WO2011116238A2 - Light-sensitive ion-passing molecules - Google Patents
Light-sensitive ion-passing molecules Download PDFInfo
- Publication number
- WO2011116238A2 WO2011116238A2 PCT/US2011/028893 US2011028893W WO2011116238A2 WO 2011116238 A2 WO2011116238 A2 WO 2011116238A2 US 2011028893 W US2011028893 W US 2011028893W WO 2011116238 A2 WO2011116238 A2 WO 2011116238A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- light
- cell
- protein
- amino acid
- animal
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/405—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from algae
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K67/00—Rearing or breeding animals, not otherwise provided for; New or modified breeds of animals
- A01K67/027—New or modified breeds of vertebrates
- A01K67/0271—Chimeric vertebrates, e.g. comprising exogenous cells
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K67/00—Rearing or breeding animals, not otherwise provided for; New or modified breeds of animals
- A01K67/027—New or modified breeds of vertebrates
- A01K67/0275—Genetically modified vertebrates, e.g. transgenic
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61N—ELECTROTHERAPY; MAGNETOTHERAPY; RADIATION THERAPY; ULTRASOUND THERAPY
- A61N5/00—Radiation therapy
- A61N5/06—Radiation therapy using light
- A61N5/0601—Apparatus for use inside the body
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61N—ELECTROTHERAPY; MAGNETOTHERAPY; RADIATION THERAPY; ULTRASOUND THERAPY
- A61N5/00—Radiation therapy
- A61N5/06—Radiation therapy using light
- A61N5/0613—Apparatus adapted for a specific treatment
- A61N5/062—Photodynamic therapy, i.e. excitation of an agent
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/14—Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
- A61P25/16—Anti-Parkinson drugs
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/06—Linear peptides containing only normal peptide links having 5 to 11 amino acids
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/08—Linear peptides containing only normal peptide links having 12 to 20 amino acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2207/00—Modified animals
- A01K2207/05—Animals modified by non-integrating nucleic acids, e.g. antisense, RNAi, morpholino, episomal vector, for non-therapeutic purpose
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2227/00—Animals characterised by species
- A01K2227/10—Mammal
- A01K2227/105—Murine
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2267/00—Animals characterised by purpose
- A01K2267/03—Animal model, e.g. for test or diseases
- A01K2267/0393—Animal model comprising a reporter system for screening tests
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61N—ELECTROTHERAPY; MAGNETOTHERAPY; RADIATION THERAPY; ULTRASOUND THERAPY
- A61N5/00—Radiation therapy
- A61N5/06—Radiation therapy using light
- A61N2005/0626—Monitoring, verifying, controlling systems and methods
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61N—ELECTROTHERAPY; MAGNETOTHERAPY; RADIATION THERAPY; ULTRASOUND THERAPY
- A61N5/00—Radiation therapy
- A61N5/06—Radiation therapy using light
- A61N2005/063—Radiation therapy using light comprising light transmitting means, e.g. optical fibres
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61N—ELECTROTHERAPY; MAGNETOTHERAPY; RADIATION THERAPY; ULTRASOUND THERAPY
- A61N5/00—Radiation therapy
- A61N5/06—Radiation therapy using light
- A61N2005/065—Light sources therefor
- A61N2005/0651—Diodes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61N—ELECTROTHERAPY; MAGNETOTHERAPY; RADIATION THERAPY; ULTRASOUND THERAPY
- A61N5/00—Radiation therapy
- A61N5/06—Radiation therapy using light
- A61N2005/0658—Radiation therapy using light characterised by the wavelength of light used
- A61N2005/0662—Visible light
- A61N2005/0663—Coloured light
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/10011—Adenoviridae
- C12N2710/10041—Use of virus, viral particle or viral elements as a vector
- C12N2710/10043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/16011—Herpesviridae
- C12N2710/16611—Simplexvirus, e.g. human herpesvirus 1, 2
- C12N2710/16641—Use of virus, viral particle or viral elements as a vector
- C12N2710/16643—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/10041—Use of virus, viral particle or viral elements as a vector
- C12N2740/10043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/15011—Lentivirus, not HIV, e.g. FIV, SIV
- C12N2740/15041—Use of virus, viral particle or viral elements as a vector
- C12N2740/15043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2750/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
- C12N2750/00011—Details
- C12N2750/14011—Parvoviridae
- C12N2750/14111—Dependovirus, e.g. adenoassociated viruses
- C12N2750/14141—Use of virus, viral particle or viral elements as a vector
- C12N2750/14143—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2799/00—Uses of viruses
- C12N2799/02—Uses of viruses as vector
- C12N2799/021—Uses of viruses as vector for the expression of a heterologous nucleic acid
- C12N2799/025—Uses of viruses as vector for the expression of a heterologous nucleic acid where the vector is derived from a parvovirus
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2800/00—Nucleic acids vectors
- C12N2800/10—Plasmid DNA
- C12N2800/106—Plasmid DNA for vertebrates
- C12N2800/107—Plasmid DNA for vertebrates for mammalian
Definitions
- aspects of the present disclosure relate generally to systems and approaches for stimulating target cells, and more particularly to using optics to stimulate the target cells.
- the stimulation of various cells of the body has been used to produce a number of beneficial effects.
- One method of stimulation involves the use of electrodes to introduce an externally generated signal into cells.
- One problem faced by electrode-based brain stimulation techniques is the distributed nature of neurons responsible for a given mental process. Conversely, different types of neurons reside close to one another such that only certain cells in a given region of the brain are activated while performing a specific task.
- heterogeneous nerve tracts move in parallel through tight spatial confines, but the cell bodies themselves may exist in mixed, sparsely embedded configurations. This distributed manner of processing seems to defy the best attempts to understand canonical order within the CNS, and makes
- Electrode-based stimulation a difficult therapeutic endeavor.
- This architecture of the brain poses a problem for electrode-based stimulation because electrodes are relatively indiscriminate with regards to the underlying physiology of the neurons that they stimulate. Instead, physical proximity of the electrode poles to the neuron is often the single largest determining factor as to which neurons will be stimulated. Accordingly, it is generally not feasible to absolutely restrict stimulation to a single class of neuron using electrodes.
- Electrodes for stimulation Another issue with the use of electrodes for stimulation is that because electrode placement dictates which neurons wiii be stimulated, mechanical stability is frequently inadequate, and results in lead migration of the electrodes from the targeted area.
- electrode leads frequently become encapsulated with glial cells, raising the effective electrical resistance of the electrodes, and hence the electrical power delivery required to reach targeted cells.
- Compensatory increases in voltage, frequency or pulse width may spread the electrical current and increase the unintended stimulation of additional cells.
- Another method of stimulus uses photosensitive bio-molecular structures to stimulate target cells in response to light.
- light activated proteins can be used to control the flow of ions through cell membranes.
- the cell By facilitating or inhibiting the flow of positive or negative ions through cell membranes, the cell can be briefly depolarized, depolarized and maintained in that state, or hyperpolarized.
- Neurons are an example of a type of cell that uses the electrical currents created by depolarization to generate communication signals (i.e., nerve impulses).
- Other electrically excitable cells include skeletal muscle, cardiac muscle, and endocrine cells.
- Neurons use rapid depolarization to transmit signals throughout the body and for various purposes, such as motor control (e.g., muscle contractions), sensory responses (e.g., touch, hearing, and other senses) and computational functions (e.g., brain functions).
- motor control e.g., muscle contractions
- sensory responses e.g., touch, hearing, and other senses
- computational functions e.g., brain functions.
- control of the depolarization of cells can be beneficial for a number of different purposes, including (but not limited to) psychological therapy, muscle control and sensory functions.
- opsin capable of inhibiting neural activity.
- the opsin comes from cryptophytes
- G. thetd Guillardia theta
- the opsin of interest is the third opsin isolated from G. theta, and is abbreviated GtR3.
- GtR3 is capable of mediating a hyperpolarizing current when illuminated with light. Characterization of the action spectra for GtR3 suggests that the absorption maxima are around 490nm, and GtR3 is not activated by yellow light.
- Various aspects of the present invention are directed to a blue-light sensing channelrhodopsin capable of exciting neural activity.
- the channelrhodopsin is derived from Dunaliella salina.
- the channelrhodopsin of interest is abbreviated as DChR.
- DChR can be heterologously expressed in mammalian neurons and mediates a robust depolarizing current when illuminated with blue light.
- the action maxima for DChR are around 500nm.
- an inhibitory current flow is created by engineering a protein derived from Guillardia theta that responds to light by producing an inhibitory current to dissuade depolarization of a neuron.
- the protein is delivered to a neuron of interest and the neuron is exposed to light.
- a method of optical stimulation of a cell expressing a GtR3 proton pump comprises providing a sequence of stimuli to the cell, each stimulus increasing the probability of a depolarizing event occurring in the cell.
- Light is provided to the cell to activate the expression of the GtR3 proton pump, thereby decreasing the probability of the depolarizing event occurring in the cell.
- the light provided is in the blue light spectrum.
- a system for controlling an action potential of a neuron or other cell in vivo comprises a delivery device that introduces a protein responsive to blue light to the neuron or cell.
- the protein responsive to blue light produces an inhibitory current in response to blue light.
- the system includes a blue light source that generates light for stimulation of the blue light responsive protein and a control device that controls the generation of light by the light source.
- a method for providing a light responsive protein for mammalian expression is disclosed.
- a light responsive protein is isolated from G. theta.
- the isolated protein has a C-terminus and an N-terminus.
- An endoplasmic reticulum (ER) export signal is added to the C-terminus of the isolated protein to create an enhanced light responsive protein.
- the enhanced protein is placed in an empty virus vector for delivery to a cell of interest.
- the virus vector with the enhanced protein is then delivered to the cell of interest.
- an animal cell includes an integrated exogenous molecule which expresses a proton pump responsive to blue light.
- the exogenous molecule is derived from G. theta.
- the animal cell is a neural cell.
- the animal cell may also be a muscle cell or a cell line, for example.
- FIG. 1 A shows an ion pump in an organelle membrane
- FIG. I B shows an ion pump in a cell membrane
- FIG. 2 A shows cell populations expressing combinations of light responsive proteins
- FIG. 2B shows a stimulus profile for use with certain embodiments in which two or more light responsive proteins are introduced into the same cell population
- FIG. 3 shows a block diagram of a system for stimulating target cells, according to an example embodiment of the present invention
- FIG. 4 shows a block diagram of an implantable device for stimulating target cells, according to an example embodiment of the present invention
- FIG. 5 shows a block diagram of an implantable device, according to an example embodiment of the present invention.
- FIG. 6A shows a block diagram of an implantable device, according to an example embodiment of the present invention.
- FIG. 6B shows a circuit diagram corresponding to the block diagram of FIG. 6A, according to an example embodiment of the present invention
- FIGs. 7A and FIG. 7B show a diagram of a mesh for containing photosensitive bio-molecules, according to an example embodiment of the present invention
- FIGs. 8A and FIG. 8B show a diagram of a viral matrix, according to an example embodiment of the present invention.
- FIG. 9 shows a circuit diagram of a circuit that produces light in response to a magnetic field, according to an example embodiment of the present invention.
- FIGs. 10A, 10B and IOC show a block diagram and circuits for the production of light in response to a RF signal, according to an example embodiment of the present invention
- FIGs. 11 A and FIG. 1 IB each show a diagram of a fiber-optic device, according to an example embodiment of the present invention
- FIGs. 12A, 12B, 12C and 12D depict various stages in the production of a photosensitive biological portion, according to an example embodiment of the present invention.
- FIG. 13 shows an implantation device, according to an example embodiment of the present invention.
- FIGs. 14A and FIG. 14B show a diagram for another implantation device, according to an example embodiment of the present invention.
- FIG. 15 depicts an arrangement with multiple light sources, according to an example embodiment of the present invention
- FIG. 16 shows a system for controlling electrical properties of one or more cells in vivo, according to an example embodiment of the present invention
- FIG. 17 shows a system for controlling electrical properties of one or more cells in vivo, according to an example embodiment of the present invention
- FIG. 18A shows a block diagram of a system for optical drug screening, according to an example embodiment of the present invention.
- FIG. 18B shows a specific system diagram of a large-format, quasi-automated system for drug screening in accordance with the present methodology, according to an example embodiment of the present invention
- FIG. 19 shows a system diagram of a small-format, fully automated drug screening system which operates in accordance with the invented methodology, according to an example embodiment of the present invention
- FIG. 20A depicts the workings of an example of emitter/detector units, according to an example embodiment of the present invention
- FIG. 20B depicts the workings of another embodiment of emitter/detector units, according to an example embodiment of the present invention.
- FIG. 21 A and 21B depict an electronic circuit mechanism for activating the LED emitters used within the emitter/detector units, according to an example embodiment of the present invention
- FIG. 22 shows a timeline for a sequence of events in the context of an example screening process, according to an example embodiment of the present invention
- FIG. 23 illustrates an example of a layout of cell and drug samples within the wells of a well-plate, according to an example embodiment of the present invention
- FIG. 24 illustrates the context in which the disclosed invention may be employed within a larger system that facilitates high-throughput drug screening, according to an example embodiment of the present invention.
- FIG. 25D shows representative photocurrent traces showing in cells transduced with eNpHR3.0 and cells transduced with eNpHR2.0, and summary plots thereof;
- FIG. 25E shows representative hyperpolarization voltage traces showing in cells transduced with eNpHR3.0 and cells transduced with eNpHR2.0, and summary plots thereof;
- FIG. 26B shows a model of trans-synaptic gene activation by WGA-Cre-fusion.
- the schematic depicts two injection sites (one with WGA-Cre-fusion gene and another with Cre-dependent opsin virus) and long range projections; Cre can be trans- synaptically delivered from transduced cells to activate distant gene expression only in synaptically connected neurons that have received the Cre-dependent virus.
- FIG. 26C shows construct design for the WGA-Cre and Cre-dependent AAV vectors optimized with mammalian codons
- FIG. 27D shows that illumination with red and far-red/infrared border light inhibited spiking induced by current injection in neurons expressing eNpHR3.0.
- Typical current-clamp traces show optical inhibition at 630 nm (top left), 660 nm (top right), and 680 nm (bottom).
- Power density 3.5 mW/mm 2 (630 nm) and 7 mW/mm 2 (660 nm, 680 nm).
- FIG. 27G shows that blue light (445 nm, 5 ms pulses) drove spiking at 20 Hz (left) and 10 Hz (right), while simultaneous application of yellow light (590 nm) inhibited spikes.
- FIG. 27F shows activation spectrums for eNPAC, ChR2 (H134R), and eNpHR3.0 alone;
- FIG. 28B shows five hundred sixty nanometer light induced outward
- FIG. 28C shows five hundred sixty nanometer light induced hyperpolarizations in eBR cells, and the corresponding sample trace in current clamp;
- FIG. 29A shows general subcellular targeting strategies for adapting microbial opsin genes to metazoan intact-systems biology
- FIG. 29B shows refinement of targeting at the tissue and subcellular levels
- FIG. 30 A shows stability and recovery of potent photocurrents in cells expressing eNpHR3.0 when exposed to pairs of 10 second long yellow light pulses separated in time by: 2.5 seconds, 5 seconds, 10 seconds, and 20 seconds;
- FIG. 30B shows a timecourse of eNpHR3.0 normalized photocurrents for long- term continuous light exposure
- FIG. 30C shows stability of outward current of eNpHR3.0 over greater than 10 minutes.
- FIG. 31C shows sample current clamp and voltage clamp traces and summary data of GtR3 function under 472 nm light.
- the present invention is believed to be useful for facilitating practical application of a variety of photosensitive bio-molecular structures, and the invention has been found to be particularly suited for use in arrangements and methods dealing with cellular membrane voltage control and stimulation. While the present invention is not necessarily limited to such applications, various aspects of the invention may be appreciated through a discussing of various examples using this context.
- stimulation of a target cell is generally used to describe modification of properties of the cell.
- the stimulus of a target cell may result in a change in the properties of the cell membrane that can lead to the
- the target cell is a neuron and the stimulus affects the transmission of impulses by facilitating or inhibiting the generation of impulses by the neuron.
- a light- responsive protein is engineered in a cell.
- the protein affects a flow of ions (anions, cations or protons) across the cell membrane in response to light. This change in ion flow creates a corresponding change in the electrical properties of the cells including, for example, the voltage and current flow across the cell membrane.
- the protein functions in vivo using an endogenous cofactor to modify ion flow across the cell membrane.
- the protein changes the voltage across the cell membrane so as to dissuade or encourage action potential firing in the cell.
- the protein is capable of changing the electrical properties of the cell within several milliseconds of the light being introduced.
- An inhibitory protein dissuades firing of the action potential by moving the potential of the cell away from the action potential trigger level for the cell. In many neurons, this means that the protein increases the negative voltage seen across the cell membrane. In a specific instance, the protein acts as a proton pump that actively transfers protons out of the cell. In this manner, the protein generates an inhibitory current across the cell membrane. More specifically, the protein responds to light by lowering the voltage across the cell, thereby decreasing the probability that an action potential or depolarization will occur.
- Certain aspects of the present invention are based on the identification and development of a molecule/protein that functions as a proton pump.
- This proton pump is derived from the cryptophyte Guillardia theta (G. theta) and has been developed for expression in target cells.
- the cell is a neuron.
- the engineered protein, GtR3, responds to blue light by producing an inhibitory current to dissuade depolarization of the cell.
- the proton pump When expressed in neural cells the proton pump (GtR3) can be used to inhibit neural activity in response to blue light stimulation.
- the GtR3 pump responds to optical stimulus by creating an inhibitory current across the neural membrane. This current inhibits action potentials while the modified cell is exposed to (blue) light.
- the present disclosure also provides for the modification of light-activated proteins expressed in a cell by the addition of one or more amino acid sequence motifs which enhance transport to the plasma membranes of mammalian cells.
- Light-activated proteins derived from evolutionarily simpler organisms may not be expressed or tolerated by mammalian cells or may exhibit impaired subcellular localization when expressed at high levels in mammalian cells. Consequently, in some embodiments, the light-activated protein expressed in a cell is fused to one or more amino acid sequence motifs selected from the group consisting of a signal peptide, an endoplasmic reticulum (ER) export signal, a membrane trafficking signal, and an N-terminal golgi export signal.
- ER endoplasmic reticulum
- the one or more amino acid sequence motifs which enhance light-activated protein transport to the plasma membranes of mammalian cells can be fused to the N-terminus, the C-terminus, or to both the N- and C-terminal ends of the light-activated protein.
- the light-activated protein and the one or more amino acid sequence motifs may be separated by a linker. Additional protein motifs which can enhance light- activated protein transport to the plasma membrane of a cell are described in U.S. Patent Application No. 12/041,628 which is incorporated herein in its entirety.
- the present disclosure additionally provides for light-activated proteins which contain amino acid substitutions, deletions, and insertions in the amino acid sequence of a native light-activated protein (such as, but not limited to, native GtR3, NpHR, DChR, and BR).
- Light-activated proteins include those in which one or more amino acid residues have undergone an amino acid substitution while retaining the ability to respond to light and the ability to control the polarization state of a plasma membrane.
- light-activated proteins can be made by substituting one or more amino acids into the native or wild type amino acid sequence of the protein.
- the invention includes proteins comprising altered amino acid sequences in comparison with a native amino acid sequence, wherein the altered light-activated protein retains the characteristic light-activated nature and/or the ability to regulate ion flow across plasma membranes of the precursor protein but may have altered properties in some specific aspects (for example, an increased or decreased sensitivity to light, an increased or decreased sensitivity to particular wavelengths of light, and/or an increased or decreased ability to regulate the polarization state of the plasma membrane of a mammalian cell, as compared to the native protein).
- Amino acid substitutions in a native protein sequence may be conservative or non-conservative and such substituted amino acid residues may or may not be one encoded by the genetic code.
