sequences selected from the group consisting of SEQ ID NOs: 166/170, 171/170, 173/170, 175/170, 201/199, 207/205, and 195/193. In one embodiment, the antibody comprises heavy and light chain sequences with SEQ ID NOs: 166/170. In one embodiment, the antibody comprising heavy and light chain sequences with SEQ ID NOs; 177/ 181.
- the antibody has the functional activity of inhibiting a canonical Wnt signal transduction pathway selected from the group consisting of Wntl signal pathway and Wnt3 signal transduction pathway.
- the antibody has the functional activity of depleting a cell population, inhibiting or reducing proliferation of a cell population, inhibiting or reducing secretion of inflammatory mediators from a cell population, inhibiting or reducing secretion of cytoplasmic granules from a cell population, wherein the cell population is selected from the group consisting of tumor cells, T cells B cells, and Wnt dependent cells.
- the invention pertains to an isolated biparatopic antibody comprising an IgG antibody that binds to a ⁇ -propeller 3 domain on an LRP6 target receptor and a scFv that binds to a ⁇ -propeller 1 domain on the LRP6 target, wherein the IgG antibody and the scFv are linked by a linker such that the binding of the IgG antibody and the scFv to the ⁇ -propeller 3 domain and the ⁇ -propeller 1 domains, respectively inhibits a canonical Wnt signal transduction pathway, and wherein the biparatopic antibody displays no significant potentiation of a Wnt signal.
- the antibody has an affinity for target receptor of approximately nanomolar affinity. In another embodiment, the antibody has an affinity for target receptor of approximately 1 picomolar affinity.
- the linker comprises a spatial distribution that permits binding of the IgG antibody and the scFv to bind the ⁇ -propeller 3 domain of LRP6 and the ⁇ -propeller 1 domain of LRP6, respectively.
- the scFv is linked by a Ser-Gly linker to the Fc binding site of the IgG antibody, wherein the Ser-Gly linker is selected from the group consisting of (Gly 4 Ser) 4 , and (Gly 4 Ser)3.
- the Fc binding site of the IgG antibody is a CH3 domain.
- the scFv comprises at least one amino acid mutation that improves stability of the scFv compared with the unmutated scFv fragment, wherein the amino acid mutation is selected from Figures 29-32.
- the antibody comprises a heavy chain variable region CDR1 of SEQ ID NO: 69; a heavy chain variable region CDR2 of SEQ ID NO: 70; a heavy chain variable region CDR3 of SEQ ID NO: 71 ; a light chain variable region CDR1 of SEQ ID NO: 72; a light chain variable region CDR2 of SEQ ID NO: 73; and a light chain variable region CDR3 of SEQ ID NO: 74, wherein the antibody binds to a ⁇ -propeller 3 domain of LRP6; and an scFv with a heavy chain variable region CDR1 of SEQ ID NO: 1 ; a heavy chain variable region CDR2 of SEQ ID NO: 2; a heavy chain variable region CDR3 of SEQ ID NO: 3; a light chain variable region CDR1 of SEQ ID NO: 4; a light chain variable region CDR2 of SEQ ID NO: 5; and a light chain variable region CDR3 of SEQ ID NO: 6, wherein the scF
- the scFv VH and VL are linked with a linker comprising 3 amino acids. In another embodiment, the scFv VH and VL are linked with a linker comprising 4 amino acids.
- the antibody comprises a heavy chain sequence selected from the group consisting of SEQ ID NO:, 187, and 189; and a light chain sequence comprising SEQ ID NO: 185. In one embodiment, the antibody has the functional activity of inhibiting a canonical Wnt signal transduction pathway selected from the group consisting of Wnt 1 signal pathway and Wnt3 signal transduction pathway. In another embodiment, the antibody has the functional activity of depleting a cell population, inhibiting or reducing proliferation of a cell population, inhibiting or reducing secretion of
- inflammatory mediators from a cell population inhibiting or reducing secretion of cytoplasmic granules from a cell population, wherein the cell population is selected from the group consisting of tumor cells, T cells B cells, and Wnt dependent cells.
- the invention pertains to nucleic acid comprising a nucleotide sequence encoding a multivalent antibody.
- the invention pertains to a nucleic acid comprising a nucleotide sequence encoding a multivalent antibody comprising a heavy chain sequence selected from the group consisting of SEQ ID NOs: 166, 171, 173, 175, 195, 201, and 207; and light chain sequences selected from the group consisting of SEQ ID NOs: 170, 193, 199, and 205.
- the invention pertains to a nucleic acid comprising a nucleotide sequence encoding multivalent antibody comprising a heavy chain sequence selected from the group consisting of SEQ ID NOs: 166, 171, 173, 175, 193, 199, 201, and 207; and light chain sequences selected from the group consisting of SEQ ID NOs: 170, 195, and 205 least, where the antibody or antigen binding fragment has 98% sequence identity to SEQ ID NOs: 166, 171 , 173, 175, 195, 201, and 207; and light chain sequences selected from the group consisting of SEQ ID NOs: 170, 193, 199, and 205.
- the invention pertains to a nucleic acid comprising a nucleotide sequence encoding a multivalent antibody comprising a SEQ ID NO: 166 and SEQ ID NO: 170.
- the invention pertains to a nucleic acid comprising a nucleotide sequence encoding a multivalent antibody comprising at least 98% sequence identity to a SEQ ID NO: 166 and SEQ ID NO: 170.
- the invention pertains to a nucleic acid comprising a nucleotide sequence encoding a multivalent antibody comprising a sequence selected from the group consisting of SEQ ID NOs: 177, and; and a light chain sequence of SEQ ID NO: 181.
- the invention pertains to a nucleic acid comprising a nucleotide sequence encoding a multivalent antibody comprising at least 98% sequence identity to SEQ ID NOs: 177; and a light chain sequence of SEQ ID NO: 181.
- the invention pertains to a nucleic acid comprising a nucleotide sequence encoding a multivalent antibody comprising a sequence selected from the group consisting of SEQ ID NOs: 187, and 189; and a light chain sequence of SEQ ID NO: 185.
- the invention pertains to a nucleotide sequence encoding a multivalent antibody comprising at least 98% sequence identity to SEQ ID NOs: 187, and 189; and a light chain sequence of SEQ ID NO: 185.
- the invention pertains to a vector comprising the nucleic acid of the invention.
- the invention pertains to a pharmaceutical composition comprising a multivalent antibody having at least two receptor binding domains for two different binding sites of a target receptor and a pharmaceutically acceptable carrier.
- the invention pertains to a method of obtaining a multivalent antibody of the invention by a) providing a first receptor binding domain which binds to a first binding site of an LRP6 target receptor; (b) providing a second receptor binding domain which binds to a second binding site of an LRP6 target receptor; and (c) linking the first receptor binding domain to the second receptor binding domain.
- the first or second receptor binding domain are selected from the group consisting of an IgG antibody, an scFv fragment, a single chain diabody, an antibody mimetic, and an antibody variable domain.
- the first and second receptor binding domains are linked together by a linker with a spatial distribution that permits the first and second receptor binding domains to bind to the first and second epitopes of LRP6, respectively.
- the linker is a Gly-Ser linker selected from the group consisting of (Gly 4 Ser) 4 , and (Gly 4 Ser)3.
- the method further comprises introducing at least one amino acid mutation to the first or second receptor binding domain, such that the amino acid mutation improves stability of the first or second receptor binding domain compared with the unmutated first or second receptor binding domain.
- the invention pertains to a method of treating a cancer comprising selecting a subject (e.g., human) having an LRP6 expressing cancer, administering to a subject in need thereof an effective amount of a composition comprising a multivalent antibody having at least two receptor binding domains for two different binding sites of a target receptor.
- a subject e.g., human
- a composition comprising a multivalent antibody having at least two receptor binding domains for two different binding sites of a target receptor.
- the invention pertains to a method of treating a cancer comprising selecting a subject having an LRP6 expressing cancer, administering to a subject in need thereof an effective amount of a composition comprising a multivalent antibody having at least two receptor binding domains for two different binding sites of a target receptor, where the cancer is selected from the group consisting of breast cancer, lung cancer, multiple myeloma, ovarian cancer, liver cancer, bladder cancer, gastric cancer, prostate cancer, acute myeloid leukemia, chronic myeloid leukemia, osteosarcoma, squamous cell carcinoma, and melanoma.
- the cancer is breast cancer.
- the invention in another aspect, pertains to a method of treating a disease mediated by a canonical Wnt signaling pathway using a biparatopic antibody to LRP6.
- the invention pertains to a method of treating a cancer comprising selecting a subject having an LRP6 expressing cancer, administering to said subject an effective amount of a composition comprising a antibody with heavy and light chain sequences selected from the group consisting of SEQ ID NOs: 166/170, 171/170, 173/170, 175/170, 201/199, 207/205, and 195/193 in combination with any standard of care cancer therapies.
- the invention pertains to use of a multivalent antibody in the manufacture of a medicament for the treatment of a cancer selected from the group consiting of breast cancer, lung cancer, multiple myeloma, ovarian cancer, liver cancer, bladder cancer gastric cancer, prostate cancer, acute myeloid leukemia, chronic myeloid leukemia, osteosarcoma, squamous cell carcinoma, and melanoma.
- a cancer selected from the group consiting of breast cancer, lung cancer, multiple myeloma, ovarian cancer, liver cancer, bladder cancer gastric cancer, prostate cancer, acute myeloid leukemia, chronic myeloid leukemia, osteosarcoma, squamous cell carcinoma, and melanoma.
- the invention pertains to a multivalent antibody having VH of SEQ ID NO: 14; VL of SEQ ID NO: 13; VH of SEQ ID NO: 82; VL of SEQ ID NO: 81 for use in treating a cancer mediated by a canonical Wnt signaling pathway.
- the invention pertains to a multivalent antibody having VH of SEQ ID NO: 14; VL of SEQ ID NO: 13; VH of SEQ ID NO: 82; VL of SEQ ID NO: 81 for use as a drug.
- the invention pertains to a multivalent antibody having SEQ ID NO: 166 and SEQ ID NO: 170 for use in treating a cancer mediated by a canonical Wnt signaling pathway.
- the invention pertains to a multivalent antibody having SEQ ID NO: 166 and SEQ ID NO: 170 for use as a drug.
- the invention pertains to a multivalent antibody for use as a
- the invention pertains to a multivalent antibody for use as a medicament for treatment of an LRP6 expressing cancer.
- the invention pertains a multivalent antibody for use as a medicament for treatment of an LRP6 expressing cancer, wherein the cancer is selected from the group consisting of breast cancer, lung cancer, multiple myeloma, ovarian cancer, liver cancer, bladder cancer, gastric cancer, prostate cancer, acute myeloid leukemia, chronic myeloid leukemia, osteosarcoma, squamous cell carcinoma, and melanoma.
- Figure 1 is a graph showing FACS EC50 determination of selected Fabs on PA1 cells, U266 cells and Daudi cells and the corresponding mRNA expression data (A) and knockdown of LRP6 by shR A and the corresponding mRNA expression data B;
- Figure 2A-L are graphs showing anti-LRP6 Fab fragments activity in HEK293T/17 STF cells (gene reporter assay) expressing Wntl or Wnt3A ligands The data shows that anti- LRP6 Fabs selectively block Wntl or Wnt3 signaling;
- Figure 3 shows the cross-reactivity values of anti-LRP6 ⁇ -propeller 1 and ⁇ -propeller 3 antibodies for human, mouse and cymologous monkey;
- Figure 4 is a graph showing transient expression of various WNT ligands in HE 293T/17 STF cells (gene reporter assay) and treatment with anti-LRP6 antibodies, showing activity inhibition of particular WNTs based on antibody binding blocking to specific ⁇ -propeller regions of LRP6;
- Figure 5 is a bar chart showing that Fab conversion to IgG results in potentiation of signal from the non-blocked Wnt ligand
- Figure 6 is a western blot showing selective target inhibition of LRP6 in cellular systems
- Figure 7 is a graph showing a single i.v. dose of an LRP6 antibody that binds to ⁇ - propeller 1 region at 5mg/kg in a rodent;
- Figure 9A is a graph showing Propeller 1 , but not Propeller 3 mAb, causes in vivo tumor regression in MMTV-Wntl model.
- Figure 9B is a graph showing the effect of different doses of the Propeller 1 mAb on the growth of the MMTV-Wntl tumor model;
- Figure 10 is a graph showing Propeller 3, but not Propeller 1 mAb, causes inhibition of tumor growth in a MMTV-Wnt3 model
- Figure 1 1 is a graph showing Propeller 3, but not Propeller 1 mAb causes inhibition of Wnt3 A- induced Super Top Flash activity in PA-1 cells in vivo;
- Figure 12 is a figure showing solvent protected regions of LRP6 PD3-4 by MOR06475 by HDx MS (A) and that mutations of specific residues result in loss of binding of scFv MOR06475 (B);
- Figure 13 is a schematic showing the ⁇ -propeller regions of LRP6
- Figure 14 is a photograph of an SDS-PAGE gel showing that all scFv molecules successfully expressed and purified from E. coli;
- Figure 15 A-D are schematic example of multivalent antibodies.
- 15 A scFv scFv attached to the C-terminus of full IgG
- 15B scFv scFv attached to the N-terminus of Fc
- 15C scFv scFv attached to the C-terminus of Fc
- 15D scFv scFv attached to the N and C terminus of Fc;
- Figure 16 is a photograph of an SDS-PAGE gel showing purified biparatopic anti-LRP6 IgG scFv under non-reduced (lane 1) and reduced (lane 2) conditions;
- Figure 17 shows activity in STF assay of a biparatopic antibody and respective component parts separately
- Figure 18 shows activity in STF assay of linker length comparisons in scFv molecules
- Figure 19 is a table showing the binding activity a biparatopic antibody
- Figure 20 shows the activity of a biparatopic antibody and a Prop3 antibody but not a Pro l antibody in a PA-1/Wnt3a L-cell co-culture model
- Figure 21 is a graph showing a comparison between single i.v. doses of a Propl LRP6 antibody and a Propl/3 biparatopic antibody at 5mg kg in a rodent;
- Figure 22 is a graph showing both Propeller 1 and biparatopic propeller 1/3 antibodies cause in vivo tumor regression in MMTV-Wntl model
- Figure 23 is a graph showing dose-response relationship of a Propl/3 binding biparatopic antibody in MMTV-Wntl model
- Figure 24 shows that differentiation of murine MMTV-Wntl mammary tumors is induced by antagonistic LRP6 antibodies.
- A-B Fragments of MMTV-Wntl tumors were implanted subcutaneously into nude mice. Tumor-bearing mice were treated with either a single dose of PBS (control) or 5mg/kg MOR08168IgGlLALA 6475 scfv.
- Figure 25 is a graph showing activity of Prop 1/3 binding biparatopic antibody in the E- Cadherin negative MDA-MB231 xenograft model
- Figure 26 shows the affinity and binding kinetics of MOR08168, MOR06475 and MOR08168IgGlLALA 6475 scfv to recombinant LRP6 PD1/2 and PD3/4.
- Figure 27 shows a schematic drawing of IgG based biparatopic antibodies
- Figure 28 are photographs of SDS-PAGE gels showing the optimization of anti-LRP6 scFv expression in E. coli;
- Figure 29 is a table showing the effect of single mutations in MOR06475 scFv on Tm.
- Figure 30 is a table showing the effect of single mutations in MOR08168 scfv on Tm;
- Figure 31 is a table showing the effect of double mutations in MOR08168 scFv on Tm in material expressed in both bacterial and mammalian systems;
- Figure 32 is a table summarizing the binding and functional activities of the WILD TYPE and single/double mutated versions of MOR06475 and MOR08168 scFvs in ELISA, Proteon affinity and STF reporter gene assays;
- Figure 33 is an illustration of selected examples of the designed mutations.
- the protein backbone is rendered in ribbon diagram while selected side chains are rendered as sticks,
- W103 could form a perpendicular pi-pi stacking interaction, while VH:F37 and VL:F98 could form another perpendicular pi-pi stacking interaction,
- VH:F37 and VL:F98 could form another perpendicular pi-pi stacking interaction
- VH:F37 and VL:F98 could form another perpendicular pi-pi stacking interaction
- VH:F37 and VL:F98 could form another perpendicular pi-pi stacking interaction
- the hydrophobic residue VH:V33 is close to a polar residue VH:N100a.
- the VH.N33 side chain could form a hydrogen bond with VH:N100a, suggested by homology modeling.
- Figure 34 is a table showing thermostability measurements of biparatopic antibodies.
- immune response refers to the action of, for example, lymphocytes, antigen presenting cells, phagocytic cells, granulocytes, and soluble macromolecules produced by the above cells or the liver (including antibodies, cytokines, and complement) that results in selective damage to, destruction of, or elimination from the human body of invading pathogens, cells or tissues infected with pathogens, cancerous cells, or, in cases of autoimmunity or pathological inflammation, normal human cells or tissues.
- signal transduction pathway or “signaling activity” as used herein refers to a biochemical causal relationship generally initiated by a protein-protein interaction such as binding of a growth factor to a receptor, resulting in transmission of a signal from one portion of a cell to another portion of a cell.
- the transmission involves specific phosphorylation of one or more tyrosine, serine, or threonine residues on one or more proteins in the series of reactions causing signal transduction.
- Penultimate processes typically include nuclear events, resulting in a change in gene expression.
- Wnt signaling pathway refers to the canonical Wnt pathway in which members of the Wnt family of secreted protein ligands bind a receptor complex of LRP and Frizzled (FZD) allowing ⁇ -catenin to be translocated into the nucleus, interact with the LEF/TCF transcription factors and activate target gene expression.
- the Wnt signaling pathway can be measured using a Wnt reporter gene assay or other measure of Wnt directed signaling (e.g., LRP6 phosphorylation, ⁇ -catenin stabilization and nuclear translocation, cellular proliferation/ survival) as described herein.
- Wnt 1 signaling pathway refers to a canonical Wnt pathway that is activated by LRP6 interacting with the Wntl ligand and the class of Wnt 1 binding ligands, such as Wnt2, Wnt6, Wnt7a, Wnt7b, Wnt9a, WntlOa, or WntlOb.
- Wnt 3 signaling pathway refers to a canonical Wnt pathway that is activated by LRP6 interacting with the Wnt3 or a Wnt3a ligand.
- LRP6 refers to human LRP6 as defined in Accession No. NP002327.
- antibody refers to whole antibodies that interact with (e.g., by binding, steric hinderance, stabilizing/destabilizing, spatial distribution) an LRP6 epitope and inhibit signal transduction.
- a naturally occurring “antibody” is a glycoprotein comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds. Each heavy chain is comprised of a heavy chain variable region
- VH a heavy chain constant region
- the heavy chain constant region is comprised of three domains, CHI, CH2 and CH3.
- Each light chain is comprised of a light chain variable region (abbreviated herein as VL) and a light chain constant region.
- the light chain constant region is comprised of one domain, CL.
- the VH and V L regions can be further subdivided into regions of hypervariability, termed
- CDR complementarity determining regions
- FR framework regions
- Each VH and VL is composed of three CDRs and four FRs arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
- the variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
- the constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq) of the classical complement system.
- antibody includes for example, monoclonal antibodies, human antibodies, humanized antibodies, camelised antibodies, chimeric antibodies, Fab fragments, F(ab') fragments, and anti-idiotypic (anti-Id) antibodies (including, e.g., anti-Id antibodies to antibodies of the invention), and epitope- binding fragments of any of the above.
- the antibodies can be of any isotype (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., IgGl, IgG2, IgG3, IgG4, IgAl and IgA2) or subclass.
- variable domains of both the light (VL) and heavy (VH) chain portions determine antigen recognition and specificity.
- the constant domains of the light chain (CL) and the heavy chain (CHI, CH2 or CH3) confer important biological properties such as secretion, transplacental mobility, Fc receptor binding, complement binding, and the like. By convention the numbering of the constant region domains increases as they become more distal from the antigen binding site or amino- terminus of the antibody.
- the N-terminus is a variable region and at the C-terminus is a constant region; the CH3 and CL domains actually comprise the carboxy-terminus of the heavy and light chain, respectively.