- alphabet The standard twenty amino acid "alphabet” is divided into chemical families based on chemical properties of their side chains. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and sidw chains having aromatic groups (e.g., tyrosine, phenylalanine, tryptophan, histidine).
- basic side chains e.g., lysine, argin
- a “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a chemically similar side chain (i.e., replacing an amino acid possessing a basic side chain with another amino acid with a basic side chain).
- a “non-conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a chemically different side chain (i.e., replacing an amino acid having a basic side chain with an amino acid having an aromatic side chain).
- the animal cell includes an integrated exogenous molecule which expresses a proton pump responsive to blue light.
- the animal cell can be a neural cell, a muscle cell, a rod or cone cell or a cell line.
- the animal cell is a mammalian cell.
- an animal cell comprising a light-activated protein expressed on the cell membrane, wherein the protein is responsive to blue light and is derived from Guillardia theta, wherein the protein is capable of mediating a hyperpolarizing current in the cell when the cell is illuminated with light.
- the light has a wavelength between about 450 and 495 nm. In some embodiments, the light has a wavelength about 490 nm.
- the light-activated protein comprises an amino acid sequence at least 95% identical to the sequence shown in SEQ ID NO: 1.
- the light-activated protein comprises an amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO: 1.
- the light-activated protein comprises substitutions, deletions, and/or insertions introduced into a native amino acid sequence to increase or decrease sensitivity to light, increase or decrease sensitivity to particular wavelengths of light, and/or increase or decrease the ability of the light- activated protein to regulate the polarization state of the plasma membrane of the cell.
- the light-activated protein contains one or more conservative amino acid substitutions.
- the light-activated protein contains one or more non-conservative amino acid substitutions.
- the light-activated protein comprising substitutions, deletions, and/or insertions introduced into the native amino acid sequence suitably retains the ability to hyperpolarize the plasma membrane of a neuronal cell in response to light.
- an animal cell comprising a light-activated protein expressed on the cell membrane, wherein the protein comprises a core amino acid sequence at least 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO: 1 and an endoplasmic reticulum (ER) export signal.
- the ER export signal may be fused to the C-terminus of the core amino acid sequence or may be fused to the N-terminus of the core amino acid sequence.
- the ER export signal is linked to the core amino acid sequence by a linker.
- the linker can comprise any of 5, 10, 20, 30, 40, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 400, or 500 amino acids in length.
- the linker may further comprise a fluorescent protein, for example, but not limited to, a yellow fluorescent protein, a red fluorescent protein, a green fluorescent protein, or a cyan fluorescent protein.
- the ER export signal comprises the amino acid sequence FXYENE, where X can be any amino acid.
- the ER export signal comprises the amino acid sequence VXXSL, where X can be any amino acid.
- the ER export signal comprises the amino acid sequence FCYENEV.
- an animal cell comprising a light-activated protein expressed on the cell membrane, wherein the protein comprises a core amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO: 1 and a signal peptide (e.g., which enhances transport to the plasma membrane).
- the signal peptide may be fused to the C- tcrminus of the core amino acid sequence or may be fused to the N-terminus of the core amino acid sequence.
- the signal peptide is linked to the core amino acid sequence by a linker.
- the linker can comprise any of 5, 10, 20, 30, 40, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 400, or 500 amino acids in length.
- the linker may further comprise a fluorescent protein, for example, but not limited to, a yellow fluorescent protein, a red fluorescent protein, a green fluorescent protein, or a cyan fluorescent protein.
- the signal peptide comprises the amino acid sequence
- MDYGGALSAVGRELLFVTNPVVVNGSVLVPEDQCYCAGWIESRGTNG may be used.
- an animal cell comprising a light-activated protein expressed on the cell membrane, wherein the protein comprises a core amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO: 1 and a trafficking signal (e.g., which enhances transport to the plasma membrane).
- the signal peptide may be fused to the C- terminus of the core amino acid sequence or may be fused to the N-terminus of the core amino acid sequence.
- the signal peptide is linked to the core amino acid sequence by a linker.
- the linker can comprise any of 5, 10, 20, 30, 40, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 400, or 500 amino acids in length.
- the linker may further comprise a fluorescent protein, for example, but not limited to, a yellow fluorescent protein, a red fluorescent protein, a green fluorescent protein, or a cyan fluorescent protein.
- the trafficking signal is derived from the amino acid sequence of the human inward rectifier potassium channel Kir2.1.
- the trafficking signal comprises the amino acid sequence K S R I T S E G E Y I P L D Q I D I N V.
- an animal cell comprising a light-activated protein expressed on the cell membrane, wherein the protein comprises a core amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO: 1 and two or more amino acid sequence motifs which enhance transport to the plasma membranes of mammalian cells selected from the group consisting of a signal peptide, an ER export signal, and a membrane trafficking signal.
- the light activated protein comprises an N- terminal signal peptide and a C-terminal ER export signal.
- the light activated protein comprises an N-terminal signal peptide and a C-terminal trafficking signal.
- the light activated protein comprises an N- terminal signal peptide, a C-terminal ER Export signal, and a C-terminal trafficking signal. In some embodiments, the light activated protein comprises a C-terminal ER Export signal and a C-terminal trafficking signal. In some embodiments, the C-terminal ER Export signal and the C-terminal trafficking signal are linked by a linker.
- the linker can comprise any of 5, 10, 20, 30, 40, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 400, or 500 amino acids in length.
- the linker may further comprise a fluorescent protein, for example, but not limited to, a yellow fluorescent protein, a red fluorescent protein, a green fluorescent protein, or a cyan fluorescent protein.
- a fluorescent protein for example, but not limited to, a yellow fluorescent protein, a red fluorescent protein, a green fluorescent protein, or a cyan fluorescent protein.
- the ER Export signal is more C-terminally located than the trafficking signal.
- the trafficking signal is more C-terminally located than the ER Export signal.
- isolated polynucleotides encoding any of the proteins described herein, such as a light-activated protein comprising a core amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO: 1.
- expression vectors such as a viral vector described herein comprising a polynucleotide encoding any of the proteins described herein, such as a light-activated protein comprising a core amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO: 1.
- the polynucleotides may be used for expression of the light-activated protein in animal cells.
- an animal cell comprising a light-activated protein expressed on the cell membrane, wherein the protein is responsive to blue light and is derived from Dunaliella salina, wherein the protein is capable of mediating a depolarizing current in the cell when the cell is illuminated with light.
- the light has a wavelength between about 450 and 495 nm. In some embodiments, the light has a wavelength about 490 nm.
- the light-activated protein comprises an amino acid sequence at least 95% identical to the sequence shown in residues 25-365, 24-365, 23-365, 22-365, 21-365, 20-365, 19-365, 18-365, 17-365, 16-365, 15-365, 14- 365, 13-365, 13-365, 12-365, 11-365, 10-365, 9-365, 8-365, 7-365, 6-365, 5-365, 4-365, 3-365, 2-365, or 1-365 of SEQ ID NO: 2.
- the light-activated protein comprises an amino acid sequence at least 90%), 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in residues 25-365, 24- 365, 23-365, 22-365, 21-365, 20-365, 19-365, 18-365, 17-365, 16-365, 15-365, 14-365, 13-365, 13-365, 12-365, 11-365, 10-365, 9-365, 8-365, 7-365, 6-365, 5-365, 4-365, 3- 365, 2-365, or 1-365 of SEQ ID NO: 2.
- the light-activated protein comprises substitutions, deletions, and/or insertions introduced into a native amino acid sequence to increase or decrease sensitivity to light, increase or decrease sensitivity to particular wavelengths of light, and/or increase or decrease the ability of the light-activated protein to regulate the polarization state of the plasma membrane of the ceil.
- the light-activated protein contains one or more conservative amino acid substitutions.
- the light-activated protein contains one or more non-conservative amino acid substitutions.
- the light-activated protein comprising substitutions, deletions, and/or insertions introduced into the native amino acid sequence suitably retains the ability to depolarize the plasma membrane of a neuronal cell in response to light.
- an animal cell comprising a light-activated protein expressed on the cell membrane, wherein the protein comprises a core amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in residues 25-365, 24-365, 23-365, 22-365, 21-365, 20- 365, 19-365, 18-365, 17-365, 16-365, 15-365, 14-365, 13-365, 13-365, 12-365, 11-365, 10-365, 9-365, 8-365, 7-365, 6-365, 5-365, 4-365, 3-365, 2-365, or 1-365 of SEQ ID NO: 2 and an endoplasmic reticulum (ER) export signal.
- the protein comprises a core amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in residues 25-365, 24-365, 23-365, 22-
- the ER export signal may be fused to the C-terminus of the core amino acid sequence or may be fused to the N- terminus of the core amino acid sequence.
- the ER export signal is linked to the core amino acid sequence by a linker.
- the linker can comprise any of 5, 10, 20, 30, 40, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 400, or 500 amino acids in length.
- the linker may further comprise a fluorescent protein, for example, but not limited to, a yellow fluorescent protein, a red fluorescent protein, a green fluorescent protein, or a cyan fluorescent protein.
- the ER export signal comprises the amino acid sequence FXYENE, where X can be any amino acid.
- the ER export signal comprises the amino acid sequence VXXSL, where X can be any amino acid.
- the ER export signal comprises the amino acid sequence FCYENEV.
- an animal cell comprising a light-activated protein expressed on the cell membrane, wherein the protein comprises a core amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in residues 25-365, 24-365, 23-365, 22-365, 21-365, 20- 365, 19-365, 18-365, 17-365, 16-365, 15-365, 14-365, 13-365, 13-365, 12-365, 11-365, 10-365, 9-365, 8-365, 7-365, 6-365, 5-365, 4-365, 3-365, 2-365, or 1-365 of SEQ ID NO: 2 and a signal peptide (e.g., which enhances transport to the plasma membrane).
- a signal peptide e.g., which enhances transport to the plasma membrane
- the signal peptide may be fused to the C-terminus of the core amino acid sequence or may be fused to the N-terminus of the core amino acid sequence.
- the signal peptide is linked to the core amino acid sequence by a linker.
- the linker can comprise any of 5, 10, 20, 30, 40, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 400, or 500 amino acids in length.
- the linker may further comprise a fluorescent protein, for example, but not limited to, a yellow fluorescent protein, a red fluorescent protein, a green fluorescent protein, or a cyan fluorescent protein.
- the signal peptide comprises the amino acid sequence
- MDYGGALSAVGRELLFVTNPVVVNGSVLVPEDQCYCAGWIESRGTNG may be used.
- an animal cell comprising a light-activated protein expressed on the cell membrane, wherein the protein comprises a core amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in residues 25-365, 24-365, 23-365, 22-365, 21-365, 20- 365, 19-365, 18-365, 17-365, 16-365, 15-365, 14-365, 13-365, 13-365, 12-365, 11-365, 10-365, 9-365, 8-365, 7-365, 6-365, 5-365, 4-365, 3-365, 2-365, or 1-365 of SEQ ID NO: 2 and a trafficking signal (e.g., which enhances transport to the plasma membrane).
- a trafficking signal e.g., which enhances transport to the plasma membrane.
- the signal peptide may be fused to the C-terminus of the core amino acid sequence or may be fused to the N-terminus of the core amino acid sequence.
- the signal peptide is linked to the core amino acid sequence by a linker.
- the linker can comprise any of 5, 10, 20, 30, 40, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 400, or 500 amino acids in length.
- the linker may further comprise a fluorescent protein, for example, but not limited to, a yellow fluorescent protein, a red fluorescent protein, a green fluorescent protein, or a cyan fluorescent protein.
- the trafficking signal is derived from the amino acid sequence of the human inward rectifier potassium channel Kir2.1.
- the trafficking signal comprises the amino acid sequence K S R I T S E G E Y I P L D Q I D I N V.
- an animal cell comprising a light-activated protein expressed on the cell membrane, wherein the protein comprises a core amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in residues 25-365, 24-365, 23-365, 22-365, 21-365, 20- 365, 19-365, 18-365, 17-365, 16-365, 15-365, 14-365, 13-365, 13-365, 12-365, 11-365, 10-365, 9-365, 8-365, 7-365, 6-365, 5-365, 4-365, 3-365, 2-365, or 1-365 of SEQ ID NO: 2 and two or more amino acid sequence motifs which enhance transport to the plasma membranes of mammalian cells selected from the group consisting of a signal peptide, an ER export signal, and a membrane trafficking signal.
- the protein comprises a core amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%,
- the light activated protein comprises an N-terminal signal peptide and a C-terminal ER export signal. In some embodiments, the light activated protein comprises an N-terminal signal peptide and a C-terminal trafficking signal. In some embodiments, the light activated protein comprises an N-terminal signal peptide, a C-terminal ER Export signal, and a C-terminal trafficking signal. In some embodiments, the light activated protein comprises a C-terminal ER Export signal and a C-terminal trafficking signal. In some embodiments, the C-terminal ER Export signal and the C-terminal trafficking signal are linked by a linker.
- the linker can comprise any of 5, 10, 20, 30, 40, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 400, or 500 amino acids in length.
- the linker may further comprise a fluorescent protein, for example, but not limited to, a yellow fluorescent protein, a red fluorescent protein, a green fluorescent protein, or a cyan fluorescent protein.
- the ER Export signal is more C-terminally located than the trafficking signal. In some embodiments the trafficking signal is more C-terminally located than the ER Export signal.
- isolated polynucleotides encoding any of the proteins described herein, such as a light-activated protein comprising a core amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in residues 25-365, 24-365, 23-365, 22-365, 21-365, 20-365, 19- 365, 18-365, 17-365, 16-365, 15-365, 14-365, 13-365, 13-365, 12-365, 11-365, 10-365, 9-365, 8-365, 7-365, 6-365, 5-365, 4-365, 3-365, 2-365, or 1-365 of SEQ ID NO: 2.
- expression vectors comprising a polynucleotide encoding any of the proteins described herein, such as a light-activated protein comprising a core amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in residues 25-365, 24-365, 23-365, 22-365, 21-365, 20-365, 19-365, 18-365, 17-365, 16- 365, 15-365, 14-365, 13-365, 13-365, 12-365, 11-365, 10-365, 9-365, 8-365, 7-365, 6- 365, 5-365, 4-365, 3-365, 2-365, or 1-365 of SEQ ID NO: 2..
- the polynucleotides may be used for expression of the light-activated protein in animal cells.
- an animal cell comprising a light-activated protein expressed on the cell membrane, wherein the protein is responsive to amber as well as red light and is derived from Natronomonas pharaonis, wherein the protein is capable of mediating a hyperpolarizing current in the cell when the cell is illuminated with light.
- the light has a wavelength between about 580 and 630 nm. In some embodiments, the light has a wavelength about 589 nm. In some embodiments, the light has a wavelength greater than about 630 nm (e.g. less than 740 nm). In some
- the light has a wavelength around 630 nm.
- the light-activated protein comprises an amino acid sequence at least 95% identical to the sequence shown in SEQ ID NO: 3.
- the light-activated protein comprises an amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO: 3.
- the light-activated protein comprises substitutions, deletions, and/or insertions introduced into a native amino acid sequence to increase or decrease sensitivity to light, increase or decrease sensitivity to particular wavelengths of light, and/or increase or decrease the ability of the light-activated protein to regulate the polarization state of the plasma membrane of the cell.
- the light- activated protein contains one or more conservative amino acid substitutions. In some embodiments, the light-activated protein contains one or more non-conservative amino acid substitutions.
- the light-activated protein comprising substitutions, deletions, and/or insertions introduced into the native amino acid sequence suitably retains the ability to hyperpolarize the plasma membrane of a neuronal cell in response to light.
- an animal cell comprising a light-activated protein expressed on the cell membrane, wherein the protein comprises a core amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO: 3 and an endoplasmic reticulum (ER) export signal.
- the ER export signal may be fused to the C-terminus of the core amino acid sequence or may be fused to the N-terminus of the core amino acid sequence.
- the ER export signal is linked to the core amino acid sequence by a linker.
- the linker can comprise any of 5, 10, 20, 30, 40, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 400, or 500 amino acids in length.
- the linker may further comprise a fluorescent protein, for example, but not limited to, a yellow fluorescent protein, a red fluorescent protein, a green fluorescent protein, or a cyan fluorescent protein.
- the ER export signal comprises the amino acid sequence FXYENE, where X can be any amino acid.
- the ER export signal comprises the amino acid sequence VXXSL, where X can be any amino acid.
- the ER export signal comprises the amino acid sequence FCYENEV.
- an animal cell comprising a light-activated protein expressed on the cell membrane, wherein the protein comprises a core amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO: 3 and a trafficking signal (e.g., which enhances transport to the plasma membrane).
- the signal peptide may be fused to the C- terminus of the core amino acid sequence or may be fused to the N-terminus of the core amino acid sequence.
- the signal peptide is linked to the core amino acid sequence by a linker.
- the linker can comprise any of 5, 10, 20, 30, 40, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 400, or 500 amino acids in length.
- the linker may further comprise a fluorescent protein, for example, but not limited to, a yellow fluorescent protein, a red fluorescent protein, a green fluorescent protein, or a cyan fluorescent protein.
- the trafficking signal is derived from the amino acid sequence of the human inward rectifier potassium channel Kir2.1.
- the trafficking signal comprises the amino acid sequence K S R I T S E G E Y I P L D Q I D I N V.
- an animal cell comprising a light-activated protein expressed on the cell membrane, wherein the protein comprises a core amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO: 3 and two or more amino acid sequence motifs which enhance transport to the plasma membranes of mammalian cells selected from the group consisting of an ER export signal and a membrane trafficking signal.
- the light activated protein comprises a C-terminal ER Export signal and a C-terminal trafficking signal.
- the C-terminal ER Export signal and the C-terminal trafficking signal are linked by a linker.
- the linker can comprise any of 5, 10, 20, 30, 40, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 400, or 500 amino acids in length.
- the linker may further comprise a fluorescent protein, for example, but not limited to, a yellow fluorescent protein, a red fluorescent protein, a green fluorescent protein, or a cyan fluorescent protein.
- the ER Export signal is more C-terminally located than the trafficking signal. In some embodiments the trafficking signal is more C-terminally located than the ER Export signal.
- an animal cell comprising a light-activated protein expressed on the cell membrane, wherein the protein comprises a core amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO: 3, wherein the N-terminal signal peptide of SEQ ID NO: 3 is deleted or substituted
- the light-activated protein comprises an amino acid sequence at least 95% identical to the sequence shown in residues 40-291, 39-291 , 38-291, 37-291, 36-291, 35-291, 34-291, 33-291, 32-291, 31-291, 30-291, 29-291, 28-291, 27-291, 26-291, 25-291, 24-291, 23-291, 22-291, 21- 291, 20-291, 19-291, 18-291, 17-291, 16-291, 15-291, 14-291, 13-291, 13-291, 12-291, 11-291, 10-291,
- polynucleotides encoding for any of the proteins described herein, such as a light-activated protein comprising a core amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO: 3, an ER export signal, and a membrane trafficking signal.
- the polynucleotides may be in an expression vector (such as a viral vector described herein).
- the polynucleotides may be used for expression of the light-activated protein in animal cells.
- an animal cell comprising a light-activated protein expressed on the cell membrane, wherein the protein is responsive to green light and is derived from Halobacterium salinarum wherein the protein is capable of mediating a
- the light has a wavelength between about 520 and 570 nm. In some embodiments, the light has a wavelength about 560 nm.
- the light- activated protein comprises an amino acid sequence at least 95 % identical to the sequence shown in SEQ ID NO: 4. In some embodiments, the light-activated protein comprises an amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO: 4.
- the light-activated protein comprises substitutions, deletions, and/or insertions introduced into a native amino acid sequence to increase or decrease sensitivity to light, increase or decrease sensitivity to particular wavelengths of light, and/or increase or decrease the ability of the light-activated protein to regulate the polarization state of the plasma membrane of the cell.
- the light- activated protein contains one or more conservative amino acid substitutions.
- the light-activated protein contains one or more non-conservative amino acid substitutions.
- the light-activated protein comprising substitutions, deletions, and/or insertions introduced into the native amino acid sequence suitably retains the ability to hyperpolarize the plasma membrane of a neuronal cell in response to light.
- an animal cell comprising a light-activated protein expressed on the cell membrane, wherein the protein comprises a core amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO: 4 and an endoplasmic reticulum (ER) export signal.
- the ER export signal may be fused to the C-terminus of the core amino acid sequence or may be fused to the N-terminus of the core amino acid sequence.
- the ER export signal is linked to the core amino acid sequence by a linker.
- the linker can comprise any of 5, 10, 20, 30, 40, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 400, or 500 amino acids in length.
- the linker may further comprise a fluorescent protein, for example, but not limited to, a yellow fluorescent protein, a red fluorescent protein, a green fluorescent protein, or a cyan fluorescent protein.
- the ER export signal comprises the amino acid sequence FXYENE, where X can be any amino acid.
- the ER export signal comprises the amino acid sequence VXXSL, where X can be any amino acid.
- the ER export signal comprises the amino acid sequence FCYENEV.
- an animal cell comprising a light-activated protein expressed on the cell membrane, wherein the protein comprises a core amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO: 4 and a trafficking signal (e.g., which enhances transport to the plasma membrane).
- the signal peptide may be fused to the C- terminus of the core amino acid sequence or may be fused to the N-terminus of the core amino acid sequence.
- the signal peptide is linked to the core amino acid sequence by a linker.
- the linker can comprise any of 5, 10, 20, 30, 40, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 400, or 500 amino acids in length.
- the linker may further comprise a fluorescent protein, for example, but not limited to, a yellow fluorescent protein, a red fluorescent protein, a green fluorescent protein, or a cyan fluorescent protein.
- the trafficking signal is derived from the amino acid sequence of the human inward rectifier potassium channel Kir2.1.
- the trafficking signal comprises the amino acid sequence K S R I T S E G E Y I P L D Q I D I N V.
- an animal cell comprising a light-activated protein expressed on the cell membrane, wherein the protein comprises a core amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO: 4 and two or more amino acid sequence motifs which enhance transport to the plasma membranes of mammalian cells selected from the group consisting of an ER export signal and a membrane trafficking signal.
- the light activated protein comprises a C-terminal ER Export signal and a C-terminal trafficking signal.
- the C-terminal ER Export signal and the C-terminal trafficking signal are linked by a linker.
- the linker can comprise any of 5, 10, 20, 30, 40, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 400, or 500 amino acids in length.
- the linker may further comprise a fluorescent protein, for example, but not limited to, a yellow fluorescent protein, a red fluorescent protein, a green fluorescent protein, or a cyan fluorescent protein.
- the ER Export signal is more C-terminally located than the trafficking signal. In some embodiments the trafficking signal is more C-terminally located than the ER Export signal.
- an animal cell comprising a light-activated protein expressed on the cell membrane, wherein the protein comprises a core amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO: 4, wherein the N-terminal signal peptide of SEQ ID NO:4 is deleted or substituted.
- the light-activated protein comprises an amino acid sequence at least 95% identical to the sequence shown in residues 40-262, 39-262, 38-262, 37-262, 36-262, 35-262, 34-262, 33-262, 32-262, 31-262, 30-262, 29-262, 28-262, 27-262, 26-262, 25-262, 24-262, 23-262, 22-262, 21- 262, 20-262, 19-262, 18-262, 17-262, 16-262, 15-262, 14-262, 13-262, 13-262, 12-262, 11-262, 10-262, 9-262, 8-262, 7-262, 6-262, 5-262, 4-262, 3-262, 2-262, or 1-262 of SEQ ID NO:4.
- other signal peptides such as signal peptides from other opsins
- the light-activated protein may further comprise an ER transport signal and/or a membrane trafficking signal described herein.
- polynucleotides encoding for any of the proteins described herein, such as a light-activated protein comprising a core amino acid sequence at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO: 4, an ER export signal, and a membrane trafficking signal.
- the polynucleotides may be in an expression vector (such as a viral vector described herein).
- the polynucleotides may be used for expression of the light-activated protein in animal cells.
- a method for providing a light responsive protein for mammalian expression is provided.
- a light responsive protein is isolated from G. theta (GtR3).
- GtR3 has a C-terminus and an N-terminus.
- a promoter is added to the C-terminus of GtR3.
- the promoter is an
- An excitatory protein encourages firing of the action potential by moving the potential of the cell toward the action potential trigger level for the cell. In many neurons, this means that the protein decreases the negative voltage seen across the cell membrane. In a specific instance, the protein acts an additional ion channel that transfers cations into the cell. In this manner, the protein generates an excitatory current across the cell membrane. More specifically, the protein responds to light by raising the voltage across the cell membrane, thereby increasing the probability that an action potential or depolarization will occur. In certain instances the voltage across the cell membrane can be increased to the action potential trigger level or higher, causing depolarization of the cell.
- DChR channel derived from Dunaliella salina.
- DChR mediates a robust depolarizing current when illuminated with blue light.
- the depolarizing current may cause a cell to become excited in response to exposure to blue light.
- DChR is expressed as an exogenous protein in a cell of interest.
- DChR can function as an excitatory protein that uses an endogenous cofactor when delivered to a cell of interest.
- GtR3 and DChR can be used in combination with other optogenetic ion-passing molecules, such as ChR2 (developed from
- GtR3 and DChR have different operating parameters, relative to other light-responsive molecules. This facilitates the development of a cell or a cell population that has a precisely-tuned response to different wavelengths of light.
- the parameter that can be tuned include, but are not limited to, current density, hyperpolarization level, membrane conductance, stimulus frequency, resting potential, optical wavelength and/or optical intensity.
- a method for controlling action potential of a neuron involves the following steps: engineering a first light responsive protein in the neuron; producing, in response to light, an inhibitory current in the neuron and from the first light responsive protein; engineering a second light responsive protein in the neuron; and producing, in response to light, an excitation current in the neuron from the second light responsive protein.
- the first light responsive protein and the second light responsive protein may be responsive to different wavelengths of light.
- the use of DChR or GtR3 can facilitate specific current densities for this excitation or inhibitory current and/or optical wavelength at which such current is generated.
- a method for controlling action potential of a neuron involves the following steps: engineering a first light responsive protein in the neuron; producing, in response to light, an inhibitory current in the neuron and from the first light responsive protein; engineering a second light responsive protein in the neuron; and producing, in response to light, a second inhibitory current from the second light responsive protein, the combination of the two currents more strongly inhibiting the neuron than a single light responsive protein.
- the first light responsive protein could be NpHR and the second light responsive protein could be GtR3.
- Another method for controlling a voltage level across a cell membrane of a cell includes measuring the voltage level of the cell membrane.
- a light responsive protein is engineered and introducing the light responsive protein into the cell, where it is expressed.
- a light of a particular wavelength is provided, which produces a reaction in the cell by the light responsive protein.
- the response by the light responsive protein produces a current across the cell membrane. The current is responsive to the measured voltage level.
- the present invention is directed to a system for controlling an action potential of a neuron in vivo.
- the system includes a delivery device, a light source, and a control device.
- the delivery device introduces a light responsive protein to the neuron, with the light responsive protein producing an inhibitory current.
- the light source generates light for stimulating the light responsive protein, and the control device controls the generation of light by the light source.
- the light responsive protein introduced into the neuron produces an excitatory current.
- such a system is further adapted such that the delivery device introduces the light responsive protein by one of transfection, transduction and microinjection, and/or such that the light source introduces light to the neuron via one of an implantable light generator and fiber-optics.
- the delivery device introduces the light responsive protein by one of transfection, transduction and microinjection, and/or such that the light source introduces light to the neuron via one of an implantable light generator and fiber-optics.
- Another aspect of the present disclosure is directed to a method for treatment of a disorder.
- the method targets a group of neurons associated with the disorder; and in this group, the method includes engineering inhibitory proteins to respond to light by producing an inhibitory current to dissuade depolarization of the neurons, and exposing the neurons to light, thereby dissuading depolarization of the neurons.
- Yet another aspect of the present disclosure is directed to a further method for treatment of a disorder.
- the method targets a group of neurons associated with the disorder; and in this group, the method includes engineering excitatory proteins to respond to light by producing an excitatory current to encourage depolarization of the neurons, and exposing the neurons to light, thereby encouraging depolarization of the neurons.
- both inhibitory and excitatory proteins, responsive to different wavelengths of light are introduced into a targeted group of neurons. The neurons are exposed alternatively to different wavelengths of light to ⁇ excite, and inhibit the depolarization of the neurons.
- Another aspect of the present invention co-expresses GtR3 and DChR with other known opsins, such as NpHR and VChRl in the species (e.g., a mouse and C. elegans).
- opsins creating currents of opposite polarity and having different color sensitivity are integrated with calcium imaging in acute mammalian brain slices for bidirectional optical modulation and readout of neural activity.
- the coupled opsins can be targeted to C. elegans muscle and cholinergic motoneurons to control locomotion bidirectionally.
- Coupled opsins can be used as a complete and complementary optogenetic system for multimodal, high-speed, genetically-targeted, all-optical interrogation of living neural circuits. Further, more than one set of cells may be targeted with different couplings of opsins, allowing for precise control of multiple sets of cells independently from each other.
- GtR3 and DChR there are a number of channelrhodopsins, halorhodopsins, and microbial opsins that can be engineered to optically regulate ion flux or second messengers within cells.
- Various embodiments of the invention include codon-optimized, mutated, truncated, fusion proteins, targeted versions, or otherwise modified versions of such ion optical regulators.
- GtR3 and DChR e.g., Appendices B and C as filed in the underlying provisional application.
- the cited opsins are used as representative of a number of different embodiments.
- Table 1 shows identified opsins for inhibition of cellular activity across the visible spectrum:
- Table 2 shows identified opsins for excitation and modulation across the visible spectrum:
- various combinations of the listed opsins are delivered to a cell population.
- a second combination can be delivered to a different cell population.
- combinations of opsins may be chosen to excite certain cell populations while inhibiting others, for example.
- target cells are stimulated using an implantable arrangement.
- the implantable arrangement includes a biological portion that facilitates the stimulation of the target cells in response to receipt of light.
- the implantable arrangement also includes a light generator for creating light to trigger the stimulus of the target cells.
- the implantable arrangement includes a microcontroller and a feedback loop. The color of light created by the light generator is dependent on the voltage of the cell.
- the target cell can include multiple light sensitive proteins which respond to different wavelengths of light to inhibit or encourage depolarization of the target cell.
- a method for stimulating target cells in vivo using gene transfer vectors (for example, viruses) capable of inducing photosensitive ion channel growth (for example, DChR ion channels) or photosensitive ion pumps (for example, GtR3 proton pumps).
- the vectors are implanted in the body, along with the electronic components of the apparatus.
- a light producing device is implanted near the target cells.
- the target cells are stimulated in response to light generated by the light producing device.
- gene transfer vectors are capable of inducing growth of more than one ion channel or ion pump.
- a protein is introduced to one or more target cells.
- the protein changes the potential of the cell in response to light having a certain frequency. This may result in a change in resting potential that can be used to control (dissuade) action potential firing.
- the protein is GtR3 which acts as a membrane pump for transferring charge across the cell membrane in response to light.
- Membrane pumps are energy transducers which use electromagnetic or chemical bond energy for translocation of ions across the membrane.
- the protein is a halorhodopsin which acts as the membrane pump. The halorhodopsin membrane pump moves specific ions across the membrane.
- halorhodopsin membrane pumps For further information regarding halorhodopsin membrane pumps, reference can be made to "Halorhodopsin Is a Light-driven Chloride Pump" by Brigitte Schobert et al, The Journal of Biological Chemistry Vol. 257, No. 17. September 10, 1982, pp. 10306-10313, which is fully incorporated herein by reference.
- GtR3 and NpHR may be introduced into different target cell populations, respectively.
- the two inhibitors are responsive to different wavelengths of light allowing the two proteins to be used to inhibit different target cell populations independently.
- GtR3 and NpHR may also be introduced into the same cell population for gradient control over the inhibition of a cell population.
- GtR3 and NpHR molecules within the same cell can be activated relatively independent from one another.
- a first level of inhibition can be implemented by activating the molecule type (GtR3 or NpHR) that provides the lowest current levels for the cell conditions.
- the next level could be implemented by deactivating this first molecule type and activating the other molecule type.
- a third level can be implemented by activating both molecules simultaneously.
- Further gradient control can be achieved by varying the wavelength of light, or by varying the light intensity at or near the maxima of each protein, for example.
- the combination of multiple inhibitors can also lead to shunting inhibition, which combined with hyperpolarizing inhibition can lead to stronger hyperpolarization in the combination approach than from using a single inhibitor protein.
- the reversal potential also known as the Nernst potential
- the reversal potential of an ion is the membrane potential at which there is no net (overall) flow of ions from one side of the membrane to the other.
- Each type of ion channel has a specific reversal potential. At the Nernst potential the outward and inward rates of ion movement are the same (the ion flux is in equilibrium for the ion type).
- a change of membrane potential on either side of the Nernst potential reverses the overall direction of ion flux. If the reversal potential of an ion channel is below the resting potential (or instant potential in the case where a light responsive protein ion channel been stimulated and changed the "resting" potential) of the cell membrane, the ion channel will contribute to inhibition through
- the ion channel will have a shunting effect.
- concentration gradient for any given ion (for example C1-) is determined in part by the balance between the activity of the other ions (for example Na+ and K+).
- Shunting inhibition is termed "shunting" because the channel conductance short-circuits currents that are generated at adjacent excitatory channels. Accordingly, the addition of a light responsive protein channel with inhibitory characteristics can lower the membrane potential to a point where an existing ion channel reverses direction and "shunts" the current, creating an additional path which prevents the membrane potential from reaching the action potential.
- populations of cells, tissues, and non-human animals comprising a cell expressing one or more of the light-activated proteins described herein on the cell membrane. Methods of using the cells, population of cells, tissues, and non- human animals are also provided.
- Figure 1 A shows a light responsive ion-passing molecule (a pump or channel) 150 in a cell membrane 160.
- ion channels allow flow toward the channel's reversal potential (or equilibrium potential for the channel); the direction is based on whether the membrane potential is above or below the channel's reversal potential.
- Ion channels do not require additional energy to transport the ion.
- Ion pumps transport ions against the equilibrium flow and require introduction of some form of energy, such as ATP, to transport the ion across the membrane.
- Ions 162 may be anions or cations.
- the hydrogen ion is a proton (as well as a cation).
- the direction the ions flow along with the ions polarity will determine whether the ion-passing molecule has a hyperpolarizing effect or a depolarizing effect on the cell.
- the ion-passing molecule 150 transports protons out of the cell, causing hyperpolarization of the cell and inhibition of the firing of the cell.
- the light responsive ion channel/pump 150 is not open/active unless light of the appropriate frequency is present.
- Figure IB shows an alternative embodiment of the present invention where a light responsive ion-passing molecule 150 is expressed within membranes that are internal to a cell. Many of the internal components of the cell have membranes similar to the cell membrane that encloses the cell.
- the membrane of organelle 152 contains naturally occurring ion pump/channels before introduction of a light responsive protein. Depending on the promoters introduced along with the exogenous light responsive protein, the light responsive protein can express as an ion pump/channel in the membrane of variety of different organelles, in the cell membrane, or a combination of different organelles and/or the cell membrane.
- the light responsive ion-passing molecule 150 is a proton pump. In other embodiments the pump can be a pump/charinel for a specific cation or a specific anion.
- the ion pump/channel 150 is located in the membrane 156 of the organelle.
- the transfer of protons across a membrane in which the ion-passing molecule is expressed can be used to change the membrane potential of either or both membrane 156 and membrane 160.
- the transport of protons out of the cytoplasm can cause a cell to become hyperpolarized, resulting in inhibition of the cell.
- the pump/channel 150 can be used to change the pH of the organelle 152 and the surrounding cytoplasm 154.
- the pH of the organelle in which the protein is expressed can be changed and/or controlled. Because most enzymes within a cell are pH sensitive, the pH of each organelle critically determines the coordinated bio-chemical reactions occurring along the endocytic and secretory pathways. Aberrations of the normal organellar pH homeostasis can lead to significant functional changes. Depending on the level of expression of the light responsive protein, and the location (i.e. which organelle) various functions of the cell may be enhanced or retarded. At high enough levels of expression the cell may be killed. This can be desirable in unwanted (i.e. cancer) cells.
- FIG 2A shows two examples of the use of light responsive proteins, each example including three cell populations, A, B, and C.
- two or more light responsive proteins can be introduced into the same cell populations.
- the light responsive proteins introduced can cause the same response or different response when activated.
- the different proteins can also have different reaction times, or strengths of reactions.
- Two proteins of the same polarity can be activated at the same time causing an additive effect.
- Two depolarizing proteins, for example may be alternatively stimulated. This can allow for an increase in frequency of firing.
- cell populations A and B express the same inhibiting protein, but different excitatory proteins.
- Cell population C has an excitatory protein which reacts to light around the same wavelength as the inhibiting protein of cell populations A and B.
- the inhibitor of cell population C reacts to a wavelength similar to the excitatory protein of cell population A.
- This arrangement allows for a variety of combinations of cell population reactions to the light provided to stimulate the cell populations. As example 1 is set up, cell population B may be excited without exciting or inhibiting either of the other two populations. However, cell populations A and C react in almost an inverse way to the light provided.
- Example 2 includes cell population A with three light responsive proteins and cell populations B and C with two light responsive proteins.
- Cell population A includes two excitatory proteins which react to different light wavelengths, and one inhibitory protein.
- Cell populations B and C each have one of the excitatory proteins of cell population A and an inhibitory protein which responses to wavelengths in the same spectrum as the excitatory protein present in the other cell population (B or C).
- This arrangement allows for the combination of cell populations A and B to be excited, or cell populations B and C to be excited, while the third cell population is inhibited. It allows for cell population A to be inhibited without affecting either cell population B or C, and for cell population A to be excited while both cell populations B and C are inhibited.
- the example combination of Figure 2 A are not meant to be limiting, but to illustrate some of the many combinations of light responsive proteins in both a single cell population, and the combinations across cell populations.
- target cells are neurons located in the brain of a mammal.
- the target cells are genetically modified to express photosensitive bio-molecular arrangement, for example, DChR ion channels.
- Light can then be used to stimulate the neurons.
- different objectives can be achieved. For instance, current techniques for deep brain stimulus (DBS) use electrodes to apply a current directly to the targeted area of the brain.
- DBS deep brain stimulus
- the frequency of the electrical stimulus is sometimes referred to as either low-frequency DBS or high-frequency DBS. Studies have suggested that high-frequency DBS inhibits the generation of impulses from the stimulated cells, while low-frequency DBS facilitates the generation of impulses from the stimulated cells.
- the frequencies that produce the effects of high-frequency of low-frequency DBS have also been shown to vary depending upon the specific area of the brain being stimulated.
- the neurons are stimulated using electrodes supplying current pulses at frequencies around 100Hz or more. Such a frequency has been shown to be effective in certain applications, as discussed further herein.
- two or more light responsive proteins may be present. Some (or all) of the two or more light responsive proteins can direct the same action (i.e., excitation or inhibition) within the cell population.
- cell population A of example 2 includes two excitatory light responsive proteins, DChR and VChRl .
- Fig. 2B shows a stimulus profile for use with certain embodiments in which two or more types of light responsive proteins, for example DChR and VChRl, may be introduced into the same cell population.
- Each ion- passing molecule has a respective stimulus frequency limit, which can be partially responsive to environmental factors like pH. This limit reflects the recovery time necessary for the molecule to transition between active and inactive states.