- the term "antibody” specifically includes an IgG-scFv formats as shown in Fig 12 A-D.
- receptor binding domain refers to portions of a binding molecule (e.g., an antibody), that specifically interacts with (e.g., by binding, steric hinderance, stabilizing/destabilizing, spatial distribution) a binding site on a target receptor.
- RBD also refers to one or more fragments of an antibody that retain the ability to specifically interact with (e.g., by binding, steric hinderance, stabilizing/destabilizing, spatial distribution) an LRP6 epitope and inhibit signal transduction.
- antibody fragments include, but are not limited to, an scFv, a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CHI domains; a F(ab) 2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; a Fd fragment consisting of the VH and CHI domains; a Fv fragment consisting of the VL and VH domains of a single arm of an antibody; a dAb fragment (Ward et al, ( 1989) Nature 341 :544-546), which consists of a VH domain; and an isolated complementarity determining region (CDR).
- an scFv a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CHI domains
- F(ab) 2 fragment a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region
- a Fd fragment consisting of the V
- the two domains of the Fv fragment, VL and VH are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (known as single chain Fv (scFv); see e.g., Bird et ai, (1988) Science 242:423-426; and Huston et ai, (1988) Proc. Natl. Acad. Sci. 85:5879-5883).
- scFv single chain Fv
- Such single chain antibodies are also intended to be encompassed within the term
- antibody fragment are obtained using conventional techniques known to those of skill in the art, and the fragments are screened for utility in the same manner as are intact antibodies.
- Antibody fragments can also be incorporated into "single domain antibodies",
- Antibody fragments can be grafted into scaffolds based on polypeptides such as
- Fibronectin type HI Fn3 (see U.S. Pat. No. 6,703,199, which describes fibronectin polypeptide monobodies).
- Antibody fragments can be incorporated into single chain molecules comprising a pair of tandem Fv segments (VH-CH1-VH-CH1) which, together with complementary light chain polypeptides, form a pair of antigen binding regions (Zapata et al., (1995) Protein Eng. 8: 1057-1062; and U.S. Pat. No. 5,641,870).
- RBDs also include single domain antibodies, maxibodies, unibodies, minibodies, , diabodies, triabodies, tetrabodies, v-NAR and bis-scFv (see, e.g., Hollinger and Hudson, (2005) Nature Biotechnology 23: 1 126-1 136), bispecific single chain diabodies, or single chain diabodies designed to bind two distinct epitopes.
- RBDs also include antibody-like molecules or antibody mimetics, which include, but not limited to minibodies, maxybodies, Fn3 based protein scaffolds, Ankrin repeats (also known as DARpins), VASP polypeptides, Avian pancreatic polypeptide (aPP), Tetranectin, Affililin, Knottins, SH3 domains, PDZ domains, Tendamistat, Neocarzinostatin, Protein A domains, Lipocalins, Transferrin, and Kunitz domains that specifically bind epitopes, which are within the scope of the invention.
- multivalent antibody refers to a single binding molecule with more than one valency, where "valency” is described as the number of antigen-binding moieties present per molecule of an antibody construct. As such, the single binding molecule can bind to more than one binding site on a target receptor.
- multivalent antibodies include, but are not limited to bivalent antibodies, trivalent antibodies, tetravalent antibodies, pentavalent antibodies, and the like, as well as bispecific antibodies and biparatopic antibodies.
- the mutivalent antibody e.g., an LRP6 biparatopic antibody
- the mutivalent antibody has a binding moiety for the ⁇ -propeller 1 domain binding site and a binding moiety for the ⁇ -propeller 3 domain binding site of LRP6, respectively.
- multivalent antibody also refers to a single binding molecule that has more than one antigen-binding moieties for two separate target receptors.
- an antibody that binds to both an LRP6 target receptor and a second target receptor that is not LRP6 such as ErbB, cmet, IGFR1, Smoothened, Notch receptors.
- a multivalent antibody is a tetravalent antibody that has four receptor binding domains.
- a tetravalent molecule may be bispecific and bivalent for each binding site on that target receptor.
- the multivalent antibody mediates biological effect (e.g., which modulates cellular activation (e.g., by binding to a cell surface receptor and resulting in transmission or inhibition of an activating or inhibitory signal), which results in death of the cell (e.g., by a cell signal induced pathway), or which modulates a disease or disorder in a subject (e.g., by mediating or promoting cell killing, or by modulating the amount of a substance which is bioavailable.
- biological effect e.g., which modulates cellular activation (e.g., by binding to a cell surface receptor and resulting in transmission or inhibition of an activating or inhibitory signal), which results in death of the cell (e.g., by a cell signal induced pathway), or which modulates a disease or disorder in a subject (e.g., by mediating or promoting cell killing, or by modulating the amount of a substance which is bioavailable.
- isolated antibody refers to antibody that is substantially free of other antibodies having different antigenic specificities (e.g., an isolated antibody that specifically binds LRP6 is substantially free of antibodies that specifically bind antigens other than LRP6).
- An isolated antibody that specifically binds LRP6 may, however, have cross-reactivity to other antigens, such as LRP6 molecules from other species.
- an isolated antibody may be substantially free of other cellular material and/or chemicals.
- monovalent antibody refers to an antibody that binds to a single epitope on a target receptor such as LRP6.
- bivalent antibody refers to an antibody that binds to two epitopes on at least two identical target receptors (e.g., an antibody that binds to the ⁇ - propeller 1 domain of two LRP6 receptors, or an antibody that binds to the ⁇ -propeller 3 domain of two LRP6 receptors).
- the bivalent antibody may also crosslink the target receptors to one another.
- a “bivalent antibody” also refers to an antibody thatbind to two different epitopes on at least two identical target receptors.
- biparatopic antibody refers to an antibody that binds to two different epitopes on the same target receptor, e.g., an antibody that binds to the ⁇ - propeller 1 domain and the ⁇ -propeller 3 domain of a single LRP6 receptor.
- the term also includes an antibody, which binds to both the ⁇ -propeller 1 and ⁇ -propeller 3 domains of at least two LRP6 receptor(s) e.g., a tetravalent biparatopic antibody.
- bispecific antibody refers to an antibody that binds to two or more different epitopes on at least two different target receptors (e.g., an LRP6 receptor and a receptor that is not a LRP6 receptor).
- monoclonal antibody or “monoclonal antibody composition” as used herein refers to polypeptides, including antibodies, antibody fragements, bisepcific antibodies, etc. that have ubstantially identical to amino acid sequence or are derived from the same genetic source. This term also includes preparations of antibody molecules of single molecular composition.
- a monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope.
- human antibody includes antibodies having variable regions in which both the framework and CDR regions are derived from sequences of human origin. Furthermore, if the antibody contains a constant region, the constant region also is derived from such human sequences, e.g., human germline sequences, or mutated versions of human germline sequences or antibody containing consensus framework sequences derived from human framework sequences analysis, for example, as described in Knappik, et al. (2000. J Mol Biol 296, 57-86).
- immunoglobulin variable domains e.g., CDRs
- CDRs immunoglobulin variable domains
- the structures and locations of immunoglobulin variable domains may be defined using well known numbering schemes, e.g., the Kabat numbering scheme, the Chothia numbering scheme, or a combination of Kabat and Chothia (see, e.g., Sequences of Proteins of
- human antibodies of the invention may include amino acid residues not encoded by human sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo, or a conservative substitution to promote stability or manufacturing).
- human antibody as used herein, is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
- recombinant human antibody includes all human antibodies that are prepared, expressed, created or isolated by recombinant means, such as antibodies isolated from an animal (e.g., a mouse) that is transgenic or transchromosomal for human immunoglobulin genes or a hybridoma prepared therefrom, antibodies isolated from a host cell transformed to express the human antibody, e.g., from a transfectoma, antibodies isolated from a recombinant, combinatorial human antibody library, and antibodies prepared, expressed, created or isolated by any other means that involve splicing of all or a portion of a human immunoglobulin gene, sequences to other DNA sequences.
- Such recombinant human antibodies have variable regions in which the framework and CDR regions are derived from human germline immunoglobulin sequences.
- such recombinant human antibodies can be subjected to in vitro mutagenesis (or, when an animal transgenic for human Ig sequences is used, in vivo somatic mutagenesis) and thus the amino acid sequences of the VH and VL regions of the recombinant antibodies are sequences that, while derived from and related to human germline VH and VL sequences, may not naturally exist within the human antibody germline repertoire in vivo.
- linker refers to a peptide linker that consists of glycine and serine residues used to link an scFv to an IgG.
- the linkers include, but are not limited to, (Gly 4 Ser) 4 or (Gly 4 Ser) 3 .
- the linkers Glu and Lys residues interspersed within the Gly-Ser linkers for better solubility.
- the linkers include multiple repeats of (Gly 2 Ser), (GlySer) or (Gly 3 Ser).
- the linkers include combinations and multiples of (Gly 3 Ser)+(Gly 4 Ser)+(GlySer).
- Ser can be replaced with Ala e.g., (Gly 4 Ala) or (Gly 3 Ala).
- the linker comprises any combination of Gly, Ser and Pro.
- the linker comprises the motif (GluAlaAlaAlaLys) n , where n is a positive integer equal to or greater than 1.
- Fc region refers to a polypeptide comprising the CH3, CH2 and at least a portion of the hinge region of a constant domain of an antibody.
- an Fc region may include a CH4 domain, present in some antibody classes.
- An Fc region may comprise the entire hinge region of a constant domain of an antibody.
- the invention comprises an Fc region and a CHI region of an antibody.
- the invention comprises an Fc region CH3 region of an antibody.
- the invention comprises an Fc region, a CHI region and a
- a binding molecule of the invention comprises a constant region, e.g., a heavy chain constant region.
- a constant region is modified compared to a wild-type constant region.
- the polypeptides of the invention disclosed herein may comprise alterations or modifications to one or more of the three heavy chain constant domains (CHI, CH2 or CH3) and or to the light chain constant region domain (CL). Exemplary modifications include additions, deletions or substitutions of one or more amino acids in one or more domains. Such changes may be included to optimize effector function, half-life, etc.
- binding site comprises an area on a target receptor to which an antibody or antigen binding fragment selectively binds.
- the binding sites on LRP6 include the ⁇ - propeller 1 binding domain, ⁇ - propeller 2 binding domain, ⁇ - propeller 3 binding domain, and ⁇ - propeller 4 binding domain.
- epitope refers to any determinant capable of binding with high affinity to an immunoglobulin.
- An epitope is a region of an antigen that is bound by an antibody that specifically targets that antigen, and when the antigen is a protein, includes specific amino acids that directly contact the antibody. Most often, epitopes reside on proteins, but in some instances, may reside on other kinds of molecules, such as nucleic acids.
- Epitope determinants may include chemically active surface groupings of molecules such as amino acids, sugar side chains, phosphoryl or sulfonyl groups, and may have specific three dimensional structura 1 characteristics, and/or specific charge characteristics.
- antibodies specific for a particular target antigen will bind to an epitope on the target antigen in a complex mixture of proteins and/or macromolecules.
- Regions of a given polypeptide that include an epitope can be identified using any number of epitope mapping techniques, well known in the art. See, e.g., Epitope Mapping Protocols in Methods in Molecular Biology, Vol. 66 (Glenn E.Morris, Ed., 1996) Humana Press, Totowa, New Jersey.
- linear epitopes may be determined by e.g., concurrently synthesizing large numbers of peptides on solid supports, the peptides corresponding to portions of the protein molecule, and reacting the peptides with antibodies while the peptides are still attached to the supports.
- Such techniques are known in the art and described in, e.g., U.S. Patent No. 4,708,871 ; Geysen et al, (1984) Proc. Natl. Acad. Sci. USA 8:3998-4002; Geysen et al, (1985) Proc. Natl. Acad. Sci. USA 82:78-182; Geysen et al, (1986) Mol. Immunol.
- conformational epitopes are readily identified by determining spatial conformation of amino acids such as by, e.g., x-ray crystallography and two-dimensional nuclear magnetic resonance. See, e.g., Epitope Mapping Protocols, supra.
- Antigenic regions of proteins can also be identified using standard antigenicity and hydropathy plots, such as those calculated using, e.g., the Omiga version 1.0 software program available from the Oxford Molecular Group. This computer program employs the Hopp/Woods method, Hopp et al, (1981) Proc. Natl. Acad.
- the term "specific binding" between two entities means a binding with an equilibrium constant ( A ) ( kofr) of at least 10 2 M ⁇ ', at least 5xl0 2 M “ ', at least 10 3 M ⁇ ', at least 5xl0 3 M-', at least 10 4 M “ ', at least 5xl0 4 M “ ', at least at least ⁇ tfM l , at least 5xl0 6 M-', at least 10 7 M _1 , at least 5xl0 7 M " ', at least 10 8 M ', at least 5xl0 8 M " ', at least 10 9 M ⁇ ', at least 5xl0 9 M " ', at least 10 10 M “ ', at least 5xl0 10 M " ', at least lO ⁇ M '1 , at least 5xl0 l l M at least 10 12 M -1 , at least 5xl0 l2 M " ', at least 10 13 M ⁇
- LRP6 multivalent antibody e.g., a biparatopic antibody
- a binding reaction that is determinative of the presence of a cognate antigen (e.g. , a human LRP6) in a heterogeneous population of proteins and other biologies.
- an LRP6 multivalent antibody of the invention typically also has a dissociation rate constant (KD) of about (k 0 ff ko n ) of less than 5xl0 2 M, less than 10 "2 M, less than 5xlO *3 M, less than 10 "3 M, less than 5xl0 '4 M, less than 10 '4 M, less than 5xl0 "s M, less than 10 "5 M, less than 5xl0 "6 M, less than 10 '6 M, less than 5xl O '7 M, less than 10 "7 M, less than 5xl O '8 M, less than 10 "8 M, less than 5xlO ⁇ 9 M, less than 10 "9 M, less than 5xlO "10 M, less than 10 "10 M, less than 5xlO ⁇ n M, less than 10 "n M, less than 5xlO '12 M, less than 10 ⁇ 12 M, less than 5xlO '13 M, less
- the LRP6 multivalent antibody has dissociation constant (Kj) of less than 3000 pM, less than 2500 pM, less than 2000 pM, less than 1500 pM, less than 1000 pM, less than 750 pM, less than 500 pM, less than 250 pM, less than 200 pM, less than 150 pM, less than 100 pM, less than 75 pM, less than 10 pM, less than 1 pM as assessed using a method described herein or known to one of skill in the art (e.g., a BIAcore assay, ELISA, FACS, SET) (Biacore International AB, Uppsala, Sweden).
- Kj dissociation constant
- KD refers to the dissociation constant, which is obtained from the ratio of d to K a (i.e. K d Ka) and is expressed as a molar concentration (M). KD values for antibodies can be determined using methods well established in the art. A method for determining the KD of an antibody is by using surface plasmon resonance, or using a biosensor system such as a Biacore® system.
- affinity refers to the strength of interaction between antibody and antigen at single antigenic sites. Within each antigenic site, the variable region of the antibody “arm” interacts through weak non-covalent forces with antigen at numerous sites; the more interactions, the stronger the affinity.
- the term "avidity” as used herein refers to an informative measure of the overall stability or strength of the antibody-antigen complex. It is controlled by three major factors:
- Wnt 1 refers to Wntl , Wnt2, Wnt6, Wnt7a, Wnt7b, Wnt9a, WntlOa, or WntlOb
- Wnt 3a refers to Wnt3a and Wnt3.
- potentiate refers to a process whereby the Wnt signal is activated and enhanced upon conversion of a fragment of an antibody to a full length IgG LRP6 antibody in the presence of a Wnt ligand.
- no significant potentiation or “avoids potentiation” refers to a Wnt signal that is not activated or enhanced compared with an control antibody or fragment thereof that binds to the same epitope.
- No significant potentiation can be at least 10% less than control antibody or fragment thereof, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100% less than then control antibody or fragment thereof.
- cluster refers to any protein that gathers or groups together LRP6 receptors and potentiates Wnt signaling.
- proteins include, but are not limited to, Wntl ligands, Wnt3a ligands and Wnt3 ligands. These proteins can cause multimerization, e.g., dimerization of two endogenous LRP6 receptors. This dimerization may result in increased avidity due to increased interactions of LRP6, which in the presence of a Wnt ligand can potentiate a Wnt signal.
- conservatively modified variants refers to those nucleic acids which encode identical or essentially identical amino acid sequences, or where the nucleic acid does not encode an amino acid sequence, to essentially identical sequences. Because of the degeneracy of the genetic code, a large number of functionally identical nucleic acids encode any given protein. For instance, the codons GCA, GCC, GCG and GCU all encode the amino acid alanine. Thus, at every position where an alanine is specified by a codon, the codon can be altered to any of the corresponding codons described without altering the encoded polypeptide.
- nucleic acid variations are "silent variations," which are one species of conservatively modified variations. Every nucleic acid sequence herein which encodes a polypeptide also describes every possible silent variation of the nucleic acid.
- each codon in a nucleic acid except AUG, which is ordinarily the only codon for methionine, and TGG, which is ordinarily the only codon for tryptophan
- TGG which is ordinarily the only codon for tryptophan
- conservatively modified variants include individual substitutions, deletions or additions to a polypeptide sequence which result in the substitution of an amino acid with a chemically similar amino acid. Conservative substitution tables providing functionally similar amino acids are well known in the art. Such conservatively modified variants are in addition to and do not exclude polymorphic variants, interspecies homologs, and alleles of the invention.
- the following eight groups contain amino acids that are conservative substitutions for one another: 1) Alanine (A), Glycine (G); 2) Aspartic acid (D), Glutamic acid (E); 3) Asparagine (N), Glutamine (Q); 4) Arginine (R), Lysine ( ); 5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W); 7) Serine (S), Threonine (T); and 8) Cysteine (C), Methionine (M) (see, e.g., Creighton, Proteins (1984)).
- the term "conservative sequence modifications" are used to refer to amino acid modifications that do not significantly affect or alter the binding characteristics of the antibody containing the amino acid sequence.
- cross-block means the ability of the multivalent antibody, to interfere with the binding of other antibodies or binding agents to LRP6 in a standard competitive binding assay.
- the ability or extent to which an multivalent antibody is able to interfere with the binding of another antibody or binding molecule to LRP6, and therefore whether it can be said to cross-block according to the invention, can be determined using standard competition binding assays.
- One suitable assay involves the use of the Biacore technology (e.g. by using the BIAcore 3000 instrument (Biacore, Uppsala, Sweden)), which can measure the extent of interactions using surface plasmon resonance technology.
- Another assay for measuring cross-blocking uses an ELISA-based approach.
- the term "optimized” as used herein refers to a nucleotide sequence has been altered to encode an amino acid sequence using codons that are preferred in the production cell or organism, generally a eukaryotic cell, for example, a cell of Pichia, a cell of Trichoderma, a Chinese Hamster Ovary cell (CHO) or a human cell.
- the optimized nucleotide sequence is engineered to retain completely or as much as possible the amino acid sequence originally encoded by the starting nucleotide sequence, which is also known as the "parental" sequence.
- Standard assays to evaluate the binding ability of the multivalent antibodies toward LRP6 of various species are known in the art, including for example, ELI S As, western blots and RIAs.
- Suitable assays are described in detail in the Examples.
- the binding kinetics (e.g., binding affinity) of the multivalent antibodies also can be assessed by standard assays known in the art, such as by BiacoreTM analysis.
- Assays to evaluate the effects of the multivalent antibodies on functional properties of LRP6 e.g., receptor binding assays, modulating the Wnt pathway, or IgG production are described in further detail in the Examples.
- a multivalent antibody that "inhibits" one or more of these LRP6 functional properties will be understood to relate to a statistically significant decrease in the particular activity relative to that seen in the absence of the multivalent antibody (e.g., or when a control antibody of irrelevant specificity is present).
- a multivalent antibody that inhibits LRP6 activity effects such a statistically significant decrease by at least 10% of the measured parameter, by at least 50%, 80% or 90%, and in certain embodiments an antibody of the invention may inhibit greater than 95%, 98% or 99% of LRP6 functional activity.
- percent identical in the context of two or more nucleic acids or polypeptide sequences, refers to two or more sequences or subsequences that are the same.