- the use of two types of light-responsive proteins, each responding to different optical wavelengths can allow for each type of protein to be controlled separately.
- the respective ion channels can be activated alternatively, allowing for an increased frequency of stimulation of the brain.
- example 3 shows that light pulses (solid vertical lines) of a first wavelength and provided at a frequency F. This wavelength is selected to activate a first type of molecule (triangles).
- a second set of light pulses (dotted vertical lines) of a second wavelength can also be provided at a frequency F. This second set of light pulses can be used to activate a second type of molecule (squares).
- the resulting activation frequency for both cells is thus twice the frequency of activation for each individual ion- passing molecule.
- the frequencies need not be identical between the two types of molecules and can be varied over time.
- a first type of ion-passing molecule can be activated for a time period followed by activation of a second type of ion-passing molecule.
- This can be particularly useful for allowing each of the ion- passing molecules to be inactive for the time period during which the other ion-passing molecule is being activated. In certain instances, this can facilitate recovery and sustained use of the ion-passing molecules.
- the different current types, densities and ion-passing capabilities can be considered when deciding on the specific stimulation profile to create the desired response.
- DBS DBS is often applied to the globus pallidus interna, or the subthalamic nucleus within a patient's brain.
- a light flashing light can be used in place of electrodes.
- the targeted neuron cells and external electrical signal need not be directly applied to the targeted cells.
- light can often travel from its point of origin farther than electricity, thereby increasing the effective area relative to the stimulation source and only those neurons that have been photosensitized are stimulated.
- one embodiment of the present invention can be implemented using high-frequency DBS to inhibit neuron generated impulses. While high-frequency DBS has been accomplished at frequencies around 100Hz, high-frequency DBS using various embodiments of the present invention may not necessarily require the same frequency. For instance, it may be possible to reproduce the inhibiting effects of high-frequency DBS at lower frequencies (e.g., 50Hz) when using light activated techniques. For example, activation of the GtR3 pump intrinsically favors hyperpolarization and resistance to action potential generation. Various frequencies can be used depending upon the particular application (e.g., the targeted portion of the brain and the desired effect), and the stimulation modality being applied.
- gene transfer vectors inducing the expression of photosensitive bio-molecules are used to target a specific type of cell.
- viral-based proteins e.g., lentiviruses, adeno- associated viruses or retroviruses
- the targeted cells are then infected by the viral-based gene-transfer proteins, and begin to produce a new type of ion channel (for example DChR), thereby becoming photosensitive.
- DChR ion channel
- neurons of disparate length, diameter, chronaxie, other membrane properties, electrical insulation, neurotransmitter output, and overall function lie in close proximity to one another, and thus, can be inadvertently stimulated when using electrodes to provide the stimulation of the neurons.
- Circuit-breakers optical technologies for probing neural signals and systems
- a specific embodiment of the present invention employs an implantable arrangement for in vivo use.
- a light-emitting diode, laser or similar light source is included for generating light (as shown, for example, light generator 104 in FIG. 3).
- Another embodiment of the present invention employs an arrangement for stimulating target cells using a photosensitive protein that allows the target cells to be stimulated in response to light.
- a biological delivery device such as those discussed in connection with biological portion 204 of FIG. 4, is used for implanting vectors that modify the target cells to include the photosensitive protein.
- a component such as that discussed in connection with biological portion 204, the mesh of FIG. 7 or viral matrix of FIG. 8, is used for implanting a light generating device near the target cells.
- a control device such as that discussed in connection control circuit 208, is used for activating the light generating device to generate light to be received by the target cells, thereby stimulating the target cells in response to the generated light.
- FIG. 3 shows a block diagram of a system for stimulating target cells, according to an example embodiment of the present invention.
- Block 102 represents a location internal to an organism (e.g., a mammal), as shown by the in vivo designation.
- Light generator 104 is an implantable device that generates light in vivo.
- the photosensitive biological portion 106 affects the target cells such that generated light strikes causes stimulation of the target.
- the light generator 104 is a small electronic device on the order of a few millimeters in size. The small size is particularly useful for minimizing the intrusiveness of the device and associated implantation procedure.
- the light generator 104 may include a fiber optic device that can be used to transmit light from an external source to the target cells.
- the target cells are modified to contain light-activated proton pump/channel proteins.
- a specific example of such protein is GtR3, which is a product based upon the cryptophytes Guillardia theta.
- These light sensitive proteins can be implanted using a number of different methods.
- Example methods include, but are not limited to, the use of various delivery devices, such as gelatin capsules, liquid injections and the like. Such methods also include the use of stereotactic surgery techniques such as frames or computerized surgical navigation systems to implant or otherwise access areas of the body.
- stereotactic surgery techniques such as frames or computerized surgical navigation systems to implant or otherwise access areas of the body.
- FIG. 4 shows a block diagram of an implantable device for stimulating target cells, according to an example embodiment of the present invention.
- the figure includes control circuit 208, light source 206, biological portion 204 and target cells 202.
- Biological portion 204 affects the target cells 202 such that the target cells are stimulated in response to light
- biological portion 204 may be composed of target cells 202 that have been modified to be photosensitive.
- biological portion 204 may contain biological elements such as gene transfer vectors, which cause target cells 202 to become sensitive to light.
- biological elements such as gene transfer vectors, which cause target cells 202 to become sensitive to light.
- the control circuit 208 can be arranged to respond to an external signal by activating, or deactivating light source 206, or by charging the battery that powers light source 206.
- the external signal is electromagnetic radiation that is received by control circuit 208.
- radio frequency (RP) signals can be transmitted by an external RF transmitter and received by control circuit 208.
- a magnetic field can be used to activate and/or power the control circuit.
- Control circuit 208 can be implemented using varying degrees of complexity.
- the circuit is a simple coil that when exposed to a magnetic field generates a current. The current is then used to power light source 206.
- control circuit 208 can include an RF antenna.
- a battery or similar power source such as a capacitive element, can be used by control circuit 208. While charged, the power source allows the circuitry to continue to operate without need for concurrent energy delivery from outside the body. This can be particularly useful for providing precise control over the light emitted by light source 206 and for increased intensity of the emitted light.
- light source 206 is implemented using a light-emitting-diode (LED). LEDs have been proven to be useful for low power applications and also to have a relatively fast response to electrical signals.
- LEDs have been proven to be useful for low power applications and also to have a relatively fast response to electrical signals.
- biological portion 204 includes a gelatin or similar substance that contains gene transfer vectors which genetically code the target cells for photosensitivity.
- the vectors are released once implanted into the body. This can be accomplished, for example, by using a containment material that allows the vectors to be released into aqueous solution ⁇ e.g., using dehydrated or water soluble materials such as gelatins). The release of the vectors results in the target cells being modified such that they are simulated in response to light from light source 206.
- the biological portion 204 includes a synthetic mesh that contains the photosensitive cells.
- the cells are neurons that have been modified to be photosensitive.
- the synthetic mesh can be constructed so as to allow the dendrites and axons to pass through the mess without allowing the entire neuron ⁇ e.g., the cell body) to pass.
- One example of such a mesh has pores that are on the order of 3-7 microns in diameter and is made from polyethylene terephthalate.
- the biological portion 204 includes an injection mechanism as discussed in further detail herein.
- FIG. 5 shows a block diagram of an implantable device, according to an example embodiment of the present invention.
- the implantable device of FIG. 3 is responsive to a field magnetic. More specifically, an inductor constructed from windings 302 and core 304 generates a current/Voltage in response to a magnetic field. The current is passed to control circuit 310 through conductive path 306. In response, control circuit 310 activates light source 312 using conductive path 308. Light source 312 illuminates biological portion 314 in order to stimulate the target cells.
- biological portion 314 includes a gelatin, synthetic mesh or injection mechanism as discussed in further detail herein.
- control portion can be a simple electrical connection, resistive element, or can be removed completely.
- the intensity, duration and frequency of light generated would be directly controlled by the current generated from a magnetic field. This can be particularly useful for creating inexpensive, long lasting and small devices. An example of such an embodiment is discussed further in connection with FIG. 6A and FIG. 6B.
- control portion can be implemented as a more complex circuit.
- control circuit may include and otherwise implement different rectifier circuits, batteries, pulse timings, comparator circuits and the like.
- control circuit includes an integrated circuit (IC) produced using CMOS or other processes. Integrated circuit technology allows for the use of a large number of circuit elements in a very small area, and thus, a relatively complex control circuit can be implemented for some applications.
- IC integrated circuit
- the inductor (302 and 304 of FIG. 5) is a surface mount inductor, such as a lOOuH inductor part number CF1008- 103K supplied by Gowanda Electronics Corp.
- the light generating portion is a blue LED, such as LEDs in 0603 or 0805 package sizes.
- a particular example is a blue surface mount LED having part number SML0805, available from LEDtronics, Inc (Torrance, CA).
- Connective paths 306 and 308 can be implemented using various electrical conductors, such as conductive epoxies, tapes, solder or other adhesive materials.
- FIG. 6A shows a block diagram of an implantable device, according to an example embodiment of the present invention.
- FIG. 6A shows an inductor comprising coils 402 and core 404 connected to LED 408 using conductive paths shown by 406.
- FIG. 6B shows a circuit diagram corresponding to the block diagram of FIG. 6A.
- Inductor 412 is connected in parallel to LED 410. Thus, current and voltage generated by changing a magnetic field seen at inductor 412 causes LED 410 to produce light. The frequency and strength of the changing magnetic field can be varied to produce the desired amount and periodicity of light from LED 410.
- FIG. 7A and FIG. 7B show a diagram of a mesh for containing photosensitive bio-molecules, according to an example embodiment of the present invention.
- Mesh 502 is constructed having holes 504 of a size that allows illumination to pass but is small enough to prevent cells 506 to pass. This allows for cells 506 to be implanted while still receiving light from a light generator.
- the cells 506 are stem cells that are modified to be photosensitive.
- the stem cells are allowed to mature as shown by FIG. 7B.
- the stem cells mature into neurons having a cell body 512, axons/dendrites 508 and 510.
- the neurons are genetically modified to be photosensitive.
- Holes 504 are on the order of 3-7 microns in diameter. This size allows some axons and dendrites to pass through holes 504, while preventing the cell body 512 to pass.
- FIG. 8A and FIG. 8B show a diagram of a viral matrix, according to an example embodiment of the present invention.
- the viral matrix includes structure 602, which contains viral vectors 604.
- structure 602 includes a gel or fluid substance that contains viral vectors 604 until they are implanted in a mammal 606. Once viral vectors 604 are released, they infect target cells 608 in the vicinity of the implanted viral matrix as shown by FIG. 8B. Infected target cell 610 becomes photosensitive, and thus, light can be used to control the stimulation of target cell 610.
- structure 602 is a gelatin that has been impregnated, or otherwise sealed with viral vectors 604 contained within the gelatin.
- the gelatin When structure 602 is implanted, the gelatin is hydrated and or dissolved, thereby releasing viral vectors 604.
- Standard commercially available gelatin mix may be used, in addition to compounds such as Matrigel by BD Biosciences division of Becton Dickenson and Company (Franklin Lakes, NJ)
- FIG. 9 shows a circuit diagram of a circuit that produces light in response to a magnetic field, according to an example embodiment of the present invention.
- FIG. 9 includes an input circuit 720 and an output circuit 730.
- Inductor 704 generates current in response to magnetic field 702. Due to properties of magnetic fields, the current produced by inductor 704 is an alternating current (AC) signal.
- Full-wave bridge rectifier 706 rectifies the AC signal and along with an RC circuit generates a relatively stable voltage from the AC signal. This generated voltage is responsive to magnetic field 702 and output circuit 730 which generates light when the generated voltage is at a sufficient level. More specifically, power from battery 708 is used to drive LED 710 in response to magnetic field 702. This is particularly useful for applications where the magnetic field 702 seen by inductor 704 is less powerful (e.g., due to the in vivo location of inductor 704).
- AC alternating current
- FIG. 10A shows a circuit diagram of a circuit that produces light in response to RF signal 801, according to an example embodiment of the present invention.
- Antenna 802 is used to receive RF transmission 801 and convert the signal to electricity.
- the received transmission is rectified by diode 803 and further filtered by capacitor 805.
- diode 803 can be implemented using a diode having a low forward bias and fast switching capabilities, such as a Schottky diode.
- RF transmission 801 contains a power component for charging battery 815 and a signal component for controlling LED 825.
- Capacitor 805 can be selected to separate these components for use by the circuit.
- the power component may be a relatively low- frequency, large-amplitude signal, while the signal component is a relatively high- frequency, small-amplitude signal.
- Capacitor 805 can be selected to filter the power component of the signal to create a corresponding voltage. The remaining high- frequency component of the RF transmission is added to this voltage.
- the power component of the transmission can then be used to charge the battery 815, and the signal component of the transmission is used to enable LED 825.
- the light generated by LED 825 triggers stimulus of the target cells 827.
- FIG 10B illustrates an alternative embodiment radio-frequency energy accumulator, which charges a battery, which in turn, powers a digital pulse generator, which powers a LED.
- An electromagnetic signal 850 is received by loop antenna 852 generating a corresponding electrical signal.
- the voltage generated from loop antenna 852 is limited by the reverse bias voltage of the diodes 855 and 856 and stored in capacitor 854. In a particular instance these diodes have a low reverse bias voltage that is relatively precise, such as a Zener diode.
- Electromagnetic signal 850 is rectified via diode rectifier bridge 858 and filtered by voltage regulator 859 to produce a DC voltage. The DC can be used to charge power source 860.
- Battery 860 is coupled to the input of Schmidt trigger 865 through capacitor 862.
- the frequency of the square-wave output of Schmidt trigger 865 is determined by the values of the resistor-capacitor network including capacitor 863 and resistor 864. Resistor 864 and capacitor 863 may be fixed or variable.
- the output of Schmidt trigger 865 is fed through digital inverter 867 which powers LED 866. Light from LED 866 is transmitted to light-sensitive neurons 868 relative to the frequency of the square-wave output of Schmidt trigger 865.
- FIG. IOC illustrates block diagram for an electromagnetic field (EMF) energy accumulator and pulsing approach in which the received EMF 897 (for example radiofrequency energy) includes not only energy for accumulation, but also an encoded signal regarding instructions to microcontroller 895.
- EMF electromagnetic field
- step 885 Energy plus Parameter Control Signal: Encoding and transmission
- a control instruction signal is encoded to ride upon the energy component by methods known in the art, for example, by frequency modulation.
- Energy receiver block 890 uses a portion of the EMF signal to provide power to block 893.
- Control signal receiver block 891 uses a portion of the EMF signal to provide control instructions to microcontroller block 895.
- the control instruction can be used to transmit information regarding the various parameters of the generated light, such as frequency, strength, duration, color, and the like. These instructions can be decoded and processed using a microcontroller or logic circuitry as shown by block 895. Block 895 can generate control signal(s) in response to the decoded instructions. Accordingly, the frequency (and other parameters) of the light generated by LED 896 rate need not be fixed for the given implanted device.
- Antenna 889 delivers input to the Energy Receiver 890 (providing power to voltage regulator and battery circuitry 893). Concurrently, antenna 889 delivers encoded data to Control Signal Receiver 891, which provides control input to microcontroller 895 that drives LED 896. Selected wavelength light 897 is then delivered to electrically excitable cell 898.
- the battery in the voltage regulator and battery circuitry 893 provides power to the microcontroller 895 and the Control Signal Receiver 891.
- circuit diagrams of FIG. 9 and FIG. 10A, 10B and IOC are merely illustrative of a few particular embodiments of the present invention, and various other circuit diagrams of FIG. 9 and FIG. 10A, 10B and IOC.
- particular embodiments implement a light source that uses a blue LED; however, other colors and light sources can be implemented depending upon the particular application.
- the light source includes more than one color light source.
- the circuitry controls not only when light is provided, but which color, depending on whether the instructions require inhibition or excitation of the cell.
- the target cell express both an inhibitor (e.g., GtR3) and an exciter (e.g., VChRl), which respond to different wavelengths of light.
- the system can also control the level at which the cells are excited or inhibited. This can be done by including multiple light responsive proteins in the target cells that excite (or inhibit) and programming the instructions to provide more than one light wavelength at a single time.
- FIG. 11 A and FIG. 1 IB each show a diagram of a fiber-optic device, according to an example embodiment of the present invention.
- the fiber-optic device includes a control portion 908, a light generator 906 and a fiber optic cable 902.
- Fiber optic cable 902 can be positioned near a photosensitive biological portion, such as a viral matrix or synthetic mesh as discussed herein. This allows for control portion 908 and light generator 906 to be located at a distance from the target cells 910 (e.g., at a distance corresponding to the length of fiber-optic cable 902). This can be particularly useful for minimizing the size of the portion of the implanted device that is near the target cells, for example, where the target cells are located at or near a sensitive location within the brain. In some instances, the remote location of portions 908 and 906 also facilitates modifications of the device, including, but not limited to, replacement of various components (e.g., batteries), changes in stimulation frequency and length.
- various components e.g., batteries
- Control portion 908 can be configured to respond to an external signal, such as magnetic field or RF signals. Alternatively, control portion 908 can be configured to enable light generator 906 according to a programmed schedule or a combination of an external signal and a programmed response.
- an external signal such as magnetic field or RF signals.
- control portion 908 can be configured to enable light generator 906 according to a programmed schedule or a combination of an external signal and a programmed response.
- FIGs. 12A-12D depicts various stages in the production of a photosensitive biological portion, according to an example embodiment of the present invention. More specifically, FIG. 12A shows molding structure 1004 having several molds 1002. Molds 1002 are constructed to various sizes depending upon the particular application. In one such application, the molds are a few millimeters or less in diameter.
- FIG. 12B shows the molds 1002 from FIG. 12A after applying a layer of gelatin or similar substance as shown by 1006 and 1008.
- viral vectors (shown by 'v') are in the upper two molds. These viruses may be suspended within media 1012, which may be a liquid or gelatinous media. Such liquids include normal saline, HEPES- buffered saline and other known viral substances and transfer media. Suitable gelatinous media includes Matrigel (BD Biosciences, San Jose CA). These viral vectors are designed transfer genes for light-sensitization to the membranes of targeted cells after implantation.
- FIG. 12C shows a side view of mold 1006.
- 1016 represents the molding structure that forms the shape of gelatin layer 1014.
- Gelatin layer 1014 traps viral vectors contained within media 1012.
- a top gelatin layer 1010 is applied to fully contain the viral vectors.
- FIG. 12D shows the resulting viral vector capsule.
- the viral vectors 1018 are contained within area 1022 by casing 1020.
- Casing 1020 can be designed to dissolve or otherwise allow viral vectors 1018 to disseminate towards the target cells once implanted.
- the capsule is constructed of a water soluble material, for example, gelatin, so that upon implantation the viral vectors are allowed to escape into the body. Water soluble capsule materials are well known in the pharmaceutical industry.
- FIG.13 shows an implantation device, according to an example embodiment of the present invention.
- Biological portion 1 102 and light generation device 1108 are implanted using the implantation device.
- the shaft of the device 1 1 14 is positioned near the target cells.
- a user of the device presses on portion 11 16 which causes portion 11 12 to place biological portion 1 102 and light generation device 1108 near the target cells.
- the implantation device can then be removed.
- FIG. 14A and FIG. 14B show a diagram for another implantation device, according to an example embodiment of the present invention.
- Implantable light generating device 1204 is surrounded by, and permeated by fluid channels 1202. Fluid channels 1202 allow a solution 1210 containing bio-molecular material (e.g.,
- the fluid channels can be located outside of device 1204 and/or within device 1204, as shown by 1212 and 1214 respectively.
- the viral vectors can be injected in large quantities or over a period of time. For instance, cells infected by viral vectors can revert back to their pre-infection state after a period of time.
- the viral vectors can be periodically reintroduced to the target cells.
- different viral vectors can be introduced through the fluid channels, allowing for targeting of different cells at the implantation site. This can be particularly useful for staged treatment through stimulation of different types of cells.
- a specific embodiment of the present invention relates to a method for genetically modifying neurons to express light-sensitive ion channel DChR.
- pulses of blue light causes DChR neurons to fire action potentials corresponding to each pulse.
- Depolarization and repolarization occur on a millisecond timescale making this method consistent with normal network neurophysiology.
- DChR a cell membrane ion channel
- a neuronal-type specific feature which is also a robust promoter is inserted adjacent to the DChR code within the virus, and the line is propagated by calcium- phosphate cotransfection of 293FT cells. The supernatant is then centrifuged into viral pellets, which are placed within phosphate-buffered saline.
- DChR is used for photostimulation.
- the amino-acid residues comprising DChR channelrhodopsin from Dunaliella salina can be used to impart fast photosensitivity upon mammalian nerve cells, by using a viral vector to insert the gene for DChR into targeted nerve cells which may subsequently express this gene.
- ATR Upon illumination with approximately 500 nm blue/green light, ATR isomerizes and triggers a conformational change to open the channel pore.
- DChR is a light-sensitive ion channel, it allows an inward current to be evoked.
- application GtR3 (derived from Guillardia thetd) is used for photostimulation.
- This proton pump can be imparted upon mammalian nerve cells by using a viral vector to insert the gene for GtR3 into targeted nerve cells, which may subsequently express this gene.
- active pumping of protons out of the neuronal cytoplasm results in
- the insertion may be genetically targeted to the products expressed by specific cellular subtypes. For example, it might be advantageous to cause only dopaminergic neurons, and not cholinergic neurons to react to blue light.
- certain embodiments of the present invention involves the use of an optically responsive ion pump or ion channel that is expressed in a cell.
- the cell is either a neural cell or a stem cell.
- a specific embodiment involves in vivo animal cells expressing an ion pump.
- Certain aspects of the present invention are based on the identification and development of a proton pump, derived from Guillardia Theta, for example, for temporally-precise optical inhibition of neural activity. The pump allows both knockout of single action potentials within rapid spike trains and sustained blockade of spiking over many minutes.
- an optically responsive ion pump and/or channel is expressed in one or more stem cells, progenitor cells, or progeny of stem or progenitor cells.
- Optical stimulation is used to activate expressed pumps/channels. The activation can be used to control the proton
- optical stimulus is implemented to provide control over the (maturation) of stem or progenitor cells.
- methods for generating an inhibitory neuron-current flow involve, in a neuron, engineering a protein that responds to light by producing an inhibitory current to dissuade depolarization of the neuron.
- the protein is GtR3 is an exogenous molecule in the neuron, and in another method the protein is an inhibitory protein that uses an
- a method for controlling action potential of a neuron involves the following step: engineering a first light responsive protein in the neuron; producing, in response to light, an inhibitory current in the neuron and from the first light responsive protein; engineering a second light responsive protein in the neuron; and producing, in response to light, an excitation current in the neuron from the second light responsive protein.
- the combination of light responsive proteins may depend on the light sensitivity of the protein, the reaction time of the protein, and defined action of the protein, for example. Multiple light responsive proteins of the same type (inhibitory vs. excitatory) may be used in the same cell population to allow for, for example, long term blockage of action potential or single action potential inhibition depending on the light wavelength used.
- the method comprises: engineering a first light responsive protein in the cell; measuring the voltage level across the cell membrane; and producing, in response to light of a first wavelength and using the first light responsive protein, a current across the cell membrane that is responsive to the measured voltage level.
- the present invention is directed to a system for controlling an action potential of a neuron in vivo.
- the system includes a delivery device, a light source, and a control device.
- the delivery device introduces a light responsive protein to the neuron, with the light responsive protein producing an inhibitory current.
- the light source generates light for stimulating the light responsive protein, and the control device controls the generation of light by the light source.
- the light source is a blue light source and the light responsive protein is responsive to blue light.
- such a system is further adapted such that the delivery device introduces the light responsive protein by one of transfection
- transduction and microinjection and/or such that the light source introduces light to the neuron via one of an implantable light generator and fiber-optics.
- Another aspect of the present invention is directed to a method for treatment of a disorder.
- the method targets a group of neurons associated with the disorder; and in this group, the method includes engineering an inhibitory proteins that use an endogenous cofactor to respond to light by producing an inhibitory current to dissuade depolarization of the neurons, and exposing the neurons to light, thereby dissuading depolarization of the neurons.
- GtR3 is optimized for mammalian expression.
- a light responsive protein is isolated from Guillardia theta.
- the isolated protein has a C-terminus and an N-terminus.
- An endoplasmic reticulum (ER) export signal promoter is added to the C-terminus of the isolated protein, creating an enhanced light responsive protein.
- the promoter added to the isolated GtR3 varies depending on the desired location of expression.
- FIG. 15 depicts an arrangement with multiple light sources, according to an example embodiment of the present invention.
- Fig. 15 shows light sources 1602 and 1604 that illuminate proteins 1610 and 1614.
- the proteins 1610 and 1614 are engineered within cell 1612 to control current across the cell membrane in response to light from light sources 1602 and 1604, respectively.
- the first protein 1610 functions to dissuade action potential firing, while the second protein 1614 functions to encourage action potential firing.
- Each of proteins 1610 and 1614 are responsive to light.
- the first protein is responsive to light from light source 1602 having a wavelength A and the second protein is responsive to light from light source 1604 having a wavelength B.
- the light sources can be used to control each protein independently. This can be useful for both encouraging and dissuading action potentials in the cell.
- having both types of proteins allows for both positive and negative control of the cell membrane voltage.
- the different light sources and proteins could be used to control the voltage or current level (e.g., clamping) of the cell membrane.
- One method of determining responsiveness involves quantifying the
- the first or second protein can still be responsive to the alternate wavelength of light although the responsiveness of the protein may be less than that of the primary wavelength.
- a protein of a first type may have some responsiveness to the wavelength corresponding to the other type of protein while still maintaining sufficient independence of operation.
- control of the cell can be implemented by shifting either the wavelength of light or the intensity of the light. For instance, the wavelength can be shifted between A and B to induce a corresponding increase or decrease of the membrane voltage potential.
- multiple proteins having similar actions, but different activation wavelength may be introduced into the same cell. The response may vary as the wavelength is shifted, in some places the combination of the two responses create a greater response than from an individual protein.
- pump 1614 can optionally be implemented for purposes other than dissuading action potential firing, such as controlling the voltage level of cell 1612.
- a sensor can be used provide feedback to the light source 1602.
- this feedback could be a measurement of the voltage or current across the cell membrane.
- the light source could be configured to maintain a constant current or voltage (e.g., clamp) across the cell.
- the amount of responsiveness can be controlled by modifying one or more of the intensity and wavelength of the light.
- FIG. 16 shows a system for controlling electrical properties of one or more cells in vivo, according to an example embodiment of the present invention.
- Control/Interface unit 1702 enables/disables light source 1704 to illuminate target ceils 1708.
- a delivery mechanism such as fiber optic cable 1706, routes or otherwise directs the light to target cells 1708.
- Fiber optic cable 1706 may include a bundle of optical cables, each capable of carrying and directing light independently. Thus, fiber optic cable 1706 can be configured to deliver light having one or more wavelengths to multiple locations.
- Sensor 1710 can be implemented e.g., as an optical device such as an optical scope or as a voltmeter, to provide feedback to control unit 1702. In a particular instance, the feedback includes optical imaging of the target cells or of other related cells. In another instance, the feedback could monitor the voltage response of the target cells, including the amount of action potential firing.
- Fig. 17 shows a system for controlling electrical properties of one or more cells in vivo, according to an example embodiment of the present invention.
- Control/Interface unit 1802 enables/disables implantable light source 1804, which in turn illuminates target cells 1806.
- Light source 1804 is shown with two light source, inhibitory current light source 1808 and excitation current light source 1810.
- Light source 1808 produces light at a wavelength and intensity that an inhibitory protein is responsive to, while light source 1810 produces light at a wavelength and intensity that an excitation protein is responsive to.
- One skilled in the art would recognize that various configurations of light source 1810 are possible, including a single inhibitory light source or an array of light sources having one or more wavelengths.
- Control/Interface unit 1802 communicates with light source 1804 through any suitable communication mechanisms, such as wired communications or wireless communications using radio-frequency signals, magnetic signals and the like. As discussed above in connection with Fig. 16, sensor 1812 can optionally be implemented for providing feedback to control unit 1802.
- Certain embodiments of the present invention can be useful in drug screening.
- the various light-sensitive proteins serving to regulate membrane voltage using ion switches that, when activated (or deactivated) in response to light, function as channels or pumps and are referred to hereafter as light-responsive ion switches or light-activated membrane potential switches (LAMPS).
- LAMPS light-responsive ion switches or light-activated membrane potential switches
- a system screens for ion-channel and ion-pump affecting compounds.
- the system introduces one or more drug candidates that could either block or enhance the activity of ion-channels or ion-pumps to cells that were made optically responsive by the addition of a combination of the above mentioned proteins (ChR2, DChR and NpHR among others), for the purpose of screening the drug candidates.
- the voltage change stimulates voltage-gated ion channels in the cells which will then cause a change in ion concentrations that can be read as optical outputs.
- These optical signals are detected and used to determine what effect, if any, the drug candidates have on the voltage-gated ion channels.
- a protein expressing a proton pump is introduced into the cell.
- the system allows for different drug candidates to be screened without necessitating extensive setup between screenings.
- an assay may be performed using optics both to stimulate the optically responsive cells and to detect the effectiveness of the drug.
- optics instead of manual contacts, e.g., using a whole-cell patch clamp, can be particularly useful in increasing the throughput of the assay screening process.
- the time between screenings can be reduced by minimizing or eliminating physical manipulations otherwise necessary to stimulate or detect ion flow in the target cells.
- the cells can also be prepared prior to the screening process because the test equipment need only be optically coupled to the prepared cells.
- throughput may be increased by screening a number of different drugs simultaneously using, for example, an array of photo detectors and a
- a cell line based approach is not limited to a particular ion channel.
- cell lines can be created for voltage-gated sodium (e.g., Na v l . l through
- v such as hERG, TASK1 , Shaker, or KvLQTl
- chloride conducting channels/pumps e.g., members of the CLC family of chloride channels.
- the methods of introducing such genes into the cell line are known in the art and may include, for example liposomal transfection, or viral gene transfer.
- transfer vectors may be generated using various genetic engineering techniques.
- the transfer vectors may be derived from a provirus clone of a retrovirus, such as an immunodeficiency virus (e.g., HIV-1 or HIV-2, or SIV).
- an immunodeficiency virus e.g., HIV-1 or HIV-2, or SIV.
- optical stimulation of the modified cells may be altered to determine specific properties of an introduced drug candidate.
- the intensity of the optical stimulus may be modified to change the corresponding level of depolarization.
- the level of desired depolarization can be tuned to further
- the optical stimulus may include rapid pulsing of the light.
- the drug may be further characterized in terms of a kinetic response.
- the drug may be characterized for a variety of different aspects including, but not limited to, the steady state effect on
- the system allows for simple calibration of the optical stimulation and/or detection.
- the modified cells may be optically stimulated prior to introduction of the drug candidate.
- the ion channel responsiveness is detected and recorded.
- the recorded values may be used as a baseline for comparison to the ion channel responsiveness of the same modified cells after the introduction of the drug under test.
- the recorded values may also be used to modify the optical stimulus or the sensitivity of the optical detector. Such modifications may be applied to an individual test sample or an array of test samples. For such an array of test samples, each test sample may be individually calibrated by adjusting the corresponding optical stimulus. Similarly, each corresponding photo detector may be individually adjusted.
- FIG. 18A shows a basic block diagram of a system for screening for ion-channel affecting drugs, according to an embodiment of the invention.
- Optical control 1904 communicates with database 1902, optical source 1906 and optical detector 1909.
- Optical source 1906 provides optical stimulus to test sample 1908.
- Test sample 1908 includes the drug under test, cells with optically responsive ion channels, and a voltage/ion indicator. In one instance, the indicator fluoresces in response to light from optical source 1906.
- Optical control 1904 may also include a reconfigurable readout, so that as different LAMPS and different LEI As are used, the same control system can be readily adapted to each paradigm.
- Optical detector 1909 produces a signal responsive to such florescence, and optical control 1904 receives the produced signal.
- the optical control 1904 stores data obtained from the signal in database 1902. The information stored may include factors such as the intensity, duration and wavelength of the detected light.
- the stored data can be compared against baseline data, where the baseline data corresponds to data recorded prior to the introduction of the drug to the test sample 1908.
- optical source 1906 may vary the intensity, duration or other parameters related to the control of optical source 1906. These and other parameters may be stored in database 1902.
- optical source 1906 may be implemented using a single light source, such as a light-emitting diode (LED), or using several light sources.
- a single light source such as a light-emitting diode (LED)
- LED light-emitting diode
- optical detector 1909 may use one or more detectors and database 1902 may be implemented using any number of suitable storage devices.
- FIG. 18B shows a system diagram of a large-format, quasi-automated system for drug screening in accordance with a specific embodiment of the invention.
- Control device 1901 e.g., a computer or control logic
- the environment may be maintained at an appropriate temperature, humidity, carbon dioxide level and ambient light level within the walls of the climate control chamber 1905, with the help of one or more sensors 1914 (e.g., thermostat, carbon dioxide sensor and humidity sensor), carbon dioxide and humidifier apparatus 1912, and heater 1910.
- Multi-well tray 1941 contains test wells 1940 for holding cultured cells, drugs, and other ingredients needed for each test.
- Tray 1941 rests upon X-Y-Z table 1925, the movement of which is carried out by table actuators 1920, under control of computer 1901.
- Xenon lamp 1955 emits high- intensity white light 1956, which is passed through color filter 1960.
- color filter 1960 is blue, causing blue light 1961 to exit the filter, and strike dichroic mirror 1970. Blue light 1961 then passes upward, through microscope objective lens apparatus 1930, and through bottom of transparent tray 1941. In this fashion, the contents of wells 1940, with their transparent undersides, are illuminated.
- a filter of the appropriate specification may be substituted for the previous filter 160, causing light of the proper wavelength for this latter task to be piped toward well 1940. If the cells within well 1940 have been light-sensitized, and if the drug being tested in each of these wells does not suppress the process, a light-emitting indicator of cellular activity (LEIA), which has also been added to each well or expressed by the cells via genetic
- This second wavelength of light which may be much smaller in magnitude than the stimulation light, is collected by microscope turret 1935, and will also be passed through dichroic mirror 1975, onto the lens of (CCD) camera 1980.
- Dichroic mirror 1970 allows for upward reflection of both the wavelength required to stimulate the optical gating of the membrane (e.g., blue-green for DChR), and the wavelength required by any LEIA used (e.g., ultraviolet for FURA-2).
- This dichroic mirror may be arranged to allow passage of the output spectrum of the LEIA (e.g., blue- green for FURA-2) with minimal reflection or absorption.
- FIG. 19 is a system diagram of an automated-drug-screening system, according to an example embodiment of the invention.
- Emitter/detector units 2050 make up the emitter/detector array 2051.
- Emitter/detector array 2051 matches the number, size, and layout of the wells on tray 2040.
- Tray holding device 2025 permits tray swapping mechanism 2020 to rapidly move a new tray into position once testing of a given tray has been completed.
- the entire process may be automated, and under the control of device 2001.
- Device 2001 can be implemented using a computer, control logic, programmable logic arrays, discreet logic and the like.
- the introduction of the drug candidates under test can also be automated using a machine that provides a reservoir for storing the drugs and a dispensing nozzle for injecting the drugs into the tray.
- a machine that provides a reservoir for storing the drugs and a dispensing nozzle for injecting the drugs into the tray.
- the use of multiple stimulator/detector elements simultaneously and in parallel can be particularly useful for augmenting the speed of the overall process.
- Low cost elements may be used to make multiple parallel detectors ⁇ e.g., the components detailed below in description of FIG. 20A and 20B); the multiple parallel emitter/detector units may also be quite economically feasible.
- FIG. 20A depicts the workings of emitter/detector units, such as those shown in FIG. 19, according to an example embodiment of the invention.
- An LED stimulates light-sensitive ion channels of cells located within a well, and a photodiode detects the response of a LEIA.
- device 2101 includes LED 2110, which produces light pulses 2111, at the proper wavelength, pulse frequency and intensity, so as to stimulate light-sensitive transgenic cells 2105 in culture within well 2106. Due to the presences of an LEIA ⁇ e.g., a voltage-sensitive dye or a calcium dye), light 2116 is returned from cells 2105, and is detected by photodiode 2115.
- an LEIA e.g., a voltage-sensitive dye or a calcium dye
- red light is fluoresced and detected by photodiode 2115.
- no fluorescence is detected by photodiode 2115.
- Other light detecting technologies may also be used instead of a photodiode including
- photostimulation may simplify the study of excitable cells by reducing the need to use mechanical electrodes for stimulation.
- LEIAs are suitable for these reasons.
- LEIA calcium dye Fura-2, which may be stimulated with violet/ultraviolet light around 340nm, and whose fluorescent output is detectable as blue-green light around 535 nm.
- voltage sensitive dye RH 1691 which may be stimulated with green light at about 550nm, and whose fluorescent output is detectable as red light at about 70 nm.
- voltage sensitive dye di-4-ANEPPS which is stimulated by blue light at about 560nm, and whose fluorescent output is detectable as red light at about 640nm.
- FIG. 20B depicts the workings of another embodiment of the emitter/detector units shown in the FIG. 19, in which multiple effects are tested within the context of a single well.
- the cells 2155 in the wells 2156 may express both GtR3 and VChRl, and hence be sensitive to both the hyperpolarizing effects of blue light, and the depolarizing effects of amber light.
- Device 2151 includes LED 2160, which is used for the stimulation of the targeted proton pump (e.g., GtR3) of light-sensitive transgenic cells 2155.
- Additional LED 2175 may be used to stimulate a second targeted ion channel or pump (e.g., VChRl).
- Yet another LED 2180 may be used to stimulate a voltage sensitive dye (e.g., RH1691 or calcium dye, such as Fura-2).
- a voltage sensitive dye e.g., RH1691 or calcium dye, such as Fura-2.
- Each LED may be arranged to output specific wavelengths and intensities for stimulus of respective targeted compounds. In one instance, an LED may affect more than one target, depending upon the specific sensitivities of each compound used.
- Photodiode 2165 detects the fluorescence of a selected voltage dye, while photodiode 2170 is sensitive to the spectrum fluoresced by a selected calcium dye.
- the use of multiple LEDs for the same cell allows for the stimulation of LEIAs at different wavelengths. Multiple LEDs may also be used to detect different light wavelengths emitted by the LEIA.
- FIG. 21 A depicts an electronic circuit mechanism for activating the LED emitters used within the emitter/detector units, according to an example embodiment of the invention.
- Control device 2201 generates a "light on signal" 2202 to transistor base 2205. This light on signal 2202 will remain on for the duration of a light flash desired, or alternatively may turn on and off in order to produce rhythmic light flashes at a specified frequency.
- Light on signal 2202 permits (conventional) current to flow from power source 2210, through resister 2211, and through transistor collector 2207 and transistor emitter 2212, to ground 2213. Current is also thereby permitted to pass through resistor 2215, and into LED 2220.
- LED 2220 emits light 2221 , which falls upon well 2225.
- the transistor functions as transconductance amplifier of signal 2202.
- light of the appropriate wavelength, intensity and frequency is delivered to cells within the well 2225, so as to cause them to stimulate the particular channel (e.g., DChR) or pump (e.g., GtR3), or other photoactive membrane structure being used to regulate the activity of electrically excitable cells.