- Two sequences are “substantially identical” if two sequences have a specified percentage of amino acid residues or nucleotides that are the same (i.e., 60% identity, optionally 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% over a specified region, or, when not specified, over the entire sequence), when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection.
- the identity exists over a region that is at least about 50 nucleotides (or 10 amino acids) in length, or more preferably over a region that is 100 to 500 or 1000 or more nucleotides (or 20, 50, 200 or more amino acids) in length.
- sequence comparison typically one sequence acts as a reference sequence, to which test sequences are compared.
- test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated.
- sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
- a “comparison window”, as used herein, includes reference to a segment of any one of the number of contiguous positions selected from the group consisting of from 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned.
- Methods of alignment of sequences for comparison are well known in the art.
- Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith and Waterman (1970) Adv. Appl. Math. 2:482c, by the homology alignment algorithm of Needleman and Wunsch (1970) J. Mol. Biol.
- BLAST and BLAST 2.0 algorithms Two examples of algorithms that are suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al, (1977) Nuc. Acids Res. 25:3389-3402; and Altschul et al, (1990) J. Mol. Biol. 215:403-410, respectively.
- Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information. This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighborhood word score threshold (Altschul et al, supra).
- initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them.
- the word hits are extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always > 0) and N (penalty score for mismatching residues; always ⁇ 0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached.
- the BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment.
- the BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., arlin and Altschul (1993) Proc. Natl. Acad. Sci. USA 90:5873- 5787).
- One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance.
- P(N) the smallest sum probability
- a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.2, more preferably less than about 0.01 , and most preferably less than about 0.001.
- the percent identity between two amino acid sequences can also be determined using the algorithm of E. Meyers and W. Miller (Comput. Appl. Biosci. 4:1 1- 17 (1988)) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
- the percent identity between two amino acid sequences can be determined using the Needleman and Wunsch (J. Mol, Biol.
- nucleic acid sequences or polypeptides are substantially identical is that the polypeptide encoded by the first nucleic acid is immunologically cross reactive with the antibodies raised against the polypeptide encoded by the second nucleic acid, as described below.
- a polypeptide is typically substantially identical to a second polypeptide, for example, where the two peptides differ only by conservative substitutions.
- Another indication that two nucleic acid sequences are substantially identical is that the two molecules or their complements hybridize to each other under stringent conditions, as described below.
- Yet another indication that two nucleic acid sequences are substantially identical is that the same primers can be used to amplify the sequence.
- nucleic acid is used herein interchangeably with the term
- polynucleotide and refers to deoxyribonucleotides or ribonucleotides and polymers thereof in either single- or double-stranded form.
- the term encompasses nucleic acids containing known nucleotide analogs or modified backbone residues or linkages, which are synthetic, naturally occurring, and non-naturally occurring, which have similar binding properties as the reference nucleic acid, and which are metabolized in a manner similar to the reference nucleotides.
- Examples of such analogs include, without limitation, phosphorothioates, phosphoramidates, methyl phosphonates, chiral-methyl phosphonates, 2-O-methyl ribonucleotides, peptide-nucleic acids (PNAs).
- degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et al, (1991) Nucleic Acid Res. 19:5081; Ohtsuka et al, (1985) J. Biol. Chem. 260:2605-2608; and Rossolini et al, (1994) Mol. Cell. Probes 8:91-98).
- operably linked refers to a functional relationship between two or more polynucleotide (e.g., DNA) segments. Typically, it refers to the functional relationship of a transcriptional regulatory sequence to a transcribed sequence.
- a promoter or enhancer sequence is operably linked to a coding sequence if it stimulates or modulates the transcription of the coding sequence in an appropriate host cell or other expression system.
- promoter transcriptional regulatory sequences that are operably linked to a transcribed sequence are physically contiguous to the transcribed sequence, i.e., they are cis-acting.
- some transcriptional regulatory sequences, such as enhancers need not be physically contiguous or located in close proximity to the coding sequences whose transcription they enhance.
- polypeptide and "protein” are used interchangeably herein to refer to a polymer of amino acid residues.
- the terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non- naturally occurring amino acid polymer. Unless otherwise indicated, a particular polypeptide sequence also implicitly encompasses conservatively modified variants thereof.
- subject includes human and non-human animals.
- Non-human animals include all vertebrates, e.g., mammals and non-mammals, such as non-human primates, sheep, dog, cow, chickens, amphibians, and reptiles. Except when noted, the terms “patient” or “subject” are used herein interchangeably.
- anti-cancer agent means any agent that can be used to treat a cell proliferative disorder such as cancer, including cytotoxic agents, chemotherapeutic agents,
- radiotherapy and radiotherapeutic agents targeted anti-cancer agents, and
- Tumor refers to neoplastic cell growth and proliferation, whether malignant or benign, and all pre-cancerous and cancerous cells and tissues.
- anti-tumor activity means a reduction in the rate of tumor cell proliferation, viability, or metastatic activity.
- a possible way of showing anti-tumor acitivey is show a decline in growth rate of abnormal cells that arises during therapy or tumor size stability or reduction. Such activity can be assessed using accepted in vitro or in vivo tumor models, including but not limited to xenograft models.
- malignancy refers to a non-benign tumor or a cancer.
- cancer includes a malignancy characterized by deregulated or uncontrolled cell growth. Exemplary cancers include: carcinomas, sarcomas, leukemias, and lymphomas.
- cancer includes primary malignant tumors (e.g., those whose cells have not migrated to sites in the subject's body other than the site of the original tumor) and secondary malignant tumors (e.g., those arising from metastasis, the migration of tumor cells to secondary sites that are different from the site of the original tumor).
- primary malignant tumors e.g., those whose cells have not migrated to sites in the subject's body other than the site of the original tumor
- secondary malignant tumors e.g., those arising from metastasis, the migration of tumor cells to secondary sites that are different from the site of the original tumor.
- the invention pertains to LRP6 multivalent antibodies and uses thereof. Inhibition of Wnt signaling by molecules directed to LRP6 lead to a loss of canonical Wnt signaling. Therefore, antagonism of LRP6 receptor function with a multivalent antibody will inhibit Wnt ligand signaling and aid in diseases associated with aberrant canonical Wnt signaling, e.g., cancer.
- the LRP6 multivalent antibodies can specifically increase or decrease signaling mediated by Wntl or Wnt3a class proteins in different disease settings.
- LRP6 antagonistic antibodies Two classes have been identified. One class of antibodies specifically inhibits Wnt proteins represented by Wntl, while the second class specifically inhibits Wnt proteins represented by Wnt3a. Epitope mapping experiments indicate that Wntl -specific and Wnt3a-specific LRP6 antibodies bind to the first ⁇ -propeller and the third ⁇ -propeller of LRP6 respectively, suggesting that Wntl and Wnt3a proteins bind to different ⁇ -propeller regions of LRP6 (See International Serial No. PCT EP2008/064821 filed October 31, 2008, the contents of which are incorporated herein by reference in their entirety).
- the Wnt signaling pathway is important in embryonic development and postnatal tissue maintenance. This is achieved by directing a specific set of genes that control temporal and spatial regulation of cell growth, movement and cell survival (reviewed in Barker and Clevers (2006) Nature Rev. 5:997). Proper regulation of this pathway is important for maintaining tissue homeostasis. Chronic activation of this pathway promotes uncontrolled cell growth and survival and can consequently drive the development of cell proliferative diseases, such as cancer. Alternatively, abnormal inhibition of this pathway can result in many disease states, for example loss of bone mass and other bone diseases.
- Wnt proteins initiate downstream signaling by interacting with a Frizzled receptor and one of two cell- surface receptors, which are members of the low-density-lipoprotein receptor (LDLR)- related proteins (LRPs): LRP5 and LRP6 (reviewed in He et A/., (2004) Development 31 : 1663-1677).
- LDLR low-density-lipoprotein receptor
- LRP6 activated Wnt/ ⁇ -catenin signaling (Tamai et ai, (2000) Nature 407:530-535). Furthermore, it has been shown that expression of either LRP6 or LRP5 is necessary for cells to respond to canonical Wnt signaling (reviewed in He et ai, supra, 2004).
- LRP5 and LRP6 are highly homologous and share 73% and 64% identity in their extra- and intracellular domains, respectively. They are widely co-expressed during
- the extracellular domains of LRP5 and LRP6 comprise three basic domains: 1) a YWTD (tyrosine, tryptophan, threonine, aspartic acid)-type ⁇ -propeller region, 2) an EGF (epidermal growth factor)-like domain, and 3) an LDLR type A (LA) domain.
- YWTD tyrosine, tryptophan, threonine, aspartic acid
- EGF epidermal growth factor-like domain
- LA LDLR type A
- the YWTD-type ⁇ -propeller region contains six YWTD repeats of 43-50 amino acid residues each and forms a six-bladed ⁇ -propeller structure.
- LRP5 and LRP6 there are four YWTD-type ⁇ -propeller regions that are each followed by an EGF- like domain, which comprises about 40 amino acid residues with conserved cysteine residues, which in turn are followed by three LA domains.
- EGF-like domain which comprises about 40 amino acid residues with conserved cysteine residues, which in turn are followed by three LA domains.
- the extracellular domain of LRP6 is defined by amino acid residues 1 to 1246 and contains four ⁇ -propeller domains at amino acid residues 43-324, 352-627, 654-929, and 957-1250, which correspond to ⁇ -propeller regions 1, 2, 3 and 4, respectively.
- Propeller domains 1-2 include amino acids 19-629, and Propeller domains 3-4 include amino acids 631-1246.
- LRP6 Antibodies are defined by amino acid residues 1 to 1246 and contains four ⁇ -propeller domains at amino acid residues 43-324, 352-627, 654-929, and 957-1250, which correspond to ⁇ -propeller regions 1, 2, 3 and 4, respectively.
- Propeller domains 1-2 include amino acids 19-629
- Propeller domains 3-4 include amino acids 631-1246.
- the present invention provides antibodies that specifically bind to LRP6 (e.g., human LRP6, cynomologus LRP6). In some embodiments, the present invention provides antibodies that specifically bind to both human and cynomologus LRP6.
- LRP6 e.g., human LRP6, cynomologus LRP6
- the present invention provides antibodies that specifically bind to both human and cynomologus LRP6.
- the Wnt proteins capable of activating ⁇ -catenin signaling can be divided into two classes and they require different ⁇ -propeller regions of LRP6 for signaling as described in International Serial No. PCT/EP2008/064821 filed October 31, 2008, the contents of which are incorporated herein by reference in their entirety.
- dimeric LRP6 antibodies e.g., IgG
- Wnt signaling for example through dimerization of endogenous LRP6.
- the antibodies potentiate a Wnt signal with the proviso that potentiation does not occur with biparatopic antibodies of the invention.
- the Wnt signal is activated and enhanced upon conversion of a fragment of an antibody to a full length IgG LRP6 antibody in the presence of a Wnt ligand.
- a Wnt 1 Fab binds to the ⁇ -propeller 1 domain of the LRP6 receptor and blocks the Wnt 1 pathway in absence of a Wnt ligand, e.g., Wnt 3.
- the Wnt 1 Fab blocks signaling through the Wnt 1 pathway, but signal activation may occur through the Wnt 3 pathway, thereby producing a signal.
- the Wnt 1 Fab is converted to a full length Wnt 1 IgG, the Wnt 1 IgG binds to the ⁇ -propeller 1 domains of two LRP6 receptors and blocks the Wnt 1 pathway, however, in the presence of a Wnt ligand, e.g., Wnt 3; signal activation occurs through the Wnt 3 pathway and is also enhanced.
- the IgG clusters together two or more LRP6 receptors by binding to the ⁇ -propeller 1 domains of each LRP6 receptor, which in the presence of a Wnt 3 ligand results in a stronger signal through the Wnt 3 pathway. Dimerization of the LRP6 receptors promotes Wnt signaling, perhaps through the increases avidity of the various interactions involving LRP6.
- the reverse results are obtained with a Wnt 3 Fab that binds to the ⁇ -propeller 3 domain of the LRP6 receptor and blocks the Wnt 3 pathway.
- the Wnt 3 Fab blocks the Wnt 3 pathway, but activates the Wnt 1 pathway to generate a signal.
- the Wnt 3 Fab is converted to a full length Wnt 3 IgG, the Wnt 3 IgG binds to the ⁇ -propeller 3 regions of two LRP6 receptors, and in the presence of a Wnt 1 ligand, inhibits signaling through the Wnt 1 pathway.
- the antibodies avoid potentiating a Wnt signal.
- the present invention provides antibodies that specifically bind to both human and cynomologus LRP6.
- the LRP6 antibodies are antagonistic antibodies.
- the LRP6 antibodies are agonistic antibodies.
- LRP6 As different Wnt proteins require different ⁇ -propellers domains of LRP6 for signaling, and as clustering or dimerization of LRP6 potentiates Wnt signaling, therapy using the LRP6 antibodies can be regulated and "fine tuned" by using different combinations of antibodies.
- the LRP6 antibodies are used as monomeric antibodies or fragments thereof such as single chain antibodies, unibodies, and the like.
- a monomeric LRP6 antibody that binds to the ⁇ -propeller 1 region of LRP6 is used in combination with a monomeric LRP6 antibody that binds to the ⁇ -propeller 3 region of LRP6.
- the LRP6 antibodies are used as multimeric antibodies or fragments thereof such as bispecific, biparatopic LRP6 antibodies.
- Propeller 1 antibodies are expected to inhibit the interaction with other Propeller 1 binding ligands (e.g. Sclerostin, Dkkl).
- Propeller 3 antibodies are expected to inhibit the interaction with other propeller 3 binding ligands (e.g. Dkkl).
- propeller 1 and 3 binding antibodies may be expected to affect the activity of other Wnt signaling modulators e.g. R-spondins
- the present invention also provides antibodies that specifically bind to a LRP6 protein (e.g., human and/or cynomologus LRP6), the antibodies comprising a VH CDR having an amino acid sequence of any one of the VH CDRs listed in Table 1, infra.
- a LRP6 protein e.g., human and/or cynomologus LRP6
- the invention provides antibodies that specifically bind to a LRP6 protein (e.g., human and/or cynomologus LRP6), the antibodies comprising (or alternatively, consisting of) one, two, three, four, five or more VH CDRs having an amino acid sequence of any of the VH CDRs listed in Table 1, infra.
- the present invention provides antibodies that specifically bind a LRP6 protein (e.g., human and/or cynomologus LRP6), the antibodies comprising a VH domain having an amino acid sequence of SEQ ID NOs: 14, 34, 36, 44, 60 and 62.
- the present invention provides antibodies that specifically bind to a LRP6 protein (e.g., human and/or cynomologus LRP6), the antibodies comprising a VL domain having an amino acid sequence of SEQ ID NOs: 13, 33, 35, 43, 59, and 61.
- the present invention provides antibodies that specifically bind a LRP6 protein (e.g., human and/or cynomologus LRP6), the antibodies comprising a VH domain having an amino acid sequence of SEQ ID NOs: 82, 89, 106, 108, 128, 130, and 138.
- the present invention provides antibodies that specifically bind to a LRP6 protein (e.g., human and/or cynomologus LRP6), the antibodies comprising a VL domain having an amino acid sequence of SEQ ID NOs: 81, 90, 105, 107, 127, and 129.
- antibodies of the invention include amino acids that have been mutated, yet have at least 60%, 70%, 80%, 90%, 95% or 98% identity in the CDR regions with the CDR regions depicted in the sequences described in Table 1. In some embodiments, it includes mutant amino acid sequences wherein no more than 1, 2, 3, 4 or 5 amino acids have been mutated in the CDR regions when compared with the CDR regions depicted in the sequence described in Table 1, while still maintaining their specif! ty for the the orignal antibody's epitope .
- antibodies of the invention include amino acids that have been mutated, yet have at least 60%, 70%, 80%, 90%, 95% or 98% identity in the framework regions with the framework regions depicted in the sequences described in Table 1.
- mutant amino acid sequences wherein no more than 1, 2, 3, 4, 5, 6, or 7 amino acids have been mutated in the f amework regions when compared with the framework regions depicted in the sequence described Table 1, while still maintaining their specifity for the the orignal antibody's epitope
- the present invention also provides nucleic acid sequences that encode VH, VL, the full length heavy chain, and the full length light chain of the antibodies that specifically bind to a LRP6 protein (e.g., human and/or cynomologus LRP6).
- LRP6 protein e.g., human and/or cynomologus LRP6
- Such nucleic acid sequences can be optimized for expression in mammalian cells (for example, Table 1 for
- the LRP6 antibodies of the invention bind to distinct LRP6 ⁇ -propeller regions.
- Propeller 1 antibodies bind to the ⁇ -propeller 1 domain and block Propeller 1 -dependent Wnts such as Wntl , Wnt2, Wnt6, Wnt7A, Wnt7B, Wnt9, Wntl OA, Wntl OB.
- Propeller 3 antibodies bind to the ⁇ -propeller 3 domain and block Propeller 3-dependent Wnts such as Wnt3a and Wnt3.
- SEQ ID NO: 19 DNA GATATCGAACTGACCCAGCCGCCTTCAGTGAGCGTTGCACCAGGTCAGACCGCGCGTATCTCGTGTAGCGGC
- LA LA NTLYLQMNSLRAEDTAVYYCARGSHG NIMAKRYFDFWGQGTLVTV55ASTKGPSVFPLAPSS STSGGTAALGCL
- IgGl LA LA CTCXGGATTTACCTTRTCTGATTATGCTATTCATTGGGTGCGCCAAGCCCCTGGGAAGGGTCTCGAGTGGGTG
- SEQ ID NO:83 DNA VL GATATCGTGCTGACCCAGAGCCCGGCGACCCTGAGCCTGTCTCCGGGCGAACGTGCGACCCTGAGCTGCAGA
- SEQ ID NO:88 DNA CAGGTGCAATTGAAAGAAAGCGGCCCGGCCCTGGTGAAACCGACCCAAACCCTGACCCTGACCTGTACCTTTT
- SEQID NO:92 DNA L GAAATCGTGCTGACCCAGAGCCCCGCWCCCTGTCTCTGAGCCCTGGCGAGAGAGCCACCCTGAGCTGCCGG
- SEQ ID NO: 109 DNA VL GATATCGTGCTGACCCAGAGCCCGGCGACCCTGAGCCTGTCTCCGGGCGAACGTGCGACCCTGAGCTGCAGA
- SEQ ID NO:141 DNA VL- Gatatcgttctgacccagagtccggcaaccctgagc-tgagtccgegtgaacgtgccaccctgagctgtcgtgcaagccagtttattggtagccg
- GFSLSNRGGGVGWIRQPPG ALEWLAWIDWDDD SYSTSLKTRLTISKDTSKNQWLTMTNMDPVDTATYYCAR MH LPLVFDSWGQGTLVTVSS
- SEQ ID NO:147 DNA VH- Caggttcaattgaaagaaagcggtccggcactggttaaaccgacccagaccctgaccctgacatgtacctttagcggttttagcctgagcaatc
- SEQ ID NO: 161 DNA VH- Caggtttaattggttgaaagcegtggtggt tggttcagcctggtggtagcctgcgtctgagttgtgcagcaagcggttttacctttagcgttaat
- VL seFv S NTLYLQMNSLRAEDTAVYYCARYDYIKYGAFDPWGQGTLVTVSSGGGGSGGGGSGGGGSDIELTQPPSVSVA
- SEQ NO: 163 DNA VH- Caggttcaattggttgaaagcggtggtggtctggttcagcttggtggtagcctgcgtctgagtt ⁇
- NKATLVCLiSDFYPGAVWAWKADSSPVKAGVETTTPS (3 ⁇ 4NN YAASSYLSLTPE WKSHRSYSC VTHEGS VE
- SEQ ID NO:178 DNA Light GATATCGTGCTGACACAGAGCCCTGCCACCCTGTCTCTGAGCCCTGGCGAGAGAGCCACCCTGAGCTGCCGG
- SEQ ID NO:192 DNA L GACATCGAGCTGACTCAGCCCCCTAGCGTGTCAGTGGCTCCTGGCCAGACCGCTAGAATTAGCTGTAGCGGC
- TLTLTCTF5GFSLSNRGGGVGWIRQPPG ALEWLAWIDWDDD SYSTSL TRLTIS DTS NQ LT TN DPV DTATYYCARMHLPLVFDSWGQGTLVTVSS
- SEQ ID NO: 205 Light lambda SYELTQPLSVSVALGQTARITCSGDSLRNKVYWYQQKPGQAPVLVIYKNNRPSGIPERFSGSNSGNTATLTISRAQA
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Immunology (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Microbiology (AREA)
- Epidemiology (AREA)
- Mycology (AREA)
- Endocrinology (AREA)
- Urology & Nephrology (AREA)
- Physical Education & Sports Medicine (AREA)
- Oncology (AREA)
- Reproductive Health (AREA)
- Dermatology (AREA)
- Hematology (AREA)
- Pulmonology (AREA)
- Gastroenterology & Hepatology (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Neurology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (16)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU2011249782A AU2011249782B2 (en) | 2010-05-06 | 2011-05-05 | Compositions and methods of use for therapeutic low density lipoprotein - related protein 6 (LRP6) multivalent antibodies |
| BR112012028326A BR112012028326A2 (pt) | 2010-05-06 | 2011-05-05 | anticorpo multivalente isolado, anticorpos biparatópicos isolados, ácido nucleico, vetor, composição farmacêutica, método de obtenção dos referidos anticorpos, bem como uso do dos mesmos |
| KR1020127031869A KR20130066631A (ko) | 2010-05-06 | 2011-05-05 | 치료적 저밀도 지단백질-관련 단백질 6 (lrp6) 다가 항체에 대한 조성물 및 사용 방법 |
| CN2011800332694A CN103237811A (zh) | 2010-05-06 | 2011-05-05 | 用于治疗性低密度脂蛋白相关蛋白质6(lrp6)多价抗体的组合物及使用方法 |
| CA2798390A CA2798390A1 (en) | 2010-05-06 | 2011-05-05 | Compositions and methods of use for therapeutic low density lipoprotein - related protein 6 (lrp6) multivalent antibodies |
| US13/696,372 US9290573B2 (en) | 2010-05-06 | 2011-05-05 | Therapeutic low density lipoprotein-related protein 6 (LRP6) multivalent antibodies |
| EA201291181A EA201291181A1 (ru) | 2010-05-06 | 2011-05-05 | Композиции и способы применения терапевтических поливалентных антител против белка, родственного рецептору липопротеинов низкой плотности 6 (lrp6) |
| MX2012012927A MX2012012927A (es) | 2010-05-06 | 2011-05-05 | Composiciones y metodos de uso para anticuerpos multivalentes terapeuticos de proteina relacionada con lipoproteina de baja densidad 6 (lrp6). |
| MA35418A MA34287B1 (fr) | 2010-05-06 | 2011-05-05 | Compositions et méthodes d'utilisation d'anticorps multivalents thérapeutiques de faible densité de la protéine apparentée à la lipoprotéine 6 (lrp6) |
| PH1/2012/502193A PH12012502193A1 (en) | 2010-05-06 | 2011-05-05 | Compositions and methods of use for therapeutic low density lipoprotein - related protein 6 (lrp6) multivalent antibodies |
| SG2012081170A SG185415A1 (en) | 2010-05-06 | 2011-05-05 | Compositions and methods of use for therapeutic low density lipoprotein - related protein 6 (lrp6) multivalent antibodies |
| EP11723308A EP2566894A1 (en) | 2010-05-06 | 2011-05-05 | Compositions and methods of use for therapeutic low density lipoprotein - related protein 6 (lrp6) multivalent antibodies |
| JP2013508500A JP2013527761A (ja) | 2010-05-06 | 2011-05-05 | 治療的低密度リポタンパク質関連タンパク質6(lrp6)多価抗体の組成物および使用方法 |
| ZA2012/08050A ZA201208050B (en) | 2010-05-06 | 2012-10-24 | Compositions and methods of use for therapeutic low density lipoprotein-related protein 6 (lrp6) multivalent antibodies |
| TNP2012000512A TN2012000512A1 (en) | 2010-05-06 | 2012-10-25 | Compositions and methods of use for therapeutic low density lipoprotein - related protein 6 (lrp6) multivalent antibodies |
| IL222814A IL222814A0 (en) | 2010-05-06 | 2012-11-01 | Compositions and methods of use for therapeutic low density lipoprotein-related protein 6 (lrp6) multivalent antibodies |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US33199310P | 2010-05-06 | 2010-05-06 | |
| US61/331,993 | 2010-05-06 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2011138391A1 true WO2011138391A1 (en) | 2011-11-10 |
Family
ID=44247029
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2011/057200 Ceased WO2011138391A1 (en) | 2010-05-06 | 2011-05-05 | Compositions and methods of use for therapeutic low density lipoprotein - related protein 6 (lrp6) multivalent antibodies |
Country Status (21)
| Country | Link |
|---|---|
| US (1) | US9290573B2 (https=) |
| EP (1) | EP2566894A1 (https=) |
| JP (4) | JP2013527761A (https=) |
| KR (1) | KR20130066631A (https=) |
| CN (1) | CN103237811A (https=) |
| AU (1) | AU2011249782B2 (https=) |
| BR (1) | BR112012028326A2 (https=) |
| CA (1) | CA2798390A1 (https=) |
| CL (2) | CL2012003093A1 (https=) |
| CO (1) | CO6630180A2 (https=) |
| EA (1) | EA201291181A1 (https=) |
| GT (1) | GT201200298A (https=) |
| IL (1) | IL222814A0 (https=) |
| MA (1) | MA34287B1 (https=) |
| MX (1) | MX2012012927A (https=) |
| PE (1) | PE20130206A1 (https=) |
| PH (1) | PH12012502193A1 (https=) |
| SG (1) | SG185415A1 (https=) |
| TN (1) | TN2012000512A1 (https=) |
| WO (1) | WO2011138391A1 (https=) |
| ZA (1) | ZA201208050B (https=) |
Cited By (17)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2013067355A1 (en) * | 2011-11-04 | 2013-05-10 | Novartis Ag | Low density lipoprotein-related protein 6 (lrp6) - half life extender constructs |
| WO2014029752A1 (en) * | 2012-08-22 | 2014-02-27 | Glaxo Group Limited | Anti lrp6 antibodies |
| US8846041B2 (en) | 2010-03-24 | 2014-09-30 | Genentech, Inc. | Anti-LRP6 antibodies |
| EP2655415A4 (en) * | 2010-12-22 | 2016-03-09 | Abbvie Inc | THREE VARIABLE DOMAIN LINK PROTEINS AND USES THEREOF |
| US9290573B2 (en) | 2010-05-06 | 2016-03-22 | Novartis Ag | Therapeutic low density lipoprotein-related protein 6 (LRP6) multivalent antibodies |
| US9428583B2 (en) | 2010-05-06 | 2016-08-30 | Novartis Ag | Compositions and methods of use for therapeutic low density lipoprotein-related protein 6 (LRP6) multivalent antibodies |
| WO2017093478A1 (en) * | 2015-12-04 | 2017-06-08 | Boehringer Ingelheim International Gmbh | Biparatopic polypeptides antagonizing wnt signaling in tumor cells |
| EP2567709B1 (en) | 2007-11-02 | 2017-12-27 | Novartis AG | Molecules and methods for modulating low-density-lipoprotein receptor-related protein 6 (LRP6) |
| WO2018220080A1 (en) | 2017-05-31 | 2018-12-06 | Boehringer Ingelheim International Gmbh | Polypeptides antagonizing wnt signaling in tumor cells |
| US10202451B2 (en) | 2010-10-04 | 2019-02-12 | Boehringer Ingelheim International Gmbh | CD33 binding agents |
| WO2020080941A1 (en) * | 2018-10-16 | 2020-04-23 | Umc Utrecht Holding B.V. | Anti- low-density lipoprotein receptor-related protein 5/6 antibodies |
| EP3541423A4 (en) * | 2016-11-18 | 2020-10-07 | The Regents of The University of California | MODIFIED ANTIBODIES AND THEIR USES |
| WO2020200998A1 (en) * | 2019-03-29 | 2020-10-08 | Boehringer Ingelheim International Gmbh | Anticancer combination therapy |
| US11345760B2 (en) | 2014-06-25 | 2022-05-31 | UCB Biopharma SRL | Multispecific antibody constructs |
| EP3911682A4 (en) * | 2019-01-14 | 2023-03-15 | The Regents of the University of California | COMPOSITIONS AND METHODS TO MODULATE CELLULAR INTERNALIZATION |
| US12297278B2 (en) | 2017-12-19 | 2025-05-13 | Surrozen Operating, Inc. | Wnt surrogate molecules and uses thereof |
| US12559542B2 (en) | 2012-07-26 | 2026-02-24 | Momenta Pharmaceuticals, Inc. | Glycoproteins with anti-inflammatory properties |
Families Citing this family (21)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CA2952315A1 (en) | 2014-07-11 | 2016-01-14 | Genentech, Inc. | Notch pathway inhibition |
| US11142577B2 (en) | 2014-09-12 | 2021-10-12 | The Board Of Trustees Of The Leland Stanford Junior University | WNT signaling agonist molecules |
| US11566082B2 (en) | 2014-11-17 | 2023-01-31 | Cytiva Bioprocess R&D Ab | Mutated immunoglobulin-binding polypeptides |
| CN105349495B (zh) * | 2015-11-17 | 2019-02-22 | 清华大学 | 抗凝血因子ix单克隆抗体的杂交瘤细胞株 |
| US10654887B2 (en) | 2016-05-11 | 2020-05-19 | Ge Healthcare Bio-Process R&D Ab | Separation matrix |
| JP6987424B2 (ja) | 2016-05-11 | 2022-01-05 | サイティバ・バイオプロセス・アールアンドディ・アクチボラグ | 分離マトリックスを洗浄および/または消毒する方法 |
| CN109071613A (zh) | 2016-05-11 | 2018-12-21 | 通用电气医疗集团生物工艺研发股份公司 | 分离基质 |
| US10730908B2 (en) | 2016-05-11 | 2020-08-04 | Ge Healthcare Bioprocess R&D Ab | Separation method |
| US11708390B2 (en) | 2016-05-11 | 2023-07-25 | Cytiva Bioprocess R&D Ab | Method of storing a separation matrix |
| JP7031934B2 (ja) | 2016-05-11 | 2022-03-08 | サイティバ・バイオプロセス・アールアンドディ・アクチボラグ | 分離マトリックス |
| US10889615B2 (en) | 2016-05-11 | 2021-01-12 | Cytiva Bioprocess R&D Ab | Mutated immunoglobulin-binding polypeptides |
| US10703774B2 (en) | 2016-09-30 | 2020-07-07 | Ge Healthcare Bioprocess R&D Ab | Separation method |
| US12448411B2 (en) | 2016-09-30 | 2025-10-21 | Cytiva Bioprocess R&D Ab | Separation method |
| CN111655729B (zh) | 2017-12-19 | 2023-10-20 | 瑟罗泽恩奥普瑞汀公司 | 抗卷曲蛋白抗体和使用方法 |
| CN111699003B (zh) * | 2017-12-19 | 2024-05-03 | 瑟罗泽恩奥普瑞汀公司 | 抗lrp5/6抗体和使用方法 |
| IL277095B2 (en) * | 2018-03-07 | 2025-10-01 | Pfizer | Preparations containing anti-PD-1 antibody |
| KR102504884B1 (ko) * | 2019-07-23 | 2023-02-28 | 와이-클론 메디컬 사이언시스 컴퍼니 리미티드 | Sftsv에 결합 가능한 나노 항체 및 이의 응용 |
| AU2020331424A1 (en) * | 2019-08-14 | 2022-03-31 | Antlera Therapeutics Inc. | Antibodies that bind to LRP6 proteins and methods of use |
| BR112022023377A2 (pt) * | 2020-05-19 | 2022-12-20 | Momenta Pharmaceuticals Inc | Preparação e purificação de igg hipersialilada |
| CA3232234A1 (en) * | 2021-09-20 | 2023-03-23 | The Regents Of The University Of California | Novel wnt agonist antibodies and therapeutic uses thereof |
| CN115124618B (zh) * | 2022-06-24 | 2023-04-18 | 复星凯特生物科技有限公司 | 一种自体血液分离的免疫细胞在治疗疾病中的应用 |
Citations (138)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US2207308A (en) | 1940-07-09 | Electrolytic manufacture | ||
| US4458066A (en) | 1980-02-29 | 1984-07-03 | University Patents, Inc. | Process for preparing polynucleotides |
| US4522811A (en) | 1982-07-08 | 1985-06-11 | Syntex (U.S.A.) Inc. | Serial injection of muramyldipeptides and liposomes enhances the anti-infective activity of muramyldipeptides |
| US4526938A (en) | 1982-04-22 | 1985-07-02 | Imperial Chemical Industries Plc | Continuous release formulations |
| EP0154316A2 (en) | 1984-03-06 | 1985-09-11 | Takeda Chemical Industries, Ltd. | Chemically modified lymphokine and production thereof |
| US4708871A (en) | 1983-03-08 | 1987-11-24 | Commonwealth Serum Laboratories Commission | Antigenically active amino acid sequences |
| EP0307434A1 (en) | 1987-03-18 | 1989-03-22 | Medical Res Council | CHANGED ANTIBODIES. |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US4881175A (en) | 1986-09-02 | 1989-11-14 | Genex Corporation | Computer based system and method for determining and displaying possible chemical structures for converting double- or multiple-chain polypeptides to single-chain polypeptides |
| US4880078A (en) | 1987-06-29 | 1989-11-14 | Honda Giken Kogyo Kabushiki Kaisha | Exhaust muffler |
| EP0367166A1 (en) | 1988-10-31 | 1990-05-09 | Takeda Chemical Industries, Ltd. | Modified interleukin-2 and production thereof |
| EP0368684A1 (en) | 1988-11-11 | 1990-05-16 | Medical Research Council | Cloning immunoglobulin variable domain sequences. |
| EP0401384A1 (en) | 1988-12-22 | 1990-12-12 | Kirin-Amgen, Inc. | Chemically modified granulocyte colony stimulating factor |
| EP0413622A1 (en) | 1989-08-03 | 1991-02-20 | Rhone-Poulenc Sante | Albumin derivatives with therapeutic functions |
| WO1991005548A1 (en) | 1989-10-10 | 1991-05-02 | Pitman-Moore, Inc. | Sustained release composition for macromolecular proteins |
| US5013653A (en) | 1987-03-20 | 1991-05-07 | Creative Biomolecules, Inc. | Product and process for introduction of a hinge region into a fusion protein to facilitate cleavage |
| WO1991006570A1 (en) | 1989-10-25 | 1991-05-16 | The University Of Melbourne | HYBRID Fc RECEPTOR MOLECULES |
| US5091513A (en) | 1987-05-21 | 1992-02-25 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
| WO1992003918A1 (en) | 1990-08-29 | 1992-03-19 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5112946A (en) | 1989-07-06 | 1992-05-12 | Repligen Corporation | Modified pf4 compositions and methods of use |
| US5128326A (en) | 1984-12-06 | 1992-07-07 | Biomatrix, Inc. | Drug delivery systems based on hyaluronans derivatives thereof and their salts and methods of producing same |
| US5132405A (en) | 1987-05-21 | 1992-07-21 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
| WO1992019244A2 (en) | 1991-05-01 | 1992-11-12 | Henry M. Jackson Foundation For The Advancement Of Military Medicine | A method for treating infectious respiratory diseases |
| WO1993012227A1 (en) | 1991-12-17 | 1993-06-24 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| WO1993015200A1 (fr) | 1992-01-31 | 1993-08-05 | Rhone-Poulenc Rorer S.A. | Polypeptides antithrombotiques, antagonistes de la liaison du vwf aux plaquettes et/ou au sous-endothelium |
| WO1993015199A1 (fr) | 1992-01-31 | 1993-08-05 | Rhone-Poulenc Rorer S.A. | Nouveaux polypeptides biologiquement actifs, leur preparation et composition pharmaceutique les contenant |
| US5258498A (en) | 1987-05-21 | 1993-11-02 | Creative Biomolecules, Inc. | Polypeptide linkers for production of biosynthetic proteins |
| US5260203A (en) | 1986-09-02 | 1993-11-09 | Enzon, Inc. | Single polypeptide chain binding molecules |
| WO1994004678A1 (en) | 1992-08-21 | 1994-03-03 | Casterman Cecile | Immunoglobulins devoid of light chains |
| US5336603A (en) | 1987-10-02 | 1994-08-09 | Genentech, Inc. | CD4 adheson variants |
| US5349053A (en) | 1990-06-01 | 1994-09-20 | Protein Design Labs, Inc. | Chimeric ligand/immunoglobulin molecules and their uses |
| EP0616640A1 (en) | 1991-12-02 | 1994-09-28 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US5359046A (en) | 1990-12-14 | 1994-10-25 | Cell Genesys, Inc. | Chimeric chains for receptor-associated signal transduction pathways |
| WO1994025585A1 (en) | 1993-04-26 | 1994-11-10 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5374548A (en) | 1986-05-02 | 1994-12-20 | Genentech, Inc. | Methods and compositions for the attachment of proteins to liposomes using a glycophospholipid anchor |
| WO1994029351A2 (en) | 1993-06-16 | 1994-12-22 | Celltech Limited | Antibodies |
| US5399331A (en) | 1985-06-26 | 1995-03-21 | The Liposome Company, Inc. | Method for protein-liposome coupling |
| US5416016A (en) | 1989-04-03 | 1995-05-16 | Purdue Research Foundation | Method for enhancing transmembrane transport of exogenous molecules |
| US5427908A (en) | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
| US5447851A (en) | 1992-04-02 | 1995-09-05 | Board Of Regents, The University Of Texas System | DNA encoding a chimeric polypeptide comprising the extracellular domain of TNF receptor fused to IgG, vectors, and host cells |
| US5476996A (en) | 1988-06-14 | 1995-12-19 | Lidak Pharmaceuticals | Human immune system in non-human animal |
| US5476786A (en) | 1987-05-21 | 1995-12-19 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
| WO1996004388A1 (en) | 1994-07-29 | 1996-02-15 | Smithkline Beecham Plc | Novel compounds |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| WO1996020698A2 (en) | 1995-01-05 | 1996-07-11 | The Board Of Regents Acting For And On Behalf Of The University Of Michigan | Surface-modified nanoparticles and method of making and using same |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5545807A (en) | 1988-10-12 | 1996-08-13 | The Babraham Institute | Production of antibodies from transgenic animals |