- DChR DChR
- pump e.g., GtR3
- other circuits can be used in place of circuit 2206 to control LED 2220 including, but not limited to, replacing the transistor with an operational amplifier, a field-effect-transistor, a resistor divider network, transistor- transistor logic, push-pull driver circuits and switches.
- FIG. 21B depicts an example electronic circuit mechanism for light detection by the emitter/detector units, according to one embodiment of the invention.
- Control device 2250 may (optionally, depending upon specific implementation) provide power to photodiode 2255.
- Photodiode 2255 receives fluoresced (emitted) light 2256 from the LEIA on the cells within well 2257. The received light results in an output signal. This output passes through resistor 2260, and is input to Schmitt triggered hex inverter 2270, which conditions the signal, providing a clean "high” or "low value” to be input to computer 2250.
- Photodetector Operation of the photodetector is shown in photovoltaic mode, but the element may also be used in the photoconductive mode of operation.
- many other light- detection devices and methods may also be used, including phototransistors, photothyristors, and charged-coupled device (CCD) elements, or arrays of elements.
- CCD charged-coupled device
- circuit of FIG. 21 B can be used without Schmitt-triggered hex inverter 2270, permitting a continuum of signal intensities to be transmitted directly to an analog input to computer 2250 or to an analog-to-digital converter.
- Various other signal conditioning circuits are also possible.
- FIG. 22 shows a sequence of steps using the embodiment shown in FIGs. 19, 20 and 21 , in the context of projected high-throughput process time course 2300 and in accordance with one embodiment of the invention.
- step 2305 light of the appropriate wavelength and intensity for the targeted ion channel is flashed-in this case for approximately three seconds.
- a LEIA stimulation flash 2310 may optionally be triggered, depending upon the specific voltage or calcium dye, etc. being used.
- This LEIA compound may have been previously added to the well, or may be (artificially) genetically imparted upon the cells such that the chemical is
- the light signal produced by the LEIA is detected by the photodetector element (e.g., photodiode).
- the photodetector element e.g., photodiode
- RH1691 fluoresces red light at about 70 nm.
- step 2320 the signal resulting from the impingement of light onto the photodetector element is sent back to the computer.
- This may be a binary (e.g.. "high” versus “low” signal intensity), or may be graded to reflect a continuum of activation levels.
- the individual readings of these photodetectors may be logged in parallel or in sequence for appropriate interpretation in a later stage of the automated process.
- step 2330 the system calls for the next tray to be placed by the automated system. The next tray is moved into position at step 2335 and the process may be repeated until all trays in a batch have been processed.
- the amount of time allotted for light delivery may vary, and depends on factors including the level of light-gated proton or ion channel/pump expression, and the density and characteristics of other proton/ionic channel characteristics of that cell population.
- the amount of time allotted for light receipt may vary, and depends upon factors including the degree of accuracy required for the screening session.
- the amount of time allotted for well-plate (tray) changing may vary, and depends upon factors including the mechanical speed of the automated apparatus. If fast neurons are used as the cells being tested, the cellular stimulation and LEIA detection process may be accomplished in milliseconds.
- the process above may be repeated under varying conditions. For example, a given set of cells may be tested with no drug present, and subsequently with one or more drugs present. The response of electrically-excitable cells under those conditions may be thereby documented, compared and studied. If the invention is implemented with at least one emitter/detector for each well on a tray and at least two concurrently operating devices, continuous operation may be maintained for extended periods of time.
- FIG. 23 illustrates an example of a layout of cell and drug samples within the wells of a well-plate which is suitable for use within an embodiment of the invention.
- well-plate 2401 also referred to herein as a "tray” contains wells 2405 (examples), which are organized into columns 2425, labeled with numbers 1-12 and rows 2420, labeled with letters A-H. More specifically, an example column and row are defined by 2410 and 2415 respectively.
- rows A-H of a single plate might be used for the testing of two different drugs.
- column 1 might contain optically gated cells, an endogenous or exogenous LEIA, but no drug.
- Columns 2-6 might be used for five different concentrations of Drug X, one concentration level per column.
- columns 7- 1 1 might be use for five different concentrations of Drug Y. one concentration per column.
- Column 12, while fully usable, is left unused in this particular example.
- Variables in the various wells might include the type of cell being tested, the type of ion channel being tested for, the type of drug placed in the cell, the concentration of the drug placed in the well, the specific LEIA used, and the optical gating stimulation parameters (e.g., wavelength, intensity, frequency, duration) applied to the cells in that well.
- the optical gating stimulation parameters e.g., wavelength, intensity, frequency, duration
- FIG. 24 illustrates the context in which the disclosed invention may be employed within a larger system which facilitates high-throughput drug screening.
- Well-plate 2506 contains wells 2505. These are carried forward by conveyer 2520, which may be a device such as a conveyor belt, robotic transporter or other delivery mechanism. Pipettes 2510 are held in array by robotic member 2515, and serve to inject the proper number of cultured cells and media into wells 2505. Subsequently, well-plate 2506 is moved down conveyer 2520, where robotic member 2525, analogous to robotic member 2515 and also containing pipettes, injects the proper amount of a LEIA into wells 2505. Conveyer 2520 then brings well-plate 2505 into screening chamber 2530.
- An emitter/detector apparatus such as those described in connection with FIG. 17, FIG. 18 A, FIG. 18B, FIG. 19A, and FIG. 19B, is located within chamber 2530. Additionally, portions of the processes described in FIG. 20A and FIG. 20B may occur within this chamber.
- well-plates 2535 is moved out of screening chamber 2530 by conveyor 2540, and discarded at 2545.
- one or more robotic devices may move pipettes 2510, screening chamber 2530, etc. to the locations of well-plate 2506, rather than vice-versa.
- example screening methods could include the collection of multiple data points without having to switch samples. Because control over the samples is reversible in the same sample preparation by simply turning the activating light on and off with fast shutters, the same samples can be reused. Further, a range of patterns of stimulation can be provided to the same cell sample so that testing can be performed for the effect of drugs without concern with regards to differences across different sample preparations. By modulating the level of excitation (e.g., by ramping the level from no light to a high or maximum intensity), the effect of the drug across a range of membrane potentials can be tested. This permits for the identification of drugs that are efficacious during hyperpolarized, natural, or depolarized membrane potentials.
- the cell lines described herein may be a particularly useful for detailed characterization of drug candidates in a high-throughput manner. Optical control is relatively fast, thereby allowing for the testing the drug's activity under more
- physiological forms of activation For example, different frequencies of depolarization and/or hyperpolarization may be used to determine how a drug interacts with the channel under physiological forms of neural activity. In some instances, the process may be accomplished without the application of expensive chemical dyes to the cell lines.
- the use of various embodiments of the invention may be particularly useful for improving screening throughput by eliminating the need for cumbersome mechanical manipulation and liquid handling.
- Various embodiments may also be useful for repeatable the screening assay using the same samples, reducing screening cost by eliminating the need for chemically- based fluorescence reports, producing high temporal precision and low signal artifact (due to the optical nature of the voltage manipulation), modulating the level of depolarization by attenuating the light intensity used for stimulation, and ascertaining the kinetics of the drug's modulation on the ion channel through the use of pulsed light patterns.
- stimulation profiles may exploit overlaps in the excitation wavelengths of two different ion channel proteins to allow excitation of both proteins at the same time.
- the proteins may have different levels of responsibility.
- one set of ion channels may produce spiking at a different success percentage relative to a second set of ion channels.
- the overlaps in inhibition wavelengths of two different ion channels (or pumps) allows for inhibition of both proteins at the same time.
- multiple light sources may be used allowing for stimulations of the light responsive proteins in the combination desired, while leaving other proteins unstimulated.
- Addiction is associated with a variety of brain functions, including reward and expectation. Additionally, the driving cause of addiction may vary between individuals. According to one embodiment, addiction, for example nicotine addiction, may be treated with optogenetic stabilization of small areas on the insula. Optionally, functional brain imaging, for example cued-state PET or fMRJ, may be used to locate a hyper metabolic focus in order to determine a precise target spot for the intervention on the insula surface.
- Optogenetic excitation of the nucleus accumbens and septum may provide reward and pleasure to a patient without need for resorting to use of substances, and hence may hold a key to addiction treatment. Conversely, optogenetic stabilization of the nucleus accumbens and septum may be used to decrease drug craving in the context of addiction. In an alternative embodiment, optogenetic stabilization of hyper metabolic activity observed at the genu of the anterior cingulate (BA32) can be used to decrease drug craving. Optogenetic stabilization of cells within the arcuate nucleus of the medial hypothalamus which contain peptide products of pro-opiomelanocortin (POMC) and cocaine-and-amphetamine-regulating transcript (CART) can also be used to decrease drug addiction behavior.
- POMC pro-opiomelanocortin
- CART cocaine-and-amphetamine-regulating transcript
- Optogenetic stimulation of neuroendocrine neurons of the hypothalamic periventricular nucleus that secrete somatostatin can be used to inhibit secretion of growth hormone from the anterior pituitary, for example in acromegaly.
- Optogenetic stabilization of neuroendocrine neurons that secrete somatostatin or growth hormone can be used to increase growth and physical development.
- Optogenetic stabilization of the ventromedial nucleus of the hypothalamus can be used to increase appetite, and thereby treat anorexia nervosa.
- optogenetic stimulation of the lateral nuclei of the hypothalamus can be used to increase appetite and eating behaviors.
- Optogenetic excitation in the cholinergic cells of affected areas including the temporal lobe, the NBM (Nucleus basalis of Meynert) and the posterior cingulate gyrus (BA 31) provides stimulation, and hence neurotrophic drive to deteriorating areas.
- an analogous treatment with implanted electrodes may be less feasible than an opto-genetic approach.
- Anxiety disorders are typically associated with increased activity in the left temporal and frontal cortex and amygdala, which trends toward normal as anxiety resolves. Accordingly, the affected left temporal and frontal regions and amygdala may be treated with optogenetic stabilization, so as to dampen activity in these regions.
- photosensitive neural cells of the retina which depolarize in response to the light that they receive, create a visual map of the received light pattern.
- Optogenetic ion channels can be used to mimic this process in many parts of the body, and the eyes are no exception.
- a functionally new retina can be grown, which uses natural ambient light rather than flashing light patterns from an implanted device.
- the artificial retina grown may be placed in the location of the original retina (where it can take advantage of the optic nerve serving as a conduit back to the visual cortex).
- the artificial retina may be placed in another location, such as the forehead, provided that a conduit for the depolarization signals are transmitted to cortical tissue capable of deciphering the encoded information from the optogenetic sensor matrix.
- Cortical blindness could also be treated by simulating visual pathways downstream of the visual cortex. The stimulation would be based on visual data produced up stream of the visual cortex or by an artificial light sensor.
- Treatment of tachycardia may be accomplished with optogenetic stimulation to parasympathetic nervous system fibers including CN X or Vagus Nerve. This causes a decrease in the S A node rate, thereby decreasing the heart rate and force of contraction.
- optogenetic stabilization of sympathetic nervous system fibers within spinal nerves Tl through T4 serves to slow the heart.
- optogenetic stabilization of the Vagus nerve, or optogenetic stimulation of sympathetic fibers in Tl through T4 will serve to increase heart rate.
- Cardiac disrhythmias resulting from aberrant electrical foci that outpace the sinoatrial node may be suppressed by treating the aberrant electrical focus with moderate optogenetic stabilization.
- Optogenetic excitation stimulation of brain regions including the frontal lobe, parietal lobes and hippocampi may increase processing speed, improve memory, and stimulate growth and interconnection of neurons, including spurring development of neural progenitor cells.
- one such application of the present invention is directed to optogenetic excitation stimulation of targeted neurons in the thalamus for the purpose of bringing a patient out of a near- vegetative (barely-conscious) state. Growth of light-gated ion channels or pumps in the membrane of targeted thalamus neurons is affected.
- modified neurons are then stimulated (e.g., via optics which may also gain access by the same passageway) by directing a flash of light thereupon so as to modulate the function of the targeted neurons and/or surrounding cells.
- appropriate modulation techniques via electrode-based treatment
- optogenetic excitation may be used to treat weakened cardiac muscle in conditions such as congestive heart failure. Electrical assistance to failing heart muscle of CHF is generally not practical, due to the thin- stretched, fragile state of the cardiac wall, and the difficulty in providing an evenly distributed electrical coupling between an electrodes and muscle. For this reason, preferred methods to date for increasing cardiac contractility have involved either pharmacological methods such as Beta agonists, and mechanical approaches such as ventricular assist devices.
- optogenetic excitation is delivered to weakened heart muscle via light emitting elements on the inner surface of a jacket surround the heart or otherwise against the affected heart wall. Light may be diffused by means well known in the art, to smoothly cover large areas of muscle, prompting contraction with each light pulse.
- Optogenetic stabilization in the subgenual portion of the cingulate gyrus (Cg25), yellow light may be applied with an implanted device.
- the goal would be to treat depression by suppressing target activity in manner analogous to what is taught by Mayberg HS et al, "Deep Brain Stimulation for Treatment-Resistant Depression," Neuron, Vol. 45, 651-660, March 3, 2005, pp. 651-660, which is fully incorporated herein by reference.
- an optogenetic excitation stimulation method is to increase activity in that region in a manner analogous to what is taught by Schlaepfer et al., "Deep Brain stimulation to Reward Circuitry Alleviates Anhedonia in Refractory Major Depression,” Neuropsychopharmacology 2007, pp. 1-10, which is fully incorporated herein by reference.
- the left dorsolateral prefrontal cortex is targeted with an optogenetic excitation stimulation method.
- Pacing the LDLPFC at 5-20 Hz serves to increase the basal metabolic level of this structure which, via connecting circuitry, serves to decrease activity in Cg 25, improving depression in the process.
- Suppression of the right dorsolateral prefrontal cortex (RDLPFC) is also an effective depression treatment strategy. This may be accomplished by optogenetic stabilization on the RDLPFC, or suppression may also be accomplished by using optogenetic excitation stimulation, and pulsing at a slow rate ⁇ e.g. , 1 Hz or less) improving depression in the process.
- Vagus nerve stimulation may be improved using an optogenetic approach. Use of optogenetic excitation may be used in order to stimulate only the vagus afferents to the brain, such as the nodose ganglion and the jugular ganglion.
- the hippocampus may be optogenetically excited, leading to increased dendritic and axonal sprouting, and overall growth of the hippocampus.
- Other brain regions implicated in depression that could be treated using this invention include the amygdala, accumbens, orbitofrontal and orbitomedial cortex, hippocampus, olfactory cortex, and dopaminergic, serotonergic, and noradrenergic projections.
- Optogenetic approaches could be used to control spread of activity through structures like the hippocampus to control depressive symptoms.
- the islets can be targeted for the treatment of diabetes.
- optogenetic excitation may be used to cause insulin release from the beta cells of the islets of Langerhans in the pancreas
- optogenetic stabilization is used to prevent glucagon release from the alpha cells of the islets of Langerhans in the pancreas.
- optogenetic stabilization may be used to stop beta cell secretion of insulin
- optogenetic excitation may be used to increase alpha-cell secretion of glucagon.
- Optogenetic stabilization could be used to suppress the abnormal activity before it spreads or truncated it early in its course.
- activation of excitatory tissue via optogenetic excitation stimulation could be delivered in a series of deliberately asynchronous patterns to disrupt the emerging seizure activity.
- Another alternative involves the activation of optogenetic excitation stimulation in GABAergic neurons to provide a similar result.
- Thalamic relays may be targeted with optogenetic stabilization triggered when an abnormal EEG pattern is detected.
- Another embodiment involves the treatment of gastrointestinal disorders.
- the digestive system has its own, semi-autonomous nervous system containing sensory neurons, motor neurons and interneurons. These neurons control movement of the GI tract, as well as trigger specific cells in the gut to release acid, digestive enzymes, and hormones including gastrin, cholecystokinin and secretin. Syndromes that include inadequate secretion of any of these cellular products may be treated with optogenetic stimulation of the producing cell types, or neurons that prompt their activity.
- optogenetic stabilization may be used to treat syndromes in which excessive endocrine and exocrine products are being created.
- Disorders of lowered intestinal motility ranging from constipation (particularly in patients with spinal cord injury) to megacolan may be treated with optogenetic excitation of motor neurons in the intestines.
- Disorders of intestinal hypermotility, including some forms of irritable bowel syndrome may be treated with optogenetic stabilization of neurons that control motility.
- Neurogenic gastric outlet obstructions may be treated with optogenetic stabilization of neurons and musculature in the pylons.
- An alternative approach to hypomobility syndromes would be to provide optogenetic excitation to stretch-sensitive neurons in the walls of the gut, increasing the signal that the gut is full and in need of emptying.
- an approach to hypermobility syndromes of the gut would be to provide optogenetic stabilization to stretch receptor neurons in the lower GI, thus providing a "false cue" that the gut was empty, and not in need of emptying.
- gaining improved control of the internal and external sphincters may be preferred to slowing the motility of the entire tract.
- optogenetic excitation of the internal anal sphincter will provide for retention.
- Providing optogenetic stimulation to the external sphincter may be used to provide additional continence.
- the internal anal sphincter, and then external anal sphincter should be relaxed, either by pausing the optogenetic stimulation, or by adding optogenetic stabilization.
- Conductive hearing loss may be treated by the use of optical cochlear implants. Once the cochlea has been prepared for optogenetic stimulation, a cochlear implant that flashes light may be used. Sensorineural hearing loss may be treated through optical stimulation of downstream targets in the auditory pathway.
- Another embodiment of the present invention is directed toward the treatment of blood pressure disorders, such as hypertension.
- Baroreceptors and chemoreceptors in regions such as the aorta (aortic bodies and paraaortic bodies) and the carotid arteries (“carotic bodies") participate in the regulation of blood pressure and respiration by sending afferents via the vagus nerve (CN X), and other pathways to the medulla and pons, particularly the solitary tract and nucleus.
- Optogenetic excitation of the carotid bodies, aortic bodies, paraortic bodies may be used to send a false message of
- hypertension may be treated with optogenetic stabilization of the heart, resulting in decreased cardiac output and lowered blood pressure.
- optogenetic stabilization of aldosterone-producing cells within the adrenal cortex may be used to decrease blood pressure.
- hypertension may be treated by optogenetic stabilization of vascular smooth muscle. Activating light may be passed transcutaneousiy to the peripheral vascular bed.
- Another example embodiment is directed toward the treatment of hypothalamic- pituitary-adrenal axis disorders.
- optogenetic excitation of parvocellular neuroendocrine neurons in the paraventricular and anterior hypothalamic nuclei can be used to increase secretion of thyrotropin-releasing hormone (TRH).
- TRH thyrotropin-releasing hormone
- hyperthyroidism may be treated with optogenetic stabilization of the provocellular neuroendocrine neurons.
- optogenetic excitation of parvocellular neuroendocrine neurons in the supraoptic nucleus and paraventricular nuclei may be used to increase the secretion of vasopressin, which, with the help of corticotropin-releasing hormone (CRH), stimulate anterior pituitary to secrete ACTH.
- CHL corticotropin-releasing hormone
- Neuroendocrine neurons of supraoptic nucleus via the same physiological chain of effects described above.
- Neuroendocrine neurons of the arcuate nucleus produce dopamine, which inhibits secretion of prolactin from the anterior pituitary.
- Hyperprolactinemia can therefore be treated via optogenetic excitation, while hypoprolactinemia can be treated with optogenetic stabilization of the neuroendocrine cells of the arcuate nucleus.
- optogenetic stabilization of the adrenal medulla may be used to reduce norepinephrine output.
- optogenetic stimulation of the adrenal medulla may be used in persons with need for adrenaline surges, for example those with severe asthma, or disorders that manifest as chronic sleepiness.
- Optogenetic stimulation of the adrenal cortex will cause release of chemicals including Cortisol, testosterone, and aldosterone.