| US5605793A (en) | 1994-02-17 | 1997-02-25 | Affymax Technologies N.V. | Methods for in vitro recombination |
| WO1997013852A1 (en) | 1995-10-10 | 1997-04-17 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5622929A (en) | 1992-01-23 | 1997-04-22 | Bristol-Myers Squibb Company | Thioether conjugates |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5641870A (en) | 1995-04-20 | 1997-06-24 | Genentech, Inc. | Low pH hydrophobic interaction chromatography for antibody purification |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| WO1997032572A2 (en) | 1996-03-04 | 1997-09-12 | The Penn State Research Foundation | Materials and methods for enhancing cellular internalization |
| WO1997034631A1 (en) | 1996-03-18 | 1997-09-25 | Board Of Regents, The University Of Texas System | Immunoglobin-like domains with increased half lives |
| US5677425A (en) | 1987-09-04 | 1997-10-14 | Celltech Therapeutics Limited | Recombinant antibody |
| US5679377A (en) | 1989-11-06 | 1997-10-21 | Alkermes Controlled Therapeutics, Inc. | Protein microspheres and methods of using them |
| WO1997044013A1 (en) | 1996-05-24 | 1997-11-27 | Massachusetts Institute Of Technology | Aerodynamically light particles for pulmonary drug delivery |
| US5714350A (en) | 1992-03-09 | 1998-02-03 | Protein Design Labs, Inc. | Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region |
| WO1998023289A1 (en) | 1996-11-27 | 1998-06-04 | The General Hospital Corporation | MODULATION OF IgG BINDING TO FcRn |
| WO1998024884A1 (en) | 1996-12-02 | 1998-06-11 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies |
| WO1998031346A1 (en) | 1997-01-16 | 1998-07-23 | Massachusetts Institute Of Technology | Preparation of particles for inhalation |
| US5789650A (en) | 1990-08-29 | 1998-08-04 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5814318A (en) | 1990-08-29 | 1998-09-29 | Genpharm International Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5831012A (en) | 1994-01-14 | 1998-11-03 | Pharmacia & Upjohn Aktiebolag | Bacterial receptor structures |
| US5834252A (en) | 1995-04-18 | 1998-11-10 | Glaxo Group Limited | End-complementary polymerase reaction |
| US5837458A (en) | 1994-02-17 | 1998-11-17 | Maxygen, Inc. | Methods and compositions for cellular and metabolic engineering |
| US5855913A (en) | 1997-01-16 | 1999-01-05 | Massachusetts Instite Of Technology | Particles incorporating surfactants for pulmonary drug delivery |
| US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US5874299A (en) | 1990-08-29 | 1999-02-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5877397A (en) | 1990-08-29 | 1999-03-02 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5885793A (en) | 1991-12-02 | 1999-03-23 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| WO1999015154A1 (en) | 1997-09-24 | 1999-04-01 | Alkermes Controlled Therapeutics, Inc. | Methods for fabricating polymer-based controlled release preparations |
| WO1999016873A1 (de) | 1997-09-26 | 1999-04-08 | Arne Skerra | Anticaline |
| WO1999020253A1 (en) | 1997-10-23 | 1999-04-29 | Bioglan Therapeutics Ab | Encapsulation method |
| US5912015A (en) | 1992-03-12 | 1999-06-15 | Alkermes Controlled Therapeutics, Inc. | Modulated release from biocompatible polymers |
| US5916597A (en) | 1995-08-31 | 1999-06-29 | Alkermes Controlled Therapeutics, Inc. | Composition and method using solid-phase particles for sustained in vivo release of a biologically active agent |
| US5934272A (en) | 1993-01-29 | 1999-08-10 | Aradigm Corporation | Device and method of creating aerosolized mist of respiratory drug |
| US5939598A (en) | 1990-01-12 | 1999-08-17 | Abgenix, Inc. | Method of making transgenic mice lacking endogenous heavy chains |
| WO1999045962A1 (en) | 1998-03-13 | 1999-09-16 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5969108A (en) | 1990-07-10 | 1999-10-19 | Medical Research Council | Methods for producing members of specific binding pairs |
| WO1999054342A1 (en) | 1998-04-20 | 1999-10-28 | Pablo Umana | Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity |
| US5985309A (en) | 1996-05-24 | 1999-11-16 | Massachusetts Institute Of Technology | Preparation of particles for inhalation |
| WO1999066903A2 (en) | 1998-06-24 | 1999-12-29 | Advanced Inhalation Research, Inc. | Large porous particles emitted from an inhaler |
| US6019968A (en) | 1995-04-14 | 2000-02-01 | Inhale Therapeutic Systems, Inc. | Dispersible antibody compositions and methods for their preparation and use |
| US6075181A (en) | 1990-01-12 | 2000-06-13 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| WO2000042072A2 (en) | 1999-01-15 | 2000-07-20 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US6121022A (en) | 1995-04-14 | 2000-09-19 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US6150584A (en) | 1990-01-12 | 2000-11-21 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US6162963A (en) | 1990-01-12 | 2000-12-19 | Abgenix, Inc. | Generation of Xenogenetic antibodies |
| US6172197B1 (en) | 1991-07-10 | 2001-01-09 | Medical Research Council | Methods for producing members of specific binding pairs |
| WO2001004144A2 (de) | 1999-07-13 | 2001-01-18 | Scil Proteins Gmbh | Design von beta-faltblatt-proteinen mit spezifischen bindungseigenschaften |
| WO2001005950A2 (en) | 1999-07-20 | 2001-01-25 | Morphosys Ag | Methods for displaying (poly)peptides/proteins on bacteriophage particles via disulfide bonds |
| US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
| WO2001014424A2 (en) | 1999-08-24 | 2001-03-01 | Medarex, Inc. | Human ctla-4 antibodies and their uses |
| US6277375B1 (en) | 1997-03-03 | 2001-08-21 | Board Of Regents, The University Of Texas System | Immunoglobulin-like domains with increased half-lives |
| US6291158B1 (en) | 1989-05-16 | 2001-09-18 | Scripps Research Institute | Method for tapping the immunological repertoire |
| WO2001077137A1 (en) | 2000-04-12 | 2001-10-18 | Human Genome Sciences, Inc. | Albumin fusion proteins |
| US6316024B1 (en) | 1996-10-11 | 2001-11-13 | Sequus Pharmaceuticals, Inc. | Therapeutic liposome composition and method of preparation |
| EP1176195A1 (en) | 1999-04-09 | 2002-01-30 | Kyowa Hakko Kogyo Co., Ltd. | Method for controlling the activity of immunologically functional molecule |
| US6350466B1 (en) | 1994-08-05 | 2002-02-26 | Targesome, Inc. | Targeted polymerized liposome diagnostic and treatment agents |
| WO2002043478A2 (en) | 2000-11-30 | 2002-06-06 | Medarex, Inc. | Transgenic transchromosomal rodents for making human antibodies |
| WO2002092780A2 (en) | 2001-05-17 | 2002-11-21 | Diversa Corporation | Novel antigen binding molecules for therapeutic, diagnostic, prophylactic, enzymatic, industrial, and agricultural applications, and methods for generating and screening thereof |
| WO2003002609A2 (en) | 2001-06-28 | 2003-01-09 | Domantis Limited | Dual-specific ligand and its use |
| WO2003035835A2 (en) | 2001-10-25 | 2003-05-01 | Genentech, Inc. | Glycoprotein compositions |
| US20030153043A1 (en) | 1997-05-21 | 2003-08-14 | Biovation Limited | Method for the production of non-immunogenic proteins |
| US20030157579A1 (en) | 2002-02-14 | 2003-08-21 | Kalobios, Inc. | Molecular sensors activated by disinhibition |
| WO2003074679A2 (en) | 2002-03-01 | 2003-09-12 | Xencor | Antibody optimization |
| US20030198971A1 (en) | 2002-04-18 | 2003-10-23 | Kalobios, Inc. | Reactivation-based molecular interaction sensors |
| WO2004003019A2 (en) | 2002-06-28 | 2004-01-08 | Domantis Limited | Immunoglobin single variant antigen-binding domains and dual-specific constructs |
| US6696245B2 (en) | 1997-10-20 | 2004-02-24 | Domantis Limited | Methods for selecting functional polypeptides |
| US6703199B1 (en) | 1997-06-12 | 2004-03-09 | Research Corporation Technologies, Inc. | Artificial antibody polypeptides |
| WO2004058821A2 (en) | 2002-12-27 | 2004-07-15 | Domantis Limited | Dual specific single domain antibodies specific for a ligand and for the receptor of the ligand |
| US6765087B1 (en) | 1992-08-21 | 2004-07-20 | Vrije Universiteit Brussel | Immunoglobulins devoid of light chains |
| US20040161738A1 (en) | 2000-05-26 | 2004-08-19 | Arumugam Muruganandam | Single-domain brain-targeting antibody fragments derived from llama antibodies |
| US20040175756A1 (en) | 2001-04-26 | 2004-09-09 | Avidia Research Institute | Methods for using combinatorial libraries of monomer domains |
| WO2004081026A2 (en) | 2003-06-30 | 2004-09-23 | Domantis Limited | Polypeptides |
| US6818418B1 (en) | 1998-12-10 | 2004-11-16 | Compound Therapeutics, Inc. | Protein scaffolds for antibody mimics and other binding proteins |
| WO2004106368A1 (de) | 2003-05-28 | 2004-12-09 | Scil Proteins Gmbh | Generierung künstlicher bindungsproteine auf der grundlage von ubiquitin-proteinen |
| WO2004110179A1 (ja) | 2003-06-16 | 2004-12-23 | Waseda University | 同極性の交番電圧を印加する電場処理装置と応用装置 |
| US6838254B1 (en) | 1993-04-29 | 2005-01-04 | Conopco, Inc. | Production of antibodies or (functionalized) fragments thereof derived from heavy chain immunoglobulins of camelidae |
| US20050008625A1 (en) | 2003-02-13 | 2005-01-13 | Kalobios, Inc. | Antibody affinity engineering by serial epitope-guided complementarity replacement |
| US20050048512A1 (en) | 2001-04-26 | 2005-03-03 | Avidia Research Institute | Combinatorial libraries of monomer domains |
| US20050053973A1 (en) | 2001-04-26 | 2005-03-10 | Avidia Research Institute | Novel proteins with targeted binding |
| US20050100543A1 (en) | 2003-07-01 | 2005-05-12 | Immunomedics, Inc. | Multivalent carriers of bi-specific antibodies |
| US20050175606A1 (en) | 2001-04-11 | 2005-08-11 | Hua-Liang Huang | Cyclic single-chain trispecific antibody |
| US20050255552A1 (en) | 2004-01-20 | 2005-11-17 | Kalobios, Inc. | Antibody specificity transfer using minimal essential binding determinants |
| US20060008844A1 (en) | 2004-06-17 | 2006-01-12 | Avidia Research Institute | c-Met kinase binding proteins |
| WO2006020258A2 (en) | 2004-07-17 | 2006-02-23 | Imclone Systems Incorporated | Novel tetravalent bispecific antibody |
| WO2006079372A1 (en) | 2005-01-31 | 2006-08-03 | Ablynx N.V. | Method for generating variable domain sequences of heavy chain antibodies |
| US20070014794A1 (en) | 1995-03-01 | 2007-01-18 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| WO2007024715A2 (en) | 2005-08-19 | 2007-03-01 | Abbott Laboratories | Dual variable domain immunoglobin and uses thereof |
| US20070092940A1 (en) | 2004-09-23 | 2007-04-26 | Genentech, Inc. | Cysteine engineered antibodies and conjugates |
| WO2007059782A1 (en) | 2005-11-28 | 2007-05-31 | Genmab A/S | Recombinant monovalent antibodies and methods for production thereof |
| WO2009056634A2 (en) * | 2007-11-02 | 2009-05-07 | Novartis Ag | Molecules and methods for modulating low-density-lipoprotein receptor-related protein 6 (lrp6) |
Family Cites Families (66)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| DE3813023A1 (de) | 1988-04-19 | 1989-11-16 | Behringwerke Ag | Monoklonaler antikoerper gegen pseudomonas aeruginosa, seine herstellung und verwendung |
| US5242813A (en) | 1990-10-12 | 1993-09-07 | The United States Of America As Represented By The Department Of Health And Human Services | Mouse monoclonal antibodies specific for normal primate tissue, malignant human cultural cell lines human tumors |
| WO1993016178A2 (en) | 1992-02-12 | 1993-08-19 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Sequences characteristic of human gene transcription product |
| WO1994021293A1 (en) | 1993-03-19 | 1994-09-29 | Duke University | Method of treatment of tumors with an antibody binding to tenascin |
| WO1998046743A1 (en) | 1997-04-15 | 1998-10-22 | The Wellcome Trust Limited As Trustee To The Wellcome Trust | Novel ldl-receptor |
| US6780609B1 (en) | 1998-10-23 | 2004-08-24 | Genome Therapeutics Corporation | High bone mass gene of 1.1q13.3 |
| US6770461B1 (en) | 1998-10-23 | 2004-08-03 | Genome Therapeutics Corporation | High bone mass gene of 11q13.3 |
| WO2000008181A2 (en) | 1998-08-07 | 2000-02-17 | Onyx Pharmaceuticals, Inc. | Chp polypeptide, a ligand of pak65 |
| GB9824632D0 (en) | 1998-11-10 | 1999-01-06 | Celltech Therapeutics Ltd | Biological compounds |
| AU2416600A (en) | 1999-01-20 | 2000-08-07 | Rigel Pharmaceuticals, Inc. | Exocytosis pathway proteins and methods of use |
| AU3391200A (en) | 1999-03-04 | 2000-09-21 | Corixa Corporation | Compositions and methods for breast cancer therapy and diagnosis |
| US7534866B2 (en) | 2005-10-19 | 2009-05-19 | Ibc Pharmaceuticals, Inc. | Methods and compositions for generating bioactive assemblies of increased complexity and uses |
| EP1396543A3 (en) | 1999-07-08 | 2004-03-31 | Research Association for Biotechnology | Primers for synthesizing full length cDNA clones and their use |
| US20030138804A1 (en) | 2000-02-03 | 2003-07-24 | Boyle Bryan J. | Methods and materials relating to novel C-type lectin receptor-like polypeptides and polynucleotides |
| US7514594B2 (en) | 2001-05-11 | 2009-04-07 | Wyeth | Transgenic animal model of bone mass modulation |
| JP2004537289A (ja) | 2001-05-11 | 2004-12-16 | ゲノム セラピューティックス コーポレーション | 骨量および脂質レベルを調整するhbm変異型 |
| IL158750A0 (en) | 2001-05-17 | 2004-05-12 | Genome Therapeutics Corp | Reagents and methods for modulating dkk-mediated interactions |
| US20040038860A1 (en) | 2002-05-17 | 2004-02-26 | Allen Kristina M. | Reagents and methods for modulating dkk-mediated interactions |
| WO2003029469A1 (en) | 2001-09-13 | 2003-04-10 | Juridical Foundation The Chemo-Sero-Therapeutic Research Institute | Novel selenocystein-containing proteins |
| US20030194708A1 (en) | 2002-04-10 | 2003-10-16 | Minke Binnerts | Human homolog of crossveinless materials and methods |
| US20050084494A1 (en) | 2003-05-21 | 2005-04-21 | Darwin Prockop | Inhibitors of Dkk-1 |
| US8637506B2 (en) | 2003-09-22 | 2014-01-28 | Enzo Biochem, Inc. | Compositions and methods for bone formation and remodeling |
| US9046537B2 (en) | 2003-09-22 | 2015-06-02 | Enzo Biochem, Inc. | Method for treating inflammation by administering a compound which binds LDL-receptor-related protein (LRP) ligand binding domain |
| WO2005048913A2 (en) | 2003-11-24 | 2005-06-02 | Gunnar Westin | Mutant lrp5/6 wnt-signaling receptors in cancer diagnosis, prognosis and treatment |
| US20060094046A1 (en) | 2004-02-11 | 2006-05-04 | Arie Abo | Compositions and methods relating to angiogenesis and tumorigenesis |
| US20060127919A1 (en) | 2004-02-25 | 2006-06-15 | Arie Abo | Compositions and methods relating to cell adhesion molecule L1 |
| CN100376599C (zh) | 2004-04-01 | 2008-03-26 | 北京安波特基因工程技术有限公司 | 基因工程重组抗cea抗cd3抗cd28线性单链三特异抗体 |
| CN1981054A (zh) | 2004-05-14 | 2007-06-13 | 加利福尼亚大学董事会 | 用抗wnt2单克隆抗体和sirna治疗癌症的方法 |
| MX2007001221A (es) | 2004-08-04 | 2007-03-23 | Amgen Inc | Anticuerpos para proteina dickkopf-1 (dkk-1). |
| US8809287B2 (en) | 2004-11-15 | 2014-08-19 | Icahn School Of Medicine At Mount Sinai | Compositions and methods for altering Wnt autocrine signaling |
| US7838252B2 (en) | 2005-02-17 | 2010-11-23 | The Board Of Trustees Of The Leland Stanford Junior University | Methods and compositions for treating a subject having an anthrax toxin mediated condition |
| US20070248628A1 (en) | 2005-12-06 | 2007-10-25 | Keller Lorraine H | Immunogens in cancer stem cells |
| KR101516823B1 (ko) | 2006-03-17 | 2015-05-07 | 바이오겐 아이덱 엠에이 인코포레이티드 | 안정화된 폴리펩티드 조성물 |
| US7977457B2 (en) | 2006-05-19 | 2011-07-12 | Teva Pharmaceutical Industries Ltd. | Fusion proteins, uses thereof and processes for producing same |
| WO2007140410A2 (en) | 2006-05-30 | 2007-12-06 | Van Andel Research Institute | Low-density lipoprotein receptor 6 (lrp6) as a mammary stem cell marker and related methods |
| WO2008013934A2 (en) | 2006-07-27 | 2008-01-31 | Cell Signaling Technology, Inc. | Tyrosine phosphorylation sites |
| US7847067B2 (en) | 2006-08-28 | 2010-12-07 | ARCA Biopharma | Antibodies to NTB-A |
| CA2697922A1 (en) | 2007-08-28 | 2009-03-12 | Biogen Idec Ma Inc. | Compositions that bind multiple epitopes of igf-1r |
| WO2009043051A2 (en) | 2007-09-27 | 2009-04-02 | Biogen Idec Ma Inc. | Cd23 binding molecules and methods of use thereof |
| TWI489993B (zh) | 2007-10-12 | 2015-07-01 | Novartis Ag | 骨硬化素(sclerostin)抗體組合物及使用方法 |
| US20100291108A1 (en) | 2007-10-16 | 2010-11-18 | Arie Abo | Antibodies to irem-1 |
| EP2211903A4 (en) | 2007-10-17 | 2011-07-06 | Nuvelo Inc | CLL-1 ANTIBODY |
| UA104132C2 (en) | 2007-11-13 | 2014-01-10 | Тева Биофармасьютикалз Юесей, Инк. | Humanized antibodies against tl1a |
| CA2705923A1 (en) | 2007-11-16 | 2009-05-22 | Nuvelo, Inc. | Antibodies to lrp6 |
| EP2080812A1 (en) | 2008-01-18 | 2009-07-22 | Transmedi SA | Compositions and methods of detecting post-stop peptides |
| CA2721093A1 (en) | 2008-04-11 | 2009-10-15 | Merrimack Pharmaceuticals, Inc. | Human serum albumin linkers and conjugates thereof |
| US8716243B2 (en) | 2008-05-28 | 2014-05-06 | St. Jude Childen's Research Hospital | Methods of effecting Wnt signaling through Dkk structural analysis |
| EP2599793A1 (en) | 2008-05-29 | 2013-06-05 | Nuclea Biotechnologies, Inc. | Anti-phospho-akt antibodies |
| UA101670C2 (ru) | 2008-07-23 | 2013-04-25 | Ханми Сайенс Ко., Лтд. | Полипептидный комплекс, содержащий непептидильный полимер, который имеет три функциональных конца |
| CN102282168A (zh) | 2008-11-18 | 2011-12-14 | 梅里麦克制药股份有限公司 | 人血清白蛋白接头以及其结合物 |
| JP5693475B2 (ja) | 2009-03-04 | 2015-04-01 | ペイタント・ソリューションズ・インコーポレイテッドPeytant Solutions, Inc. | 羊膜組織を含む材料で修飾されたステント及び対応する方法 |
| EP2411412B1 (en) | 2009-03-24 | 2015-05-27 | Teva Biopharmaceuticals USA, Inc. | Humanized antibodies against light and uses thereof |
| CN102458442B (zh) | 2009-04-08 | 2016-06-29 | 加利福尼亚大学董事会 | 具有受控血清药代动力学的人蛋白支架 |
| JP2012525149A (ja) | 2009-04-27 | 2012-10-22 | オンコメッド ファーマシューティカルズ インコーポレイテッド | ヘテロ多量体分子を作製するための方法 |
| US8728730B2 (en) | 2009-09-03 | 2014-05-20 | Genentech, Inc. | Methods for treating, diagnosing, and monitoring rheumatoid arthritis |
| US20110172398A1 (en) | 2009-10-02 | 2011-07-14 | Boehringer Ingelheim International Gmbh | Bispecific binding molecules for anti-angiogenesis therapy |
| CA2777242A1 (en) | 2009-10-14 | 2011-04-21 | Merrimack Pharmaceuticals, Inc. | Bispecific binding agents targeting igf-1r and erbb3 signalling and uses thereof |
| WO2011084714A2 (en) | 2009-12-17 | 2011-07-14 | Biogen Idec Ma Inc. | STABILIZED ANTI-TNF-ALPHA scFv MOLECULES OR ANTI-TWEAK scFv MOLECULES AND USES THEREOF |
| US8859736B2 (en) | 2010-02-19 | 2014-10-14 | The Board Of Regents Of The University Of Oklahoma | Monoclonal antibodies that inhibit the wnt signaling pathway and methods of production and use thereof |
| WO2011106707A2 (en) | 2010-02-26 | 2011-09-01 | Human Genome Sciences, Inc. | Antibodies that specifically bind to dr3 |
| AR080795A1 (es) | 2010-03-24 | 2012-05-09 | Genentech Inc | Anticuerpos anti-lrp6 (proteina relacionada con el receptor ldl tipo 6) |
| KR20130066631A (ko) | 2010-05-06 | 2013-06-20 | 노파르티스 아게 | 치료적 저밀도 지단백질-관련 단백질 6 (lrp6) 다가 항체에 대한 조성물 및 사용 방법 |
| EP4234698A3 (en) | 2010-05-06 | 2023-11-08 | Novartis AG | Compositions and methods of use for therapeutic low density lipoprotein-related protein 6 (lrp6) antibodies |
| EP2630154A1 (en) | 2010-10-20 | 2013-08-28 | F.Hoffmann-La Roche Ag | Methods and compositions for modulating the wnt pathway |
| AU2011341337A1 (en) | 2010-12-10 | 2013-06-13 | Merrimack Pharmaceuticals, Inc. | Dosage and administration of bispecific scFv conjugates |
| CN104039830A (zh) | 2011-11-04 | 2014-09-10 | 诺华股份有限公司 | 低密度脂蛋白相关蛋白6(lrp6)-半寿期延长物构建体 |
-
2011
- 2011-05-05 KR KR1020127031869A patent/KR20130066631A/ko not_active Withdrawn
- 2011-05-05 CA CA2798390A patent/CA2798390A1/en not_active Abandoned
- 2011-05-05 PH PH1/2012/502193A patent/PH12012502193A1/en unknown
- 2011-05-05 SG SG2012081170A patent/SG185415A1/en unknown
- 2011-05-05 AU AU2011249782A patent/AU2011249782B2/en not_active Ceased
- 2011-05-05 JP JP2013508500A patent/JP2013527761A/ja not_active Withdrawn
- 2011-05-05 BR BR112012028326A patent/BR112012028326A2/pt not_active IP Right Cessation
- 2011-05-05 MA MA35418A patent/MA34287B1/fr unknown
- 2011-05-05 WO PCT/EP2011/057200 patent/WO2011138391A1/en not_active Ceased
- 2011-05-05 EA EA201291181A patent/EA201291181A1/ru unknown
- 2011-05-05 US US13/696,372 patent/US9290573B2/en active Active
- 2011-05-05 EP EP11723308A patent/EP2566894A1/en not_active Withdrawn
- 2011-05-05 MX MX2012012927A patent/MX2012012927A/es not_active Application Discontinuation
- 2011-05-05 PE PE2012002124A patent/PE20130206A1/es not_active Application Discontinuation
- 2011-05-05 CN CN2011800332694A patent/CN103237811A/zh active Pending
-
2012
- 2012-10-24 ZA ZA2012/08050A patent/ZA201208050B/en unknown
- 2012-10-25 TN TNP2012000512A patent/TN2012000512A1/en unknown
- 2012-11-01 IL IL222814A patent/IL222814A0/en unknown
- 2012-11-06 GT GT201200298A patent/GT201200298A/es unknown
- 2012-11-06 CL CL2012003093A patent/CL2012003093A1/es unknown
- 2012-11-06 CO CO12199729A patent/CO6630180A2/es unknown
-
2014
- 2014-05-16 CL CL2014001297A patent/CL2014001297A1/es unknown
-
2017
- 2017-08-17 JP JP2017157638A patent/JP6678627B2/ja not_active Expired - Fee Related
-
2019
- 2019-11-29 JP JP2019216739A patent/JP2020063262A/ja active Pending
-
2023
- 2023-09-07 JP JP2023145259A patent/JP2023182590A/ja active Pending
Patent Citations (167)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US2207308A (en) | 1940-07-09 | Electrolytic manufacture | ||
| US4458066A (en) | 1980-02-29 | 1984-07-03 | University Patents, Inc. | Process for preparing polynucleotides |
| US4526938A (en) | 1982-04-22 | 1985-07-02 | Imperial Chemical Industries Plc | Continuous release formulations |
| US4522811A (en) | 1982-07-08 | 1985-06-11 | Syntex (U.S.A.) Inc. | Serial injection of muramyldipeptides and liposomes enhances the anti-infective activity of muramyldipeptides |
| US4708871A (en) | 1983-03-08 | 1987-11-24 | Commonwealth Serum Laboratories Commission | Antigenically active amino acid sequences |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| EP0154316A2 (en) | 1984-03-06 | 1985-09-11 | Takeda Chemical Industries, Ltd. | Chemically modified lymphokine and production thereof |
| US5128326A (en) | 1984-12-06 | 1992-07-07 | Biomatrix, Inc. | Drug delivery systems based on hyaluronans derivatives thereof and their salts and methods of producing same |
| US5399331A (en) | 1985-06-26 | 1995-03-21 | The Liposome Company, Inc. | Method for protein-liposome coupling |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| US5374548A (en) | 1986-05-02 | 1994-12-20 | Genentech, Inc. | Methods and compositions for the attachment of proteins to liposomes using a glycophospholipid anchor |
| US4881175A (en) | 1986-09-02 | 1989-11-14 | Genex Corporation | Computer based system and method for determining and displaying possible chemical structures for converting double- or multiple-chain polypeptides to single-chain polypeptides |
| US5455030A (en) | 1986-09-02 | 1995-10-03 | Enzon Labs, Inc. | Immunotheraphy using single chain polypeptide binding molecules |
| US5260203A (en) | 1986-09-02 | 1993-11-09 | Enzon, Inc. | Single polypeptide chain binding molecules |
| US5648260A (en) | 1987-03-18 | 1997-07-15 | Scotgen Biopharmaceuticals Incorporated | DNA encoding antibodies with altered effector functions |
| US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
| EP0307434A1 (en) | 1987-03-18 | 1989-03-22 | Medical Res Council | CHANGED ANTIBODIES. |
| US5013653A (en) | 1987-03-20 | 1991-05-07 | Creative Biomolecules, Inc. | Product and process for introduction of a hinge region into a fusion protein to facilitate cleavage |
| US5482858A (en) | 1987-05-21 | 1996-01-09 | Creative Biomolecules, Inc. | Polypeptide linkers for production of biosynthetic proteins |
| US5091513A (en) | 1987-05-21 | 1992-02-25 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
| US5258498A (en) | 1987-05-21 | 1993-11-02 | Creative Biomolecules, Inc. | Polypeptide linkers for production of biosynthetic proteins |
| US5132405A (en) | 1987-05-21 | 1992-07-21 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
| US5476786A (en) | 1987-05-21 | 1995-12-19 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
| US4880078A (en) | 1987-06-29 | 1989-11-14 | Honda Giken Kogyo Kabushiki Kaisha | Exhaust muffler |
| US5677425A (en) | 1987-09-04 | 1997-10-14 | Celltech Therapeutics Limited | Recombinant antibody |
| US5336603A (en) | 1987-10-02 | 1994-08-09 | Genentech, Inc. | CD4 adheson variants |
| US5476996A (en) | 1988-06-14 | 1995-12-19 | Lidak Pharmaceuticals | Human immune system in non-human animal |
| US5698767A (en) | 1988-06-14 | 1997-12-16 | Lidak Pharmaceuticals | Human immune system in non-human animal |
| US5403484A (en) | 1988-09-02 | 1995-04-04 | Protein Engineering Corporation | Viruses expressing chimeric binding proteins |
| US5571698A (en) | 1988-09-02 | 1996-11-05 | Protein Engineering Corporation | Directed evolution of novel binding proteins |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5545807A (en) | 1988-10-12 | 1996-08-13 | The Babraham Institute | Production of antibodies from transgenic animals |
| EP0367166A1 (en) | 1988-10-31 | 1990-05-09 | Takeda Chemical Industries, Ltd. | Modified interleukin-2 and production thereof |
| EP0368684A1 (en) | 1988-11-11 | 1990-05-16 | Medical Research Council | Cloning immunoglobulin variable domain sequences. |
| EP0401384A1 (en) | 1988-12-22 | 1990-12-12 | Kirin-Amgen, Inc. | Chemically modified granulocyte colony stimulating factor |
| US5585089A (en) | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5693762A (en) | 1988-12-28 | 1997-12-02 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US6180370B1 (en) | 1988-12-28 | 2001-01-30 | Protein Design Labs, Inc. | Humanized immunoglobulins and methods of making the same |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5416016A (en) | 1989-04-03 | 1995-05-16 | Purdue Research Foundation | Method for enhancing transmembrane transport of exogenous molecules |
| US6291158B1 (en) | 1989-05-16 | 2001-09-18 | Scripps Research Institute | Method for tapping the immunological repertoire |
| US5112946A (en) | 1989-07-06 | 1992-05-12 | Repligen Corporation | Modified pf4 compositions and methods of use |
| EP0413622A1 (en) | 1989-08-03 | 1991-02-20 | Rhone-Poulenc Sante | Albumin derivatives with therapeutic functions |
| WO1991005548A1 (en) | 1989-10-10 | 1991-05-02 | Pitman-Moore, Inc. | Sustained release composition for macromolecular proteins |
| WO1991006570A1 (en) | 1989-10-25 | 1991-05-16 | The University Of Melbourne | HYBRID Fc RECEPTOR MOLECULES |
| US5679377A (en) | 1989-11-06 | 1997-10-21 | Alkermes Controlled Therapeutics, Inc. | Protein microspheres and methods of using them |
| US6162963A (en) | 1990-01-12 | 2000-12-19 | Abgenix, Inc. | Generation of Xenogenetic antibodies |
| US5939598A (en) | 1990-01-12 | 1999-08-17 | Abgenix, Inc. | Method of making transgenic mice lacking endogenous heavy chains |
| US6150584A (en) | 1990-01-12 | 2000-11-21 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US6114598A (en) | 1990-01-12 | 2000-09-05 | Abgenix, Inc. | Generation of xenogeneic antibodies |
| US6075181A (en) | 1990-01-12 | 2000-06-13 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US5580717A (en) | 1990-05-01 | 1996-12-03 | Affymax Technologies N.V. | Recombinant library screening methods |
| US5427908A (en) | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
| US5349053A (en) | 1990-06-01 | 1994-09-20 | Protein Design Labs, Inc. | Chimeric ligand/immunoglobulin molecules and their uses |
| US5969108A (en) | 1990-07-10 | 1999-10-19 | Medical Research Council | Methods for producing members of specific binding pairs |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| WO1992003918A1 (en) | 1990-08-29 | 1992-03-19 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5770429A (en) | 1990-08-29 | 1998-06-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5874299A (en) | 1990-08-29 | 1999-02-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5814318A (en) | 1990-08-29 | 1998-09-29 | Genpharm International Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5877397A (en) | 1990-08-29 | 1999-03-02 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5789650A (en) | 1990-08-29 | 1998-08-04 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5359046A (en) | 1990-12-14 | 1994-10-25 | Cell Genesys, Inc. | Chimeric chains for receptor-associated signal transduction pathways |
| US5290540A (en) | 1991-05-01 | 1994-03-01 | Henry M. Jackson Foundation For The Advancement Of Military Medicine | Method for treating infectious respiratory diseases |
| WO1992019244A2 (en) | 1991-05-01 | 1992-11-12 | Henry M. Jackson Foundation For The Advancement Of Military Medicine | A method for treating infectious respiratory diseases |
| US6172197B1 (en) | 1991-07-10 | 2001-01-09 | Medical Research Council | Methods for producing members of specific binding pairs |
| US6544731B1 (en) | 1991-12-02 | 2003-04-08 | Medical Research Council | Production of anti-self antibodies from antibody segment repertories and displayed on phage |
| EP0616640A1 (en) | 1991-12-02 | 1994-09-28 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US6593081B1 (en) | 1991-12-02 | 2003-07-15 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US6582915B1 (en) | 1991-12-02 | 2003-06-24 | Medical Research Council | Production of anti-self bodies from antibody segment repertories and displayed on phage |
| US5885793A (en) | 1991-12-02 | 1999-03-23 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US6555313B1 (en) | 1991-12-02 | 2003-04-29 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US6521404B1 (en) | 1991-12-02 | 2003-02-18 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| WO1993012227A1 (en) | 1991-12-17 | 1993-06-24 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5622929A (en) | 1992-01-23 | 1997-04-22 | Bristol-Myers Squibb Company | Thioether conjugates |
| WO1993015200A1 (fr) | 1992-01-31 | 1993-08-05 | Rhone-Poulenc Rorer S.A. | Polypeptides antithrombotiques, antagonistes de la liaison du vwf aux plaquettes et/ou au sous-endothelium |
| WO1993015199A1 (fr) | 1992-01-31 | 1993-08-05 | Rhone-Poulenc Rorer S.A. | Nouveaux polypeptides biologiquement actifs, leur preparation et composition pharmaceutique les contenant |
| US5714350A (en) | 1992-03-09 | 1998-02-03 | Protein Design Labs, Inc. | Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region |
| US6350861B1 (en) | 1992-03-09 | 2002-02-26 | Protein Design Labs, Inc. | Antibodies with increased binding affinity |
| US5912015A (en) | 1992-03-12 | 1999-06-15 | Alkermes Controlled Therapeutics, Inc. | Modulated release from biocompatible polymers |
| US5447851A (en) | 1992-04-02 | 1995-09-05 | Board Of Regents, The University Of Texas System | DNA encoding a chimeric polypeptide comprising the extracellular domain of TNF receptor fused to IgG, vectors, and host cells |
| US5447851B1 (en) | 1992-04-02 | 1999-07-06 | Univ Texas System Board Of | Dna encoding a chimeric polypeptide comprising the extracellular domain of tnf receptor fused to igg vectors and host cells |
| WO1994004678A1 (en) | 1992-08-21 | 1994-03-03 | Casterman Cecile | Immunoglobulins devoid of light chains |
| US6765087B1 (en) | 1992-08-21 | 2004-07-20 | Vrije Universiteit Brussel | Immunoglobulins devoid of light chains |
| US5759808A (en) | 1992-08-21 | 1998-06-02 | Vrije Universiteit Brussel | Immunoglobulins devoid of light chains |
| US5934272A (en) | 1993-01-29 | 1999-08-10 | Aradigm Corporation | Device and method of creating aerosolized mist of respiratory drug |
| WO1994025585A1 (en) | 1993-04-26 | 1994-11-10 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US6838254B1 (en) | 1993-04-29 | 2005-01-04 | Conopco, Inc. | Production of antibodies or (functionalized) fragments thereof derived from heavy chain immunoglobulins of camelidae |
| WO1994029351A2 (en) | 1993-06-16 | 1994-12-22 | Celltech Limited | Antibodies |
| US5831012A (en) | 1994-01-14 | 1998-11-03 | Pharmacia & Upjohn Aktiebolag | Bacterial receptor structures |
| US5605793A (en) | 1994-02-17 | 1997-02-25 | Affymax Technologies N.V. | Methods for in vitro recombination |
| US5830721A (en) | 1994-02-17 | 1998-11-03 | Affymax Technologies N.V. | DNA mutagenesis by random fragmentation and reassembly |
| US5837458A (en) | 1994-02-17 | 1998-11-17 | Maxygen, Inc. | Methods and compositions for cellular and metabolic engineering |
| US5811238A (en) | 1994-02-17 | 1998-09-22 | Affymax Technologies N.V. | Methods for generating polynucleotides having desired characteristics by iterative selection and recombination |
| WO1996004388A1 (en) | 1994-07-29 | 1996-02-15 | Smithkline Beecham Plc | Novel compounds |
| US6350466B1 (en) | 1994-08-05 | 2002-02-26 | Targesome, Inc. | Targeted polymerized liposome diagnostic and treatment agents |
| WO1996020698A2 (en) | 1995-01-05 | 1996-07-11 | The Board Of Regents Acting For And On Behalf Of The University Of Michigan | Surface-modified nanoparticles and method of making and using same |