- the adrenal cortex receives its instructions from neuroendocrine hormones secreted from the pituitary and hypothalamus, the lungs, and the kidneys. Regardless, the adrenal cortex is amenable to optogenetic stimulation.
- Optogenetic stimulation of the cortisol-producing cells of the adrenal cortex may be used to treat Addison's disease.
- Optogenetic stabilization of cortisol-producing cells of the adrenal cortex may be used to treat Cushing's disease.
- Optogenetic stimulation of testosterone-producing cells may be used to treat disorders of sexual interest in women: Optogenetic stabilization of those same cells may be used to decrease facial hair in women. Optogenetic stabilization of aldosterone-producing cells within the adrenal cortex may be used to decrease blood pressure. Optogenetic excitation of aldosterone-producing cells within the adrenal cortex may be used to increase blood pressure.
- Optogenetic excitation stimulation of specific affected brain regions may be used to increase processing speed, and stimulate growth and interconnection of neurons, including spurring the maturation of neural progenitor cells. Such uses can be particularly useful for treatment of mental retardation.
- various muscle diseases and injuries can be treated.
- Palsies related to muscle damage, peripheral nerve damage and to dystrophic diseases can be treated with optogenetic excitation to cause contraction, and optogenetic stabilization to cause relaxation.
- optogenetic stabilization to cause relaxation.
- This latter relaxation via optogenetic stabilization approach can also be used to prevent muscle wasting, maintain tone, and permit coordinated movement as opposing muscle groups are contracted.
- frank spasticity can be treated via optogenetic stabilization.
- Obesity can be treated with optogenetic excitation to the ventromedial nucleus of the hypothalamus, particularly the pro-opiomelanocortin (POMC) and cocaine-and- amphetamine-regulating transcript (CART) of the arcuate nucleus.
- POMC pro-opiomelanocortin
- CART cocaine-and- amphetamine-regulating transcript
- obesity can be treated via optogenetic stabilization of the lateral nuclei of the hypothalamus.
- optogenetic stimulation to leptin-producing cells or to cells with leptin receptors within the hypothalamus may be used to decrease appetite and hence treat obesity.
- OCD48 severe, intractable obsessive-compulsive disorder 48
- Such approaches may be emulated using optogenetic stabilization to the anterior limb of the internal capsule, or to regions such as BA32 and Cg24 which show metabolic decrease as OCD remits.
- Chronic pain can be treated using another embodiment of the present invention.
- Electrical stimulation methods include local peripheral nerve stimulation, local cranial nerve stimulation and "sub threshold" motor cortex stimulation.
- Reasonable autogenic approaches include optogenetic stabilization at local painful sites. Attention to promoter selection would ensure that other sensory and motor fibers would be unaffected.
- Selective optogenetic excitation of interneurons at the primary motor cortex also may provide effective pain relief.
- optogenetic stabilization at the sensory thalamus, (particularly medial thalamic nuclei), periventricular grey matter, and ventral raphe nuclei may be used to produce pain relief.
- optogenetic stabilization of parvalbumin-expressing cells targeting as targeting strategy may be used to treat pain by decreasing Substance P production. The release of endogenous opiods may be accomplished by using optogenetic excitation to increase activity in the nucleus accumbens.
- when POMC neurons of the arcuate nucleus of the medial hypothalamus are optogenetically excited, beta endorphin are increased, providing viable treatment approaches for depression and for chronic pain.
- Certain personality disorders including the borderline and antisocial types, demonstrate focal deficits in brain disorders including "hypofrontality.” Direct or indirect optogenetic excitation of these regions is anticipated to produce improvement of symptoms. Abnormal bursts of activity in the amygdala are also known to precipitate sudden, unprompted flights into rage: a symptom of borderline personality disorder, as well as other conditions, which can benefit from optogenetic stabilization of the amygdala. Optogenetic approaches could improve communication and synchronization between different parts of the brain, including amygdala, striatum, and frontal cortex, which could help in reducing impulsiveness and improving insight.
- PTSD post-traumatic-stress disorder
- Optogenetic approaches could improve communication and synchronization between different parts of the brain which could help in reducing misattribution of self-generated stimuli as foreign.
- Optogenetic stabilization of cells within the arcuate nucleus of the medial hypothalamus, which contain peptide products of pro-opiomelanocortin (POMC) and cocaine-and-amphetamine-regulating transcript (CART), can be used to reduce compulsive sexual behavior.
- Optogenetic excitation of cells within the arcuate nucleus of the medial hypothalamus which contain peptide products of pro-opiomelanocortin (POMC) and cocaine-and-amphetamine-regulating transcript (CART) may be used to increase sexual interest in the treatment of cases of disorders of sexual desire.
- testosterone production by the testes and the adrenal glands can be increased through optogenetic excitation of the pituitary gland.
- Optogenetic excitation of the nucleus accumbens can be used for the treatment of anorgasmia.
- the suprachiasmatic nucleus secretes melatonin, which serves to regulate sleep/wake cycles.
- Optogenetic excitation to the suprachiasmic nucleus can be used to increase melatonin production, inducing sleep, and thereby treating insomnia.
- Orexin (hypocretin) neurons strongly excite numerous brain nuclei in order to promote wakefulness.
- Optogenetic excitation of orexin-producing cell populations can be used to treat narcolepsy, and chronic daytime sleepiness.
- Optogenetic stimulation of the supraoptic nucleus may be used to induce secretion of oxytocin, can be used to promote parturition during childbirth, and can be used to treat disorders of social attachment.
- the motor functions that have been de-afferented by a spinal cord injury may be treated with optogenetic excitation to cause contraction, and optogenetic stabilization to cause relaxation.
- This latter relaxation via optogenetic stabilization approach may also be used to prevent muscle wasting, maintain tone, and permit coordinated movement as opposing muscle groups are contracted.
- frank spasticity may be treated via optogenetic stabilization.
- Re-growth of new spinal neuronal tracts may be encouraged via optogenetic excitation, which serves to signal stem cells to sprout axons and dendrites, and to integrate themselves with the network.
- Stroke deficits include personality change, motor deficits, sensory deficits, cognitive loss, and emotional instability.
- One strategy for the treatment of stroke deficits is to provide optogenetic stimulation to brain and body structures that have been deafferented from excitatory connections.
- optogenetic stabilization capabilities can be imparted on brain and body structures that have been deafferented from inhibitory connections.
- Tourette's syndrome is a phasic dysfunction of dopamine transmission in cortical and subcortical regions, the thalamus, basal ganglia and frontal cortex.
- affected areas are preferably first identified using techniques including functional brain imaging and magnetoencephalography (MEG). Whether specifically identified or not, optogenetic stabilization of candidate tracts may be used to suppress motor tics. Post-implantation empirical testing of device parameters reveals which sites of optogenetic stabilization, and which are unnecessary to continue.
- stabilization can be used to the sphincters, for example via optogenetic stabilization of the bladder detrussor smooth muscle or innervations of that muscle. When micturation is necessary, these optogenetic processes are turned off, or alternatively can be reversed, with optogenetic stabilization to the (external) urinary sphincter, and optogenetic excitation of the bladder detrussor muscle or its innervations.
- optogenetic stabilization to the (external) urinary sphincter, and optogenetic excitation of the bladder detrussor muscle or its innervations.
- Optogenetic excitation of the muscle directly can be used to restore tone to the detrussor, prevent kidney damage, and to assist with the micturition process.
- optogenetic stabilization to the bladder muscle can be used to minimize this reactivity of the organ.
- genetic targeting may be used to express various optogenetic proteins or molecules.
- Such targeting involves the targeted expression of the optogenetic proteins/molecules via genetic control elements such as promoters (e.g., Parvalbumin, Somatostatin, Cholecystokinin, GFAP), enhancers/silencers (e.g., Cytomaglovirus Immediate Early Enhancer), and other transcriptional or translational regulatory elements (e.g., Woodchuck Hepatitis Virus Post-transcriptional Regulatory Element).
- promoters e.g., Parvalbumin, Somatostatin, Cholecystokinin, GFAP
- enhancers/silencers e.g., Cytomaglovirus Immediate Early Enhancer
- other transcriptional or translational regulatory elements e.g., Woodchuck Hepatitis Virus Post-transcriptional Regulatory Element.
- promoter+enhancer+regulatory element combination can be used to restrict the expression of optogenetic probes to genetically-defined populations.
- Various embodiments of the present invention may be implemented using spatial/anatomical targeting.
- Such targeting takes advantage of the fact that projection patterns of neurons, virus or other reagents carrying genetic information (DNA plasmids, fragments, etc), can be focally delivered to an area where a given population of neurons project to. The genetic material will then be transported back to the bodies of the neurons to mediate expression of the optogenetic probes.
- viruses or genetic material may be focally delivered to the interested region to mediate localized expression.
- AAV Adeno-Associated Virus
- AAV can be used to deliver a promoter+optogenetic probe cassette to a specific region of interest.
- the choice of promoter will drive expression in a specific population of neurons.
- CaMKIIa promoter will drive excitatory neuron specific expression of optogenetic probes.
- AAV will mediate long-term expression of the optogenetic probe for at least one year or more.
- AAV may be pseudotyped with specific serotypes 1, 2, 3, 4, 5, 6, 7, and 8, with each having different trophism for different cell types. For instance, serotype 2 and 5 is known to have good neuron-specific trophism.
- Retrovirus HIV or other lentivirus-based retroviral vectors may be used to deliver a promoter+optogenetic probe cassette to a specific region of interest. Retroviruses may also be pseudo-typed with the Rabies virus envelope glycoprotein to achieve retrograde transport for labeling cells based on their axonal projection patterns. Retroviruses integrate into the host cell's genome, therefore are capable of mediating permanent expression of the optogenetic probes. Non-lentivirus based retroviral vectors can be used to selectively label dividing cells.
- Gutless Adenovirus and Herpes Simplex Virus (HSV) are two DNA-based viruses that can be used to deliver promoter+optogenetic probe cassette into specific regions of the brain as well. HSV and Adenovirus have much larger packaging capacities and therefore can accommodate much larger promoter elements and can also be used to deliver multiple optogenetic probes or other therapeutic genes along with optogenetic probes.
- Focal Electroporation can also be used to transiently transfect neurons.
- DNA plasmids or fragments can be focally delivered into a specific region of the brain. By applying mild electrical current, surrounding local cells will receive the DNA material and expression of the optogenetic probes.
- lipofection can be used by mixing genetic material with lipid reagents and then subsequently injected into the brain to mediate transfection of the local cells.
- control elements involve the use of various control elements.
- other control elements can be used to mediate temporally-controlled expression of the optogenetic probes.
- a promoter whose transcriptional activity is subject to infrared radiation allows one to use focused radiation to fine tune the expression of optogenetic probes in a focal region at only the desired time.
- Parkinson's Disease can be treated by expressing optogenetic stabilization in the glutamatergic neurons in either the subthalamic nucleus (STN) or the globus pallidus interna (GPi) using an excitatory-specific promoter such as CaMKIIa, and apply optogenetic stabilization. Unlike electrical modulation in which all cell-types are affected, only glutamatergic STN neurons would be suppressed.
- STN subthalamic nucleus
- GPi globus pallidus interna
- the model can define output response of the circuit as a function of input signals.
- the output response can be assessed using a number of different measurable characteristics. For instance, characteristics can include an electrical response of downstream neurons and/or behavioral response of a patient.
- optogenetic probes are expressed at an input position for the model. The optogenetic probes are stimulated and the output characteristics are monitored and compared to an output predicted by the model.
- the use of optogenetic probes allows for fine tuning of models defined using electrical probes. As electrical probes provide only limited ability to direct the stimulus and thus are not well suited for stimulus of certain areas without also directly stimulating nearby areas.
- Optogenetic probes disclosed herein provide a mechanism for more precise selection of the stimulus location.
- the stimulus from the optogenetic probes can be directed to very specific types of circuits/cells, such as afferent fibers.
- the following description provides an example implementation consistent with such an embodiment and is meant to show the feasibility and wide-ranging applicability for aspects of present invention.
- the invention may be used in animal models of DBS, for example in Parkinsonian rats, to identify the target cell types responsible for therapeutic effects (an area of intense debate and immense clinical importance). This knowledge alone may lead to the development of improved pharmacological and surgical strategies for treating human disease.
- LTP long-term potentiation
- LTD long-term depression
- the delivery of the proteins to cells in vivo can be accomplished using a number of different deliver devices, methods and systems.
- an implantable device that delivers a nucleotide sequence for modifying cells in vivo, such as a viral-vector.
- the implantable device can also include a light delivery mechanism.
- the light delivery can be accomplished using, for example, light-emitting diodes (LEDs), fiber optics and/or Lasers.
- VChRl in affecting stem cell fate including survival/death, differentiation and replication.
- the modulation of electrical properties has been shown to control stem cell fate.
- Various techniques can be used to provide stimulus patterns that modify stem cell fate. A specific example is consistent with the techniques explained in Deisseroth, K. et al. "Excitation-neurogenesis coupling in adult neural stem/progenitor cells," Neuron 42, pp. 535-552 (2004), which is fully incorporated herein by reference.
- DChR is used as the primary optically responsive protein in such assessments.
- DChR is used with other types of optically responsive proteins (e.g., VCHR1, GtR3, ChR2 and/or NpHR) that respond to different wavelengths.
- Also provided herein are methods of identifying transsynaptic connection between neuronal cells in an animal or a tissue comprising: a) administering a first viral vector encoding a Cre recombinase fused to a transcellular tracer protein to neuronal cells in region A of the animal or tissue; b) administering a second viral vector encoding a light-activated protein to neuronal cells in region B of the animal or tissue, wherein the expression of the light-activated protein depends on the presence of the Cre recombinase; and c) identifying neuronal cells expressing the light-activated protein in region B, wherein the expression of the light-activated protein in the neuronal cells indicating that these cells are in transsynaptic connection with the cells in region A.
- Also provided herein are methods of generating optical control of targeted neuronal cells in an animal or tissue comprising: a) administering a first viral vector expressing a Cre recombinase fused to a transcellular tracer protein to region A of the animal or tissue; b) administering a second viral vector encoding a light-activated protein to region B of the animal or tissue, wherein the expression of the light-activated protein depends on the presence of the Cre recombinase, and wherein the neuronal cells in region A and in region B are in transsynaptic connected; and c) controlling action potential of a neuronal cell in region B with light that activates the protein.
- Also provided herein are methods of controlling action potential of a neuron in an animal comprising activating a light-activated protein in the neuron with light to generate action potential change, wherein expression of the light-activated protein in the neuron is generated by a) administering a first viral vector expressing a Cre recombinase fused to a transcellular tracer protein to region A of the animal, b) administering a second viral vector encoding a light-activated protein to region B of the animal which contains the neuron, wherein the expression of the light-activated protein depends on the presence of the Cre recombinase, wherein the neurons in region A and region B are in
- the viral vector is a viral vector selected from the group consisting of AAV, HSV, and lentivirus.
- the transcellular tracer protein is wheat germ agglutinin (WGA) or tetanus toxin-fragment C (TTC).
- An “isolated" polynucleotide is one which has been identified and separated and/or recovered from a component of its natural environment.
- references to "about” a value or parameter herein includes (and describes) variations that are directed to that value or parameter per se.
- description referring to “about X” includes description of "X”.
- the term “about” has its normal meaning of approximately. In some embodiments, “about” means ⁇ 10% or ⁇ 5%.
- GTTGG G A ATTA ACGCTG CG AAATCAAAG GCTG C ATCTAG GGTG CTGTTTCCCG CTACTTTCGTCACTG G
- an animal cell including, but not limited to, neural cells, cell lines and muscle cells, the animal cell comprising: an integrated exogenous molecule which expresses a proton pump responsive to blue light, the exogenous molecule derived from Guillardia theta.
- Also provided herein is a method comprising: modifying a light responsive protein derived from Guillardia theta to add an endoplasmic reticulum (ER) export signal at the C-Terminus of the light responsive protein.
- ER endoplasmic reticulum
- Also provided herein is a system for controlling an action potential of a neuron in vivo the system comprising: a delivery device that introduces a protein to the neuron, the protein being responsive to blue light, wherein the produces an inhibitory current a blue light source that generates light for stimulation of the blue light responsive protein; and a control device that controls the generation of light by the light source.
- DChR Also provided herein is a protein consistent with any of the sequences described herein (e.g., sequences shown in Table 1).
- Also provided herein is a system comprising a feedback loop for control of a cell (or cell population) with the cell(s) having multiple light-responsive proteins types expressed therein.
- therapeutic applications including, but not limited to, treatment of Parkinson's disease.
- systems, methods, arrangements, or kits directed toward control of pH levels in cells including, but not limited to, control over pH levels in an organelle, which can be implemented, without limitation, to encourage or inhibit functions thereof or to kill or maim the cell.
- subcellular and transcellular trafficking strategies now permit (1) optical regulation at the far-red/infrared border and extension of optogenetic control across the entire visible spectrum; (2) increased potency of optical inhibition without increased light power requirement (nanoampere-scale chloride- mediated photocurrents that maintain the light sensitivity and reversible, step-like kinetic stability of earlier tools); and (3) generalizable strategies for targeting cells based not only on genetic identity, but also on morphology and tissue topology, to allow versatile targeting when promoters are not known or in genetically intractable organisms.
- Golgi export signal did not significantly affect surface expression, but that addition of the trafficking signal from Kir2.1 either between eNpHR and the EYFP fusion, or at the C terminus of the fusion protein, dramatically reduced intracellular labeling and increased apparent surface membrane expression and also improved labeling of cellular processes.
- high-resolution confocal imaging revealed marked localization in processes, with identifiable labeled membranes spanning intracellular regions apparently devoid of the opsin-EYFP fusion protein, in a pattern never previously observed with NpHR or its derivatives.
- FIG. 25D shows representative traces in the left portion of the figure, and summary plots in the right portion of the figure. The representative traces and summary plots of FIG.
- FIG. 25E shows representative voltage traces, in the left portion of the figure, and summary plots, in the right portion, of eNpHR3.0 (black) and eNpHR2.0 (gray).
- FIG. 30A shows stability and recovery for eNpHR3.0 over a short time scale.
- the representative traces in the left portion of FIG. 30A show photocurrents in cells expressing eNpHR3.0 when exposed to pairs of 10 second long yellow light pulses separated in time by, from the top to bottom of FIG. 30A: 2.5 seconds, 5 seconds, 10 seconds, and 20 seconds.
- PI first pulse peak, 1.00
- SI first pulse steady state, 0.74 ⁇ 0.01
- P2 second pulse peak, 0.86 ⁇ 0.02
- n 11).
- FIG. 30A shows the summary plot for pulses 20 seconds apart displaying approximately 50% peak recovery (P2-S1)/(P1-S1). After 20 seconds, the peak recovers to (45.2 ⁇ 6.6)%.
- FIG. 30C shows the outward current of eNpHR3.0 stability over 10 minutes (light deliver of 593 nm is indicated by the solid bar; output power density: 2.5 mW/mm ).
- a major in vivo opportunity for systems neurobiology is controlling not just a projection from region A to region B, but a cell type itself that has (among its connections) a projection from A to B.
- This fundamentally distinct result requires multiplexing of optical control with other targeting methods.
- Such control would be of great value in systems neurobiology; for example, cortical excitatory pyramidal neurons form a genetically and anatomically defined class of cell, but within this class are cells that each project to multiple different areas of the brain (e.g., thalamus, spinal cord, striatum, and other cortical areas) and therefore have fundamentally distinct roles (Lein et al., 2007; Yoshimura et al., 2005).
- connection topology (FIG. 26B).