| US20070014794A1 (en) | 1995-03-01 | 2007-01-18 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US6121022A (en) | 1995-04-14 | 2000-09-19 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US6019968A (en) | 1995-04-14 | 2000-02-01 | Inhale Therapeutic Systems, Inc. | Dispersible antibody compositions and methods for their preparation and use |
| US5834252A (en) | 1995-04-18 | 1998-11-10 | Glaxo Group Limited | End-complementary polymerase reaction |
| US5641870A (en) | 1995-04-20 | 1997-06-24 | Genentech, Inc. | Low pH hydrophobic interaction chromatography for antibody purification |
| US5916597A (en) | 1995-08-31 | 1999-06-29 | Alkermes Controlled Therapeutics, Inc. | Composition and method using solid-phase particles for sustained in vivo release of a biologically active agent |
| WO1997013852A1 (en) | 1995-10-10 | 1997-04-17 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| WO1997032572A2 (en) | 1996-03-04 | 1997-09-12 | The Penn State Research Foundation | Materials and methods for enhancing cellular internalization |
| US5985320A (en) | 1996-03-04 | 1999-11-16 | The Penn State Research Foundation | Materials and methods for enhancing cellular internalization |
| WO1997034631A1 (en) | 1996-03-18 | 1997-09-25 | Board Of Regents, The University Of Texas System | Immunoglobin-like domains with increased half lives |
| US5874064A (en) | 1996-05-24 | 1999-02-23 | Massachusetts Institute Of Technology | Aerodynamically light particles for pulmonary drug delivery |
| WO1997044013A1 (en) | 1996-05-24 | 1997-11-27 | Massachusetts Institute Of Technology | Aerodynamically light particles for pulmonary drug delivery |
| US5985309A (en) | 1996-05-24 | 1999-11-16 | Massachusetts Institute Of Technology | Preparation of particles for inhalation |
| US6316024B1 (en) | 1996-10-11 | 2001-11-13 | Sequus Pharmaceuticals, Inc. | Therapeutic liposome composition and method of preparation |
| WO1998023289A1 (en) | 1996-11-27 | 1998-06-04 | The General Hospital Corporation | MODULATION OF IgG BINDING TO FcRn |
| WO1998024884A1 (en) | 1996-12-02 | 1998-06-11 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies |
| WO1998031346A1 (en) | 1997-01-16 | 1998-07-23 | Massachusetts Institute Of Technology | Preparation of particles for inhalation |
| US5855913A (en) | 1997-01-16 | 1999-01-05 | Massachusetts Instite Of Technology | Particles incorporating surfactants for pulmonary drug delivery |
| US6277375B1 (en) | 1997-03-03 | 2001-08-21 | Board Of Regents, The University Of Texas System | Immunoglobulin-like domains with increased half-lives |
| US20030153043A1 (en) | 1997-05-21 | 2003-08-14 | Biovation Limited | Method for the production of non-immunogenic proteins |
| US6703199B1 (en) | 1997-06-12 | 2004-03-09 | Research Corporation Technologies, Inc. | Artificial antibody polypeptides |
| US5989463A (en) | 1997-09-24 | 1999-11-23 | Alkermes Controlled Therapeutics, Inc. | Methods for fabricating polymer-based controlled release devices |
| WO1999015154A1 (en) | 1997-09-24 | 1999-04-01 | Alkermes Controlled Therapeutics, Inc. | Methods for fabricating polymer-based controlled release preparations |
| WO1999016873A1 (de) | 1997-09-26 | 1999-04-08 | Arne Skerra | Anticaline |
| US6696245B2 (en) | 1997-10-20 | 2004-02-24 | Domantis Limited | Methods for selecting functional polypeptides |
| WO1999020253A1 (en) | 1997-10-23 | 1999-04-29 | Bioglan Therapeutics Ab | Encapsulation method |
| WO1999045962A1 (en) | 1998-03-13 | 1999-09-16 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
| WO1999054342A1 (en) | 1998-04-20 | 1999-10-28 | Pablo Umana | Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity |
| WO1999066903A2 (en) | 1998-06-24 | 1999-12-29 | Advanced Inhalation Research, Inc. | Large porous particles emitted from an inhaler |
| US6818418B1 (en) | 1998-12-10 | 2004-11-16 | Compound Therapeutics, Inc. | Protein scaffolds for antibody mimics and other binding proteins |
| WO2000042072A2 (en) | 1999-01-15 | 2000-07-20 | Genentech, Inc. | Polypeptide variants with altered effector function |
| EP1176195A1 (en) | 1999-04-09 | 2002-01-30 | Kyowa Hakko Kogyo Co., Ltd. | Method for controlling the activity of immunologically functional molecule |
| WO2001004144A2 (de) | 1999-07-13 | 2001-01-18 | Scil Proteins Gmbh | Design von beta-faltblatt-proteinen mit spezifischen bindungseigenschaften |
| WO2001005950A2 (en) | 1999-07-20 | 2001-01-25 | Morphosys Ag | Methods for displaying (poly)peptides/proteins on bacteriophage particles via disulfide bonds |
| WO2001014424A2 (en) | 1999-08-24 | 2001-03-01 | Medarex, Inc. | Human ctla-4 antibodies and their uses |
| WO2001077137A1 (en) | 2000-04-12 | 2001-10-18 | Human Genome Sciences, Inc. | Albumin fusion proteins |
| US20040161738A1 (en) | 2000-05-26 | 2004-08-19 | Arumugam Muruganandam | Single-domain brain-targeting antibody fragments derived from llama antibodies |
| WO2002043478A2 (en) | 2000-11-30 | 2002-06-06 | Medarex, Inc. | Transgenic transchromosomal rodents for making human antibodies |
| US20050175606A1 (en) | 2001-04-11 | 2005-08-11 | Hua-Liang Huang | Cyclic single-chain trispecific antibody |
| US20050053973A1 (en) | 2001-04-26 | 2005-03-10 | Avidia Research Institute | Novel proteins with targeted binding |
| US20040175756A1 (en) | 2001-04-26 | 2004-09-09 | Avidia Research Institute | Methods for using combinatorial libraries of monomer domains |
| US20050048512A1 (en) | 2001-04-26 | 2005-03-03 | Avidia Research Institute | Combinatorial libraries of monomer domains |
| WO2002092780A2 (en) | 2001-05-17 | 2002-11-21 | Diversa Corporation | Novel antigen binding molecules for therapeutic, diagnostic, prophylactic, enzymatic, industrial, and agricultural applications, and methods for generating and screening thereof |
| WO2003002609A2 (en) | 2001-06-28 | 2003-01-09 | Domantis Limited | Dual-specific ligand and its use |
| WO2003035835A2 (en) | 2001-10-25 | 2003-05-01 | Genentech, Inc. | Glycoprotein compositions |
| US20030157579A1 (en) | 2002-02-14 | 2003-08-21 | Kalobios, Inc. | Molecular sensors activated by disinhibition |
| WO2003074679A2 (en) | 2002-03-01 | 2003-09-12 | Xencor | Antibody optimization |
| US20030198971A1 (en) | 2002-04-18 | 2003-10-23 | Kalobios, Inc. | Reactivation-based molecular interaction sensors |
| WO2004003019A2 (en) | 2002-06-28 | 2004-01-08 | Domantis Limited | Immunoglobin single variant antigen-binding domains and dual-specific constructs |
| WO2004058821A2 (en) | 2002-12-27 | 2004-07-15 | Domantis Limited | Dual specific single domain antibodies specific for a ligand and for the receptor of the ligand |
| US20050008625A1 (en) | 2003-02-13 | 2005-01-13 | Kalobios, Inc. | Antibody affinity engineering by serial epitope-guided complementarity replacement |
| WO2004106368A1 (de) | 2003-05-28 | 2004-12-09 | Scil Proteins Gmbh | Generierung künstlicher bindungsproteine auf der grundlage von ubiquitin-proteinen |
| WO2004110179A1 (ja) | 2003-06-16 | 2004-12-23 | Waseda University | 同極性の交番電圧を印加する電場処理装置と応用装置 |
| WO2004081026A2 (en) | 2003-06-30 | 2004-09-23 | Domantis Limited | Polypeptides |
| US20050100543A1 (en) | 2003-07-01 | 2005-05-12 | Immunomedics, Inc. | Multivalent carriers of bi-specific antibodies |
| WO2005035572A2 (en) | 2003-10-08 | 2005-04-21 | Domantis Limited | Antibody compositions and methods |
| US20050255552A1 (en) | 2004-01-20 | 2005-11-17 | Kalobios, Inc. | Antibody specificity transfer using minimal essential binding determinants |
| US20060008844A1 (en) | 2004-06-17 | 2006-01-12 | Avidia Research Institute | c-Met kinase binding proteins |
| WO2006020258A2 (en) | 2004-07-17 | 2006-02-23 | Imclone Systems Incorporated | Novel tetravalent bispecific antibody |
| US20070092940A1 (en) | 2004-09-23 | 2007-04-26 | Genentech, Inc. | Cysteine engineered antibodies and conjugates |
| WO2006079372A1 (en) | 2005-01-31 | 2006-08-03 | Ablynx N.V. | Method for generating variable domain sequences of heavy chain antibodies |
| WO2007024715A2 (en) | 2005-08-19 | 2007-03-01 | Abbott Laboratories | Dual variable domain immunoglobin and uses thereof |
| WO2007059782A1 (en) | 2005-11-28 | 2007-05-31 | Genmab A/S | Recombinant monovalent antibodies and methods for production thereof |
| WO2009056634A2 (en) * | 2007-11-02 | 2009-05-07 | Novartis Ag | Molecules and methods for modulating low-density-lipoprotein receptor-related protein 6 (lrp6) |
Non-Patent Citations (222)
| Title |
|---|
| "Cancer Chemotherapy and Biotherapy", 2001, LIPPINCOTT, WILLIAMS & WILKINS |
| "Current Protocols in Molecular Biology", vol. 1, 1994, JOHN WILEY & SONS, INC. |
| "Fundamental Immunology", 1999, LIPPINCOTT-RAVEN |
| "Monoclonal Antibodies and Peptide Therapy in Autoimmune Diseases", 1993, MARCEL DEKKER |
| "Monoclonal Antibodies For Cancer Detection And Therapy", 1985, ACADEMIC PRESS, article "Analysis, Results, And Future Prospective Of The Therapeutic Use Of Radiolabeled Antibody In Cancer Therapy", pages: 303 - 16 |
| "Monoclonal Antibodies, Cytokines and Arthritis", 1991, MARCEL DEKKER |
| "Pharmaceutical Dosage Forms: Disperse Systems", 1990, MARCEL DEKKER |
| "Pharmaceutical Dosage Forms: Parenteral Medications", 1993, MARCEL DEKKER |
| "Pharmaceutical Dosage Forms: Tablets", 1990, MARCEL DEKKER |
| "Remington's Pharmaceutical Sciences and Introduction to Pharmaceutical Dosage Forms. 19th Ed.", 1995, MACK PUB. CO. |
| ABRAHAM ET AL., JOURNAL OF MOLECULAR RECOGNITION, vol. 9, 1996, pages 456 - 461 |
| AITSCHUL ET AL., J.MOL. BIOL., vol. 215, 1990, pages 403 - 10 |
| AKIRI ET AL., ONCOGENE, vol. 28, 2009, pages 2163 - 2172 |
| AL LAZIKANI ET AL., J. MOL. BIO., vol. 273, 1997, pages 927 948 |
| AL-LAZIKANI ET AL., J. MOL. BIOL., vol. 273, 1997, pages 927 - 948 |
| ALLEN, NAT. REV. CANCER, vol. 2, 2002, pages 750 - 763 |
| ALT ET AL., FEBS LETTERS, vol. 454, 1999, pages 90 - 94 |
| ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410 |
| ALTSCHUL ET AL., NUC. ACIDS RES., vol. 25, 1977, pages 3389 - 3402 |
| ARNON ET AL.: "Monoclonal Antibodies And Cancer Therapy", 1985, ALAN R. LISS, INC, article "Monoclonal Antibodies For Immunotargeting Of Drugs In Cancer Therapy", pages: 243 - 56 |
| ASHKENAZI ET AL., PROC. NATL. ACAD. SCI. USA, vol. 88, 1991, pages 10535 - 10539 |
| BAERT ET AL., NEW ENGL. J. MED., vol. 348, 2003, pages 601 - 608 |
| BAFICO ET AL., CANCER CELL, vol. 6, 2004, pages 497 - 506 |
| BARKER, CLEVERS, NATURE REV., vol. 5, 2006, pages 997 |
| BATZER ET AL., NUCLEIC ACID RES., vol. 19, 1991, pages 5081 |
| BEAUCAGE ET AL., TETRA. LETT., vol. 22, 1981, pages 1859 |
| BENIAMINOVITZ ET AL., NEW ENGL. J. MED., vol. 342, 2000, pages 613 - 619 |
| BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426 |
| BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 42G |
| BITTNER ET AL., METH. ENZYMOL., vol. 153, 1987, pages 516 |
| BRENNAN ET AL., SCIENCE, vol. 229, 1985, pages 81 - 83 |
| BRENT ET AL., CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, 2003 |
| BRISCOE ET AL., AM. J. PHYSIOL., vol. 1233, 1995, pages 134 |
| BROWN, METH. ENZYMOL., vol. 68, 1979, pages 109 |
| BUCHWALD ET AL., SURGERY, vol. 88, 1980, pages 507 |
| CAO ET AL., BIOCONJ. CHEM., vol. 9, 1998, pages 635 - 44 |
| CARTER ET AL., J. HEMATOTHERAPY, vol. 4, 1995, pages 463 - 70 |
| CHEN ET AL., EMBO J., vol. 12, 1993, pages 821 - 830 |
| CHEN ET AL., INTERNATIONAL IMMUNOLOGY, vol. 5, 1993, pages 647 - 656 |
| CHEUNG ET AL., VIROLOGY, vol. 176, 1990, pages 546 - 552 |
| CHOI ET AL., NATURE GENETICS, vol. 4, 1993, pages 117 - 123 |
| CHOTHIA ET AL., J. MOL. BIOL., vol. 196, 1987, pages 901 - 917 |
| CHOTHIA ET AL., NATURE, vol. 342, 1989, pages 877 - 883 |
| CLEEK ET AL.: "Biodegradable Polymeric Carriers for a bFGF Antibody for Cardiovascular Application", PRO. INT'L. SYMP. CONTROL. REL. BIOACT. MATER., vol. 24, 1997, pages 853 - 854 |
| CLEVERS ET AL., CELL, vol. 127, 2006, pages 469 - 480 |
| CORTEZ-RETAMOZO ET AL., INT J CANCER, vol. 89, 2002, pages 456 - 62 |
| COX ET AL., EUR. J IMMUNOL., vol. 24, 1994, pages 827 - 836 |
| CREIGHTON, PROTEINS, 1984 |
| DEALMEIDA ET AL., CANCER RES., vol. 67, 2007, pages 5371 - 9 |
| DEALMEIDA ET AL., CANCER RESEARCH, vol. 67, 2007, pages 5371 - 5379 |
| DENARDO ET AL., CLIN CANCER RES., vol. 4, no. 10, 1998, pages 2483 - 90 |
| DENT: "Good Laboratory and Good Clinical Practice", 2001, URCH PUBL. |
| DIMASI ET AL., J. MOL BIOL., vol. 393, 2009, pages 672 - 692 |
| DIMASI ET AL., J. MOL. BIOL., vol. 393, 2009, pages 672 - 692 |
| DUMOULIN ET AL., NATURE, vol. 424, 2003, pages 783 - 788 |
| DURING ET AL., ANN. NEUROL., vol. 25, 1989, pages 351 |
| E. MEYERS, W. MILLER, COMPUT. APPL. BIOSCI., vol. 4, 1988, pages 11 - 17 |
| ECKERT ET AL., PCR METHODS AND APPLICATIONS, vol. 1, 1991, pages 17 |
| ELLIOT, O'HARE, CELL, vol. 88, 1997, pages 223 |
| EPSTEIN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 3688 - 3692 |
| FISHWILD ET AL., NATURE BIOTECHNOLOGY, vol. 14, 1996, pages 845 - 851 |
| FONTANA ET AL., FOLD. DES., vol. 2, 1997, pages R17 - 26 |
| FRIGUET ET AL., J IMMUNOL METHODS, vol. 77, 1985, pages 305 - 319 |
| GENNARO: "Remington: The Science and Practice of Pharmacy", 2000, LIPPINCOTT, WILLIAMS, AND WILKINS |
| GENTZ ET AL., PROC. NATL. ACAD. SCI. USA, vol. 86, 1989, pages 821 - 824 |
| GEYSEN ET AL., MOL. IMMUNOL., vol. 23, 1986, pages 709 - 715 |
| GEYSEN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 8, 1984, pages 3998 - 4002 |
| GEYSEN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 78 - 182 |
| GHOSH ET AL., NEW ENGL. J. MED., vol. 348, 2003, pages 24 - 32 |
| GLENN E.MORRIS: "Epitope Mapping Protocols in Methods in Molecular Biology", vol. 66, 1996, HUMANA PRESS |
| GLENNIE ET AL., J. IMMUNOL., vol. 139, 1987, pages 2367 - 2375 |
| GOODSON, MEDICAL APPLICATIONS OF CONTROLLED RELEASE, vol. 2, 1984, pages 115 - 138 |
| H.A. ERLICH: "DNA Amplification", 1992, FREEMAN PRESS |
| HAENEL ET AL., ANAL BIOCHEM., vol. 339, 2005, pages 182 - 184 |
| HANSSON ET AL., J. MOL. BIOL., vol. 287, 1999, pages 265 - 76 |
| HARAYAMA, TRENDS BIOTECHNOL., vol. 16, no. 2, 1998, pages 76 - 82 |
| HARDING, LONBERG, ANN. N. Y. ACAD. SCI., vol. 764, 1995, pages 536 - 546 |
| HARDMAN ET AL.: "Goodman and Gilman's The Pharmacological Basis of Therapeutics", 2001, MCGRAW-HILL |
| HARRINGTON ET AL., NAT GENET, vol. 15, 1997, pages 345 |
| HE ET AL., DEVELOPMENT, vol. 31, 2004, pages 1663 - 1677 |
| HELLSTROM ET AL.: "Controlled Drug Delivery", 1987, MARCEL DEKKER, INC., article "Antibodies For Drug Delivery", pages: 623 - 53 |
| HENIKOFF, HENIKOFF, PROC. NATL. ACAD. SCI. USA, vol. 89, 1989, pages 10915 |
| HEROLD ET AL., NEW ENGL. J. MED., vol. 346, 2002, pages 1692 - 1698 |
| HOLLIGER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 6448 |
| HOLLINGER ET AL., PROC NATL ACAD. SCI. U.S.A., vol. 90, 1993, pages 6444 - 6448 |
| HOLLINGER, HUDSON, NATURE BIOTECHNOLOGY, vol. 23, 2005, pages 1126 - 1136 |
| HOPP ET AL., PROC. NATL. ACAD. SCI USA, vol. 78, 1981, pages 3824 - 3828 |
| HOWARD ET AL., J. NEUROSURG., vol. 7 1, 1989, pages 105 |
| HUANG ET AL., NATURE, vol. 461, 2009, pages 614 - 20 |
| HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883 |
| HUSTON ET AL., PROC. NATL. ACAD. SCI., vol. 85, 1988, pages 5879 - 5883 |
| HWANG ET AL., PROC. NATL. ACAD. SCI. USA, vol. 77, 1980, pages 4030 - 4034 |
| INNIS ET AL.: "PCR Protocols: A Guide to Methods and Applications", 1990, ACADEMIC PRESS |
| JAMIESON ET AL., CANCER CELL, vol. 6, 2004, pages 531 - 533 |
| JEON ET AL., NAT. STRUCT. BIOL., vol. 8, 2001, pages 499 - 504 |
| JIMENEZ ET AL., MOLECULAR CANCER THERAPEUTICS, 2005, pages 4427 - 434 |
| JOHNNSON, B. ET AL., ANAL. BIOCHEM., vol. 198, 1991, pages 268 - 277 |
| JOHNSSON, B. ET AL., J. MOL. RECOGNIT., vol. 8, 1995, pages 125 - 131 |
| JONES ET AL., NATURE, vol. 321, 1986, pages 522 - 525 |
| JONSSON, U. ET AL., ANN. BIOL. CLIN., vol. 51, 1993, pages 19 - 26 |
| JONSSON, U., I, BIOTECHNIQUES, vol. 11, 1991, pages 620 - 627 |
| KABAT ET AL.: "Sequences of Proteins of Irnmunological Interest. 5th Ed.", 1991, NIH PUBLICATION NO. 91-3242 |
| KARLIN, ALTSCHUL, PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 5873 - 5787 |
| KARPOVSKY ET AL., J. EXP. MED., vol. 160, 1984, pages 1686 |
| KEINANEN ET AL., FEBS LETT., vol. 346, 1994, pages 123 |
| KILLION ET AL., IMMUNOMETHODS, vol. 4, 1994, pages 273 |
| KIRKLAND ET AL., J. IMMUNOL., vol. 137, 1986, pages 3614 - 3619 |
| KNAPPIK ET AL., J MOL BIOL, vol. 296, 2000, pages 57 - 86 |
| KOHLER, MILSTEIN, NATURE, vol. 256, 1975, pages 495 |
| KUROIWA ET AL., NATURE BIOTECHNOLOGY, vol. 20, 2002, pages 889 - 894 |
| KYTE ET AL., J.MOI. BIOL., vol. 157, 1982, pages 105 - 132 |
| LAM ET AL.: "Microencapsulation of Recombinant Humanized Monoclonal Antibody for Local Delivery", PROC. INT'L. SYMP. CONTROL REL. BIOACT. MATER., vol. 24, 1997, pages 759 - 760 |
| LANGER AND WISE: "Medical Applications of Controlled Release", 1974, CRC PRES. |
| LANGER ET AL., J. BIOMED. MATER. RES., vol. 15, 1981, pages 167 - 277 |
| LANGER, CHEM. TECH., vol. 12, 1982, pages 98 - 105 |
| LANGER, SCIENCE, vol. 249, 1990, pages 1527 - 1533 |
| LAUWEREYS ET AL., EMBO J, vol. 17, 1998, pages 3512 - 3520 |
| LEVY ET AL., SCIENCE, vol. 228, 1985, pages 190 |
| LIPSKY ET AL., NEW ENGL. J. MED., vol. 343, 2000, pages 1594 - 1602 |
| LIU ET AL., J. NEUROL. NEUROSURG. PSYCH., vol. 67, 1999, pages 451 - 456 |
| LIU ET AL., PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 8648 |
| LOGAN ET AL., ANNU. REV CELL DEV. BIOL, vol. 20, 2004, pages 781 - 810 |
| LONBERG ET AL., NATURE, vol. 368, no. 6474, 1994, pages 856 - 859 |
| LONBERG, HUSZAR, INTERN. REV. IMMUNOL., vol. 13, 1995, pages 65 - 93 |
| LONBERG: "Handbook of Experimental Pharmacology", vol. 113, 1994, pages: 49 - 101 |
| LORENZO, BLASCO, BIOTECHNIQUES, vol. 24, no. 2, 1998, pages 308 - 313 |
| LU ET AL., J. OF IMMUN. METHODS, vol. 230, 1999, pages 159 - 171 |
| LU ET AL., JBC, vol. 279, 2004, pages 2856 - 2865 |
| LU ET AL., JBC, vol. 280, 2005, pages 19665 - 19672 |
| M. OWAIS ET AL., ANTIMICROB. AGENTS CHEMOTHER, vol. 39, 1995, pages 180 |
| MARVIN ET AL., ACTA PHARMACOLOGICA SINICA, vol. 26, 2005, pages 649 - 658 |
| MARVIN ET AL., CURR OPIN DRUG DISC DEVELOP, vol. 9, 2006, pages 184 - 193 |
| MATTILA ET AL., NUCLEIC ACIDS RES., vol. 19, 1991, pages 967 |
| MAYNARD ET AL.: "A Handbook of SOFs for Good Clinical Practice", 1996, INTERPHARM PRESS |
| MICHAELSAN ET AL., MABS, vol. 1, 2009, pages 128 - 141 |
| MILGROM ET AL., NEW ENGL. J. MED., vol. 341, 1999, pages 1966 - 1973 |
| MOLDENHAUER ET AL., SCAND. J. IMMUNOL., vol. 32, 1990, pages 77 - 82 |
| MOREL ET AL., MOLEC. IMMUNOL., vol. 25, 1988, pages 7 - 15 |
| MORRISON ET AL., NATURE BIOTECH., vol. 15, 1997, pages 159 - 163 |
| NARANG ET AL., METH. ENZYMOL., vol. 68, 1979, pages 90 |
| NEEDLEMAN, WUNSCH, J. MOL, BIOL, vol. 48, 1970, pages 444 - 453 |
| NEEDLEMAN, WUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 443 |
| NING ET AL.: "Intratumoral Radioimmunotheraphy of a Human Colon Cancer Xenograft Using a Sustained-Release Gel", RADIOTHERAPY & ONCOLOGY, vol. 39, 1996, pages 179 - 189 |
| OHTSUKA ET AL., J. BIOL. CHEM., vol. 260, 1985, pages 2605 - 2608 |
| P. G. BLOEMAN ET AL., FEBS LETT., vol. 357, 1995, pages 140 |
| PASTAN, KREITMAN, CURR. OPIN. INVESTIG. DRUGS, vol. 3, 2002, pages 089 - 910 |
| PATTEN ET AL., CURR. OPINION BIOTECHNOL., vol. 8, 1997, pages 724 - 33 |
| PAULUS, BEHRING INS. MITT., vol. 78, 1985, pages 118 - 132 |
| PAYNE, CANCER CELL, vol. 3, 2003, pages 207 - 212 |
| PEARSON, LIPMAN, PROC. NAT'L. ACAD. SCI. USA, vol. 85, 1988, pages 2444 |
| PETERSON ET AL., BIOCONJUG. CHEM., vol. 10, no. 4, 1999, pages 553 - 7 |
| PINSON ET AL., NATURE, vol. 407, 2000, pages 535 - 538 |
| PLESCHBERGER ET AL., BIOCONJUGATE CHEM, vol. 14, 2003, pages 440 - 448 |
| POLJAK ET AL., STRUCTURE, vol. 2, 1994, pages 1121 - 1123 |
| POOLE AND PETERSON: "Pharmacotherapeutics for Advanced Practice:A Practical Approach", 2001, LIPPINCOTT, WILLIAMS & WILKINS |
| PORTIELJI ET AL., CANCER IMMUNOL. IMMUNOTHER., vol. 52, 2003, pages 133 - 144 |
| QUEEN ET AL., IMMUNOL. REV., vol. 89, 1986, pages 49 - 68 |
| QUEEN ET AL., PROC. NATL. ACAD., U.S.A., vol. 86, 1989, pages 10029 - 10033 |
| RANGER, PEPPAS, J., MACROMOL. SCI. REV. MACROMOL. CHEM., vol. 23, 1983, pages 61 |
| RIECHMANN ET AL., NATURE, vol. 332, 1998, pages 323 - 327 |
| RONDOT ET AL., NAT BIOTECHNOL, vol. 19, 2001, pages 75 - 78 |
| ROSENFELD ET AL., CELL, vol. 68, 1992, pages 143 |
| ROSSOLINI ET AL., MOL. CELL. PROBES, vol. 8, 1994, pages 91 - 98 |
| ROTHE ET AL., J MOL BIOL, 2007 |
| S. A. ETTENBERG ET AL: "Inhibition of tumorigenesis driven by different Wnt proteins requires blockade of distinct ligand-binding regions by LRP6 antibodies", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES, vol. 107, no. 35, 31 August 2010 (2010-08-31), pages 15473 - 15478, XP055002447, ISSN: 0027-8424, DOI: 10.1073/pnas.1007428107 * |
| SAITO ET AL., ADV. DRUG DELIV. REV., vol. 55, 2003, pages 199 - 215 |
| SANCHEZ-RUIZ ET AL., BIOCHEMISTRY, vol. 27, 1988, pages 1648 - 52 |
| SAUDEK ET AL., N. ENGL. J. MED., vol. 321, 1989, pages 574 |
| SCHARF ET AL., RESULTS PROBL. CELL DIFFER., vol. 20, 1994, pages 125 |
| SCHREIER ET AL., J. BIOL. CHEM., vol. 269, 1994, pages 9090 |
| SEFTON, CRC CRIT. REF BIOMED. ENG., vol. 14, 1987, pages 20 |
| SEMENOV ET AL., CURR. BIOL, vol. 11, 2001, pages 951 - 961 |
| SENTER, SPRINGER, ADV. DRUG DELIV. REV., vol. 53, 2001, pages 247 - 264 |
| SHEN ET AL., J IMMUN METHODS, vol. 218, 2007, pages 65 - 74 |
| SHIELDS ET AL., J. BIOL. CHEM., vol. 277, 2002, pages 26733 - 26740 |
| SHIELDS ET AL., J. BIOL. CHEN., vol. 276, 2001, pages 6591 - 6604 |
| SIDMAN ET AL., BIOPOLYMERS, vol. 22, 1983, pages 547 - 556 |
| SLAMON ET AL., NEW ENGL. J. MED., vol. 344, 2001, pages 783 - 792 |
| SMITH, ANNU. REV. MICROBIOL., vol. 49, pages 807 |
| SMITH, WATERMAN, ADV. APPL. MATH., vol. 2, 1970, pages 482C |
| SMOLEN AND BALL: "Controlled Drug Bioavailability, Drug Product Design and Performance", 1984, WILEY |
| SONG ET AL.: "Antibody Mediated Lung Targeting of Long-Circulating Emulsions", PDA JOURNAL OF PHARMACEUTICAL SCIENCE & TECHNOLOGY, vol. 50, 1995, pages 372 - 397 |
| SPRINGER ET AL., J. MOL. BIOL., vol. 283, 1998, pages 837 - 862 |
| STAHLI ET AL., METHODS IN ENZYMOLOGY, vol. 9, 1983, pages 242 - 253 |
| STIJIEMANS ET AL., J BIOL CHEM, vol. 279, 2004, pages 1256 - 1261 |
| SURESH ET AL., METHODS ENZYMOL., vol. 121, 1986, pages 210 - 28 |
| SUZUKI ET AL., NAT GENET., vol. 36, 2004, pages 417 - 422 |
| TAMAI ET AL., NATURE, vol. 407, 2000, pages 530 - 535 |
| TANIGUCHI ET AL., ONCOGENE, vol. 24, 2005, pages 7946 - 7952 |
| TAYLOR ET AL., INTERNATIONAL IMMUNOLOGY, 1994, pages 579 - 591 |
| TAYLOR ET AL., NUCLEIC ACIDS RESEARCH, vol. 20, 1992, pages 6287 - 6295 |
| THORPE ET AL., IMMUNOL. REV., vol. 62, 1982, pages 119 - 58 |
| THORPE ET AL.: "Monoclonal Antibodies 84: Biological And Clinical Applications", 1985, article "Antibody Carriers Of Cytotoxic Agents In Cancer Therapy: A Review", pages: 475 - 506 |
| TOMIZUKA ET AL., PROC. NATL. ACAD. SCI. USA, vol. 97, 2000, pages 722 - 727 |
| TOMLINSON ET AL., J. FOL. BIOL., vol. 227, 1992, pages 776 - 798 |
| TRAIL ET AL., CANCER IMMUNOL. IMMUNOTHER., vol. 52, 2003, pages 328 - 337 |
| TUAILLON ET AL., J. IMMUNOL., vol. 152, 1994, pages 2912 - 2920 |
| TUAILLON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 94, 1993, pages 3720 - 3724 |
| UMANA ET AL., NAT. BIOTECH., vol. 17, 1999, pages 176 - 180 |
| UMEZAWA ET AL., BIOCHEM. BIOPHYS. RES. COMMUN., vol. 153, 1988, pages 1038 |
| V. V. RANADE, J. CLIN. PHARMACOL., vol. 29, 1989, pages 685 |
| VAN DER WETERING ET AL., CELL, vol. 111, 2002, pages 241 - 250 |
| VAN DER WETERING ET AL., EMBO REPORTS, vol. 4, 2003, pages 609 - 615 |
| VAN MIERLO, STEEMSMA, J. BIOTECHNOL., vol. 79, no. 3, 2000, pages 281 - 98 |
| VEECK ET AL., ONCOGENE, vol. 25, 2006, pages 3479 - 3488 |
| VIL ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 11337 - 11341 |
| WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 546 |
| WAWRZYNCZAK: "Antibody Therapy", 1996, BIOS SCIENTIFIC PUB. LTD |
| WEINER, KOTKOSKIE: "Excipient Toxicity and Safety", 2000, MARCEL DEKKER, INC. |
| WIEDERSCHAIN ET AL., CELL CYCLE, vol. 8, 2009, pages 498 - 504 |
| WILLIAM HUMPHREY ET AL., J. MOLECULAR GRAPHICS, vol. 14, 1996, pages 33 - 38 |
| WILSON ET AL., CELL, vol. 37, 1984, pages 767 |
| WINNACKER: "FROM GENES TO CLONES", 1987, VCH PUBLISHERS |
| WU ET AL., NAT BIOTECHNOL., vol. 11, 2007, pages 1290 - 1297 |
| YANG ET AL., NEW ENGL. J. MED., vol. 349, 2003, pages 427 - 434 |
| ZAPATA ET AL., PROTEIN ENG., vol. 8, 1995, pages 1057 - 1062 |
| ZENG ET AL., HUM. PATHOL., vol. 38, 2007, pages 120 - 133 |
| ZHAO ET AL., CANCER CELL, vol. 12, 2007, pages 528 - 541 |
| ZHENG ET AL., J. IMMUNOL., vol. 154, 1995, pages 5590 - 5600 |
| ZHU ET AL., CANCER LETT., vol. 86, 1994, pages 27 - 34 |
| ZIMMERMAN ET AL., NUCL. MED. BIOL., vol. 26, no. 8, 1999, pages 943 - 50 |
| ZUO ET AL., PROTEIN ENGINEERING, vol. 13, 2000, pages 351 - 367 |
Cited By (34)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP2567709B1 (en) | 2007-11-02 | 2017-12-27 | Novartis AG | Molecules and methods for modulating low-density-lipoprotein receptor-related protein 6 (LRP6) |
| US8846041B2 (en) | 2010-03-24 | 2014-09-30 | Genentech, Inc. | Anti-LRP6 antibodies |
| US9556267B2 (en) | 2010-03-24 | 2017-01-31 | Genentech, Inc. | Anti-LRP6 antibodies |
| US9290573B2 (en) | 2010-05-06 | 2016-03-22 | Novartis Ag | Therapeutic low density lipoprotein-related protein 6 (LRP6) multivalent antibodies |
| US9428583B2 (en) | 2010-05-06 | 2016-08-30 | Novartis Ag | Compositions and methods of use for therapeutic low density lipoprotein-related protein 6 (LRP6) multivalent antibodies |
| US10202451B2 (en) | 2010-10-04 | 2019-02-12 | Boehringer Ingelheim International Gmbh | CD33 binding agents |
| EP2655415A4 (en) * | 2010-12-22 | 2016-03-09 | Abbvie Inc | THREE VARIABLE DOMAIN LINK PROTEINS AND USES THEREOF |
| US9173960B2 (en) | 2011-11-04 | 2015-11-03 | Novartis Ag | Methods of treating cancer with low density lipoprotein-related protein 6 (LRP6)—half life extender constructs |
| US8883735B2 (en) | 2011-11-04 | 2014-11-11 | Novartis Ag | Low density lipoprotein-related protein 6 (LRP6)-half life extender constructs |
| EP3252075A1 (en) * | 2011-11-04 | 2017-12-06 | Novartis AG | Low density lipoprotein-related protein 6 (lrp6) - half life extender constructs |
| USRE47860E1 (en) | 2011-11-04 | 2020-02-18 | Novartis Ag | Methods of treating cancer with low density lipoprotein-related protein 6 (LRP6)—half life extender constructs |
| EP3290442A1 (en) * | 2011-11-04 | 2018-03-07 | Novartis AG | Low density lipoprotein-related protein 6 (lrp6) half-life extender constructs |
| WO2013067355A1 (en) * | 2011-11-04 | 2013-05-10 | Novartis Ag | Low density lipoprotein-related protein 6 (lrp6) - half life extender constructs |
| US12559542B2 (en) | 2012-07-26 | 2026-02-24 | Momenta Pharmaceuticals, Inc. | Glycoproteins with anti-inflammatory properties |
| WO2014029752A1 (en) * | 2012-08-22 | 2014-02-27 | Glaxo Group Limited | Anti lrp6 antibodies |
| US12428497B2 (en) | 2014-06-25 | 2025-09-30 | UCB Biopharma SRL | Multispecific antibody constructs |
| US11345760B2 (en) | 2014-06-25 | 2022-05-31 | UCB Biopharma SRL | Multispecific antibody constructs |
| CN108289943A (zh) * | 2015-12-04 | 2018-07-17 | 勃林格殷格翰国际有限公司 | 在肿瘤细胞中拮抗wnt信号传递的双互补位多肽 |
| IL259119A (en) * | 2015-12-04 | 2018-06-28 | Boehringer Ingelheim Int | Biparatopic polypeptides antagonistic to wnt signaling in epithelial cells |
| CN108289943B (zh) * | 2015-12-04 | 2023-06-20 | 勃林格殷格翰国际有限公司 | 在肿瘤细胞中拮抗wnt信号传递的双互补位多肽 |
| US10597449B2 (en) | 2015-12-04 | 2020-03-24 | Boehringer Ingelheim International Gmbh | Biparatopic polypeptides antagonizing Wnt signaling in tumor cells |
| WO2017093478A1 (en) * | 2015-12-04 | 2017-06-08 | Boehringer Ingelheim International Gmbh | Biparatopic polypeptides antagonizing wnt signaling in tumor cells |
| US11952418B2 (en) | 2015-12-04 | 2024-04-09 | Boehringer Ingelheim International Gmbh | Biparatopic polypeptides antagonizing Wnt signaling in tumor cells |
| EP3797790A1 (en) | 2015-12-04 | 2021-03-31 | Boehringer Ingelheim International GmbH | Biparatopic polypeptides antagonizing wnt signaling in tumor cells |
| TWI734719B (zh) * | 2015-12-04 | 2021-08-01 | 德商百靈佳殷格翰國際股份有限公司 | 在腫瘤細胞中拮抗wnt信號傳遞之雙抗體結合部位(biparatopic)多肽 |
| AU2016363787B2 (en) * | 2015-12-04 | 2023-02-02 | Ablynx N.V. | Biparatopic polypeptides antagonizing Wnt signaling in tumor cells |
| EP3541423A4 (en) * | 2016-11-18 | 2020-10-07 | The Regents of The University of California | MODIFIED ANTIBODIES AND THEIR USES |
| US11702480B2 (en) | 2016-11-18 | 2023-07-18 | The Regents Of The University Of California | Engineered antibodies and uses thereof |
| WO2018220080A1 (en) | 2017-05-31 | 2018-12-06 | Boehringer Ingelheim International Gmbh | Polypeptides antagonizing wnt signaling in tumor cells |
| US12297278B2 (en) | 2017-12-19 | 2025-05-13 | Surrozen Operating, Inc. | Wnt surrogate molecules and uses thereof |
| WO2020080941A1 (en) * | 2018-10-16 | 2020-04-23 | Umc Utrecht Holding B.V. | Anti- low-density lipoprotein receptor-related protein 5/6 antibodies |
| EP3911682A4 (en) * | 2019-01-14 | 2023-03-15 | The Regents of the University of California | COMPOSITIONS AND METHODS TO MODULATE CELLULAR INTERNALIZATION |
| US11578129B2 (en) | 2019-03-29 | 2023-02-14 | Boehringer Ingelheim International Gmbh | LRP5 and PD-1 antagonist anticancer combination therapy |
| WO2020200998A1 (en) * | 2019-03-29 | 2020-10-08 | Boehringer Ingelheim International Gmbh | Anticancer combination therapy |
Also Published As
| Publication number | Publication date |
|---|---|
| AU2011249782B2 (en) | 2014-10-02 |
| JP2023182590A (ja) | 2023-12-26 |
| JP2020063262A (ja) | 2020-04-23 |
| US9290573B2 (en) | 2016-03-22 |
| IL222814A0 (en) | 2012-12-31 |
| JP2013527761A (ja) | 2013-07-04 |
| US20130064823A1 (en) | 2013-03-14 |
| CL2012003093A1 (es) | 2013-03-22 |
| TN2012000512A1 (en) | 2014-04-01 |
| CN103237811A (zh) | 2013-08-07 |
| ZA201208050B (en) | 2013-06-26 |
| GT201200298A (es) | 2014-04-08 |
| JP6678627B2 (ja) | 2020-04-08 |
| MX2012012927A (es) | 2013-05-01 |
| SG185415A1 (en) | 2012-12-28 |
| CL2014001297A1 (es) | 2014-10-03 |
| BR112012028326A2 (pt) | 2017-03-21 |
| CA2798390A1 (en) | 2011-11-10 |
| CO6630180A2 (es) | 2013-03-01 |
| JP2018023381A (ja) | 2018-02-15 |
| EA201291181A1 (ru) | 2013-05-30 |
| PH12012502193A1 (en) | 2021-08-09 |
| EP2566894A1 (en) | 2013-03-13 |
| MA34287B1 (fr) | 2013-06-01 |
| KR20130066631A (ko) | 2013-06-20 |
| PE20130206A1 (es) | 2013-02-28 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US9290573B2 (en) | Therapeutic low density lipoprotein-related protein 6 (LRP6) multivalent antibodies | |
| US20200377603A1 (en) | Compositions and methods of use for therapeutic low density lipoprotein - related protein 6 (lrp6) multivalent antibodies | |
| AU2011249782A1 (en) | Compositions and methods of use for therapeutic low density lipoprotein - related protein 6 (LRP6) multivalent antibodies | |
| JP6416161B2 (ja) | 上皮細胞増殖因子受容体3(her3)に対する抗体 | |
| WO2013084148A2 (en) | Antibodies for epidermal growth factor receptor 3 (her3) directed to domain ii of her3 | |
| CA2857939A1 (en) | Antibodies for epidermal growth factor receptor 3 (her3) directed to domain iii and domain iv of her3 | |
| AU2014227432A1 (en) | Compositions and methods of use for therapeutic low density lipoprotein - related protein 6 (LRP6) multivalent antibodies | |
| HK1178911A (en) | Compositions and methods of use for therapeutic low density lipoprotein -related protein 6 (lrp6) antibodies | |
| HK1178911B (en) | Compositions and methods of use for therapeutic low density lipoprotein -related protein 6 (lrp6) antibodies |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 11723308 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 222814 Country of ref document: IL Ref document number: 9415/DELNP/2012 Country of ref document: IN |
|
| ENP | Entry into the national phase |
Ref document number: 2013508500 Country of ref document: JP Kind code of ref document: A Ref document number: 2798390 Country of ref document: CA |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 13696372 Country of ref document: US Ref document number: 1201005799 Country of ref document: TH Ref document number: 12199729 Country of ref document: CO Ref document number: 002124-2012 Country of ref document: PE Ref document number: 12012502193 Country of ref document: PH Ref document number: MX/A/2012/012927 Country of ref document: MX |
|
| WWE | Wipo information: entry into national phase |
Ref document number: DZP2012000825 Country of ref document: DZ |
|
| ENP | Entry into the national phase |
Ref document number: 20127031869 Country of ref document: KR Kind code of ref document: A |
|
| REEP | Request for entry into the european phase |
Ref document number: 2011723308 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2011723308 Country of ref document: EP Ref document number: 201291181 Country of ref document: EA |
|
| ENP | Entry into the national phase |
Ref document number: 2011249782 Country of ref document: AU Date of ref document: 20110505 Kind code of ref document: A |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112012028326 Country of ref document: BR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2014001297 Country of ref document: CL |
|
| ENP | Entry into the national phase |
Ref document number: 112012028326 Country of ref document: BR Kind code of ref document: A2 Effective date: 20121105 |