- One way to achieve this goal is to capitalize on transcellular trafficking: to introduce into the local cell-body location a Cre-dependent virus conditionally expressing the microbial opsin gene of choice (e.g., Tsai et al., 2009), and rather than additionally employing a Cre-drive mouse line, to instead introduce into a distant target structure (chosen to define the cells of interest by anatomical connectivity) a virus expressing Cre recombinase fused to a transcellular tracer protein, e.g., wheat germ agglutinin (WGA) (FIG.
- WGA wheat germ agglutinin
- Cre recombinase in the fusion protein would be transported by presumed endosomal trafficking mechanisms along with the tracer to the local cell-body location if anatomically connected and activate opsin expression in the subset of local cells defined by this connectivity (FIG. 26B) (Gradinaru et al, 2007, 2009; Petreanu et al., 2007, 2009).
- FIG. 26C shows the construct design for the WGA-Cre and Cre dependent AAV vectors, wherein the WGA and Cre genes are both optimized with mammalian codons.
- Cre can be trans-synaptically delivered from transduced cells to activate distant gene expression only in synaptically connected neurons that have received the Cre-dependent virus, and not in others.
- the expected EYFP-eNpHR3.0 axon terminals arising from Ml were present in SI.
- EYFP-expressing circuit elements in the ipsilateral dentate affording precise opportunities for optical control, were axonal fibers observed to terminate in the molecular layer of the granule cell layer, precisely as expected for fibers arising from the contralateral dentate hilus.
- NpHR its spectral compatibility with ChR2: the two opsins have largely separable action spectra and operate with similar light power density requirements, allowing bidirectional control of optical activity (Zhang et al., 2007a) in vitro or in vivo despite a small region of spectral overlap.
- eNpHR3.0 had become too potent, given the spectral overlap, to use in combination with ChR2 in the same cell, we created a bicistronic vector containing eNpHR3.0; analogous 2A-based combination vectors (Ryan and Drew.
- FIG. 27F shows the activation spectrums for eNPAC, the left portion of FIG. 27F, and for ChR2 (H124R) and eNpHR3.0, on the right portion of FIG. 27F.
- the activation spectrum of ChR2 is shown in dark gray
- the activation spectrum of eNpHR3.0 is shown in light gray.
- Maximal eNPAC steady-state excitatory and inhibitory currents were both approximately 60% of that observed when each opsin was expressed individually, yielding maximal photocurrents of >550 pA in each direction (FIGs.
- Output power density for peak current values was 3.5-5 mW/mm 2 (3.5 mW/mm 2 at 590 nm).
- Validation in vivo will require demonstration that the specific P2A method (or other linker approach) is functional in a particular circuit or cell type (yet to be determined); however, these data in cultured hippocampal neurons demonstrate that potent bidirectional photocurrents of >500 pA each can be achieved within a single cell, without incapacitating interference of the trafficking-enhanced opsin.
- BR bacteriorhodopsin
- halorhodopsin is expressed at high levels, and no photocurrents were observed.
- eBR could typically deliver -50 pA of outward photocurrent and ⁇ 10 mV hyperpolarizations that sufficed to block spiking in hippocampal pyramidal neurons when exposed to the optimal wavelength light of 560 run, thereby providing another channel for optogenetic control and illustrating the potential generalizeability of the microbial opsin membrane trafficking approach.
- the membrane input resistance was similar for all neurons patched (131.6 ⁇ 19.5 mQ).
- the light power density at sample was 7 mW/mm 2 .
- GtR3 theta rhodopsin-3
- GtR3 optimized the codon bias of GtR3 for mammalian expression, and delivered the GtR3-EYFP fusion gene to hippocampal pyramidal neurons.
- GtR3 showed intracellular accumulations and no photocurrents. Provision of the TS signal between GtR3 and EYFP only mildly reduced accumulations, but, together with addition of the ER export signal FCYENEV to the C terminus, accumulations were abolished and increased surface and process localization observed.
- the resulting modified GtR3 hyperpolarizes hippocampal neurons in response to 472 nm blue light, albeit with smaller currents than eBR, and could inhibit spiking as well.
- Sample current clamp and voltage clamp traces and summary data show GtR3 function under 472 nm light (18.5 mW/mm ) are shown in the left and right portions, respectively, of FIG. 31C.
- a light induced outward photocurrent summary is shown in the left bar graph of FIG. 31 C, and the corresponding
- hyperpolarization summary for a blue light peak is shown in the right bar graph.
- FIG. 29A shows general subcellular targeting strategies for adapting microbial opsin genes to metazoan intact-systems biology.
- FIG. 29B shows refinement of targeting at the tissue and subcellular levels (subcellular opsin targeting methods have been previously described, see Gradinaru et al. [2007] and Lewis et al., [2009]; tissue/transcellular opsin targeting methods are described herein).
- Optogenetic approaches previously have found substantial utility in the control of biological processes and behavior in freely moving mammals (Adamantidis et al., 2007; Airan et al., 2009; Gradinaru et al., 2009; Petreanu et al., 2007, 2009; Sohal et al., 2009; Tsai et al., 2009) and other animals (Douglass et al., 2008; Hwang et al., 2007; Lerchner et al., 2007; Zhang et al., 2007a), with the high temporal precision that is important for intact-systems biology.
- engineering specific membrane-trafficking capabilities for microbial proteins is an important step in generating diverse optogenetic technologies for intact-systems biology.
- nanoampere- scale mean outward currents readily resulted with only 3.5 mW/mm yellow light (10-fold less light power than required for approaching similar currents with previously described proton pumps).
- eNpHR3.0 preserved the step-like kinetics, fast recovery, and resistance to inactivation over long timescales of NpHR (Zhang et al., 2007a).
- eNpHR3.0 is particularly well suited for in vivo applications, as the most red- shifted and potent optogenetic inhibitor to date, but further strategies to enhance potency of this and other tools will no doubt emerge, and membrane trafficking work as described here may enable even more potent inhibitors in the future.
- inhibition can be readily dialed down if needed by using weaker promoters, shorter expression times, or reduced light levels, while maintaining access to new wavelengths -100 nm red-shifted from previous reports (680 nm versus 589 nm) to enable operating at the infrared border with deeper-penetrating and safer photons.
- DBS deep brain stimulation
- STN subthalamic nucleus
- the cell-process targeting enabled by membrane trafficking modification allows for control of cells that are defined topologically—that is, by the essential character of their connections within tissue. At present, it is not guaranteed that transport is synaptic or monosynaptic (as in the hippocampal circuit experiments, such properties will need to be validated in each system); therefore, the term "topological targeting” rather than synaptic targeting is here used to underscore the deformation independence of the fundamental character of the connection— an axonal connection can take any path from A to B, and as long as the connection is present, the topological targeting strategy remains valid. This property is important in genetically less-tractable organisms, but also of substantial value even in animals such as mice, where genetic targeting tools are in many cases inadequate.
- genetic targeting strategies may be multiplexed with topological targeting; for example, expression from the Cre-dependent vector and the Cre-fusion vector may each be governed by specific genetic targeting sequences if available. Moreover, the availability of multiple channels of optical control opens the door to combinatorial topological targeting strategies.
- a photoactivatable adenylyl cyclase has been studied from Euglena, although with high dark activity that limits in vivo application (Schroder-Lang et al., 2007), and subsequent work on light-sensitive PAS or LOV domains (Levskaya et al., 2009; Wu et al., 2009) may open up new ways to control protein-protein association if these approaches can be made to operate in living animals.
- NpHR variants were produced by PCR amplification of the NpHR-EYFP construct previously published (Zhang et aL, 2007b). All opsins described here have been optimized for mammalian expression by changing each gene's codon usage to conform to human codon usage distribution. Updated maps and vectors are available and freely distributed from the Deisseroth laboratory (affiliated with Stanford University, Stanford, California) and described at 2010 Scientific American, "Method of the Year," December 2010 (http://www.optogenetics.org ). the contents of which are hereby incorporated by reference in their entirety.
- Hippocampal cultures grown on coverslips were transfected or transduced at 4 days in vitro (DIV) with titer-matched viruses for all constructs (final dilution 10 4 infectious units (i.u.)/ml in neuronal growth medium).
- DIV vitro
- Whole-cell patch clamp recordings were performed as previously described (Zhang et al., 2007b).
- Primary hippocampal cultures were infected at 4 DIV with titer-matched virus (final dilution 104 i.u./ml in neuronal growth medium).
- DIV cultures were fixed for 30 min with ice-cold 4% paraformaldehyde and then permeabilized for 30 min with 0.4% saponin in 2%normal donkey serum (NDS).
- mice or rats were sacrificed 4 to 5 weeks after viral injection. Rodents were perfused with 20 ml ice-cold PBS, followed by 20 ml 4% paraformaldehyde. The brains were then fixed overnight in 4% paraformaldehyde and transferred to 30% sucrose solution for 2 days. Brains were frozen and coronal slices (40 ⁇ ) were prepared with a Leica SM2000R cryostat and preserved in 4°C in
- cryoprotectant (25% glycerol and 30% ethylene glycol in PBS).
- Slices (DAPI stain 1:50,000) were mounted with PVA-DABCO on microscope slides, and single confocal optical sections (e.g., through dorsal CA1 region, -1-2.5mm posterior to bregma or the dorsal subiculum, 2.7-3 mm posterior to bregma) were acquired using a lOx air and 40x/1.4 NA oil objectives on a Leica confocal microscope.
- confocal optical sections e.g., through dorsal CA1 region, -1-2.5mm posterior to bregma or the dorsal subiculum, 2.7-3 mm posterior to bregma
- GenBank accession code for the original AR, BR, and GtR3 sequences are DQ074124, Ml 1720, and EG722553.
- NpHR variants were produced by PCR amplification of the NpHR-EYFP construct previously published (Zhang et al., 2007b) and cloned in-frame into the Agel and EcoRI restriction sites of a lentivirus carrying the CaMKIIa or Synapsin-1 promoters according to standard molecular biology protocols. A similar strategy was used for BR and AR. GtR3 was identified through genomic searches.
- GenBank accession codes for the original AR, BR, and GtR3 sequences are DQ074124, Ml 1720, and EG722553.
- pAAV-EFla- mCherry-IRES-WGA-Cre vector was constructed using standard molecular biology protocols. Codons for the WGA and Cre genes were optimized for expression in mammalian cells.
- the genes were synthesized by DNA2.0 (Menlo Park, CA). Cre was fused in-frame to the C-term of WGA, which in turn was fused to IRES.
- the mCherry- IRES-WGA-Cre bicistronic expression cassette was designed using the EMCV IRES sequence.
- the pAAV-EFla plasmid backbone is the same as described previously (Sohal et al., 2009; Tsai et al., 2009).
- pAAV-hSyn-eNpHR3.0-EFYP-P2A-ChR2H134R- mCherry was constructed with a 120-mer primer
- ChR2(H134R)-mCherry fragment was amplified using the 120-mer as the forward primer and 5'-atatcgaattctcattacttgtacagctcgt- 3' as the reverse primer.
- this amplified product was used as a reverse primer along with the forward primer 5'-ccggatccccgggtaccggtaggccaccatgacagagaccctgcct- 3' to fuse eNpHR 3.0- EYFP to ChR2 (H134R)-mCherry with the p2A region interposed.
- the 3.4 Kb fragment was then purified and cloned into the BamHI and EcoRI sites of the pAAV-hSyn vector. All constructs were fully sequenced for accuracy of cloning; updated maps are available online at http://www.optogenetics.org. the contents of which are hereby incorporated by reference in their entirety.
- Lenti viruses for cultured neuron infection and for in vivo injection were produced as previously described (Zhang et al., 2007b). Viral titering was performed in HEK293 cells that were grown in 24- well plates and inoculated with 5 -fold serial dilutions in the presence of polybrene (8 ⁇ g/ml). After 4 days, cultures were resuspended in PBS and sorted for EYFP fluorescence on a FACScan flow cytometer (collecting 20,000 events per sample) followed by analysis using Flow Jo software (Ashland, OR).
- the titer of viruses for culture infection was 10 5 i.u./ml.
- the titer of concentrated virus for in vivo injection was 10 10 i.u./ml.
- CA1 and CA3 regions were isolated, digested with 0.4 mg/mL papain (Worthington, Lakewood, NJ), and plated onto glass coverslips precoated with 1 :30 Matrigel (Beckton Dickinson Labware, Bedford, MA) at a density of 65,000/cm .
- DNA/CaC CI 2 mix for each well: 1.5-3 ⁇ g DNA (QIAGEN endotoxin-free preparation) + 1.875 ⁇ 2M CaC CI 2 (final Ca 2+ concentration 250 mM) in 15 ⁇ total H 2 0.
- DNA/CaCI 2 was added 15 ⁇ of 2X HEPES-buffered saline (pH 7.05), and the final volume was mixed well by pipetting. After 20 min at RT, the 30 ⁇ DNA CaCI2 2 /HBS mixture was dropped into each well (from which the growth medium had been temporarily removed and replaced with 400 ⁇ warm MEM) and transfection allowed to proceed at 37C for 45-60 min. Each well was then washed with 3 X lmL warm MEM and the growth medium replaced. Opsin expression was generally observed within 20- 24 hr.
- Hippocampal cultures grown on coverslips were transduced at 4 div with titer- matched viruses for all constructs (final dilution 10 4 i.u./ml in neuronal growth medium) and allowed to express for one week.
- Whole-cell patch clamp recordings were performed as previously described (intracellular solution: 129 mM K-gluconate, 10 mM HEPES, 10 mM KCI, 4 mM MgATP, 0.3 mM Na 3 GTP, titrated to pH 7.2; extracellular Tyrode: 125 mM NaCl, 2 mM KCl, 3 mM CaC12, 1 mM MgCl 2 , 30 mM glucose, and 25 mM HEPES, titrated to pH 7.3).
- light (7 mW/ mm2) for 660nm inhibition was delivered using a light emitting diode and a 40x/.8 NA water objective.
- Light (7mW/mm 2 ) for 680nm inhibition was delivered using the X-Cite 120W halogen light source through a 680 ⁇ 13nm filter and a 40x/0.8 NA water objective.
- Light delivery for eNPAC, ChR2(H134R), and eNpHR3.0 power spectra was delivered from a 300W DG-4 lamp fitted with a Lambda 10-3 filter wheel (Sutter Instruments) with a 10-position wheel for 25-mm filters of different wavelengths and a 40X/0.8NA water objective.
- Filters (given here as wavelength in nm / bandwidth in nm / output power in mW/mm 2 ) were: 387 / 10 / 3.5; 406 / 15 / 3.5; 427 / 10 / 4.0; 445 / 20 / 4.0; 470 / 22 / 4.0; 494 / 20 / 4.5; 520 / 15 / 4.5; 542 / 27 / 5.0; 560 / 20 / 5.0; 590 / 20 / 3.5; 630 / 20 / 3.5.
- confocal images and whole-cell patch clamp data are from cultured hippocampal neurons either transfected (confocal data) or transduced (patch data) with lentiviral NpHR, BR, GtR3 and AR-based constructs, and allowed to express for one week. Expression was driven by the human Synapsin I promoter and visualized by fusion to EYFP. Table 5 shows additional trafficking-enhanced tools for blue inhibition, and opsin sequence: G. theta rhodopsin-3 or GtR3.
- New opsin sequence G. theta rhodopsin-3 or GtR3.
- the EST sequence included all seven transmembrane helices; the 5' amino acid sequence was provided from ChR2 (transmembrane motifs: bars; conserved residues: highlighted; truncation site for peptide: *; signal peptide provided from ChR2: gray.
- Cy3 -conjugated secondary antibodies (Jackson Laboratories, West Grove, PA) were applied in 2% NDS for 1 hr at room temperature. Images were obtained on a Leica confocal microscope using a 63X/1.4NA oil objective.
- the head was placed in a stereotactic apparatus (Kopf Instruments, Tujunga, CA; Olympus stereomicroscope). Ophthalmic ointment was applied to prevent eye drying. A midline scalp incision was made and a small craniotomy was performed using a drill mounted on the stereotactic apparatus
- the virus was delivered using a 10 ⁇ syringe and a thin 34 gauge metal needle; the injection volume and flow rate (1 ⁇ at 0.1 CI 2 l/min) was controlled with an injection pump from World Precision Instruments (Sarasota, FL). After injection the needle was left in place for 5 additional minutes and then slowly withdrawn. The skin was glued back with Vetbond tissue adhesive. The animal was kept on a heating pad until it recovered from anesthesia. Buprenorphine (0.03 mg/kg) was given subcutaneously following the surgical procedure to minimize discomfort.
- AAVs adeno-associated viruses
- Ml injection I AP, +1 mm from bregma; lateral, 1.5 mm; ventral, 2 mm; Ml injection II: AP, +2 mm; lateral, 1.5 mm; ventral, 2 mm; SI injection I: AP, -0.3 mm; lateral, 3.4 mm; ventral, 2 mm; SI injection II: AP, -1.3 mm; lateral, 3 mm; ventral, 2 mm; SI injection III: AP, -2.12 mm; lateral, 3 mm; ventral, 2 mm.
- Optrode recordings were conducted in rodents anesthetized with 1.5% isoflurane and the optrode was placed through small craniotomies created above target regions.
- pClamp 10 and a Digidata 1322 A board were used to both collect data and generate light pulses through the fiber.
- the recorded signal was band pass filtered at 300Hz low/5 kHz high (1800
- Microelectrode AC Amplifier For precise placement of the fiber/electrode pair, stereotactic instrumentation was used.
- mice or rats were sacrificed 4 to 5 weeks after viral injection. Rodents were perfused with 20ml of ice-cold PBS, followed by 20 ml of 4% paraformaldehyde. The brains were then fixed overnight in4% paraformaldehyde, and transferred to 30% sucrose solution for 2 days. Brains were frozen and coronal slices (40 ⁇ ) were prepared using a Leica SM2000R cryostat, and preserved in 4°C in cryoprotectant (25% glycerol, 30% ethylene glycol, in PBS). Slices (DAPI stain
- Kalaidzidis I.V.
- Kalaidzidis Y.L.
- Kaulen A.D. (1998). Flash-induced voltage changes in halorhodopsin from Natronobacterium pharaonis. FEBS Lett. 427, 59-63.
- Bacteriorhodopsin a light-driven proton pump in Halobacterium Halobium. Biophys. J. 15, 955-962.
- Appendices may be implemented in connection with one or more of the above-described embodiments and implementations, as well as with those shown in the figures and described below. Reference may be made to the Appendices (A, B and C) which were filed in the underlying provisional application and incorporated herein by reference.
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Environmental Sciences (AREA)
- Biomedical Technology (AREA)
- Animal Behavior & Ethology (AREA)
- Zoology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Biotechnology (AREA)
- Molecular Biology (AREA)
- Medicinal Chemistry (AREA)
- Veterinary Medicine (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Animal Husbandry (AREA)
- Biodiversity & Conservation Biology (AREA)
- Public Health (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Wood Science & Technology (AREA)
- General Engineering & Computer Science (AREA)
- Gastroenterology & Hepatology (AREA)
- Cell Biology (AREA)
- Neurology (AREA)
- Neurosurgery (AREA)
- Radiology & Medical Imaging (AREA)
- Pathology (AREA)
- Physics & Mathematics (AREA)
- Virology (AREA)
- Plant Pathology (AREA)
- Microbiology (AREA)
- Pharmacology & Pharmacy (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Psychology (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Priority Applications (15)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201180014303.3A CN102844427B (zh) | 2010-03-17 | 2011-03-17 | 光敏离子透过性分子 |
| EP11757027.5A EP2547762B1 (en) | 2010-03-17 | 2011-03-17 | Light-sensitive ion-passing molecules |
| AU2011227131A AU2011227131B2 (en) | 2010-03-17 | 2011-03-17 | Light-sensitive ion-passing molecules |
| ES11757027.5T ES2676274T3 (es) | 2010-03-17 | 2011-03-17 | Moléculas sensibles a la luz que permiten el paso de iones |
| CA2791094A CA2791094A1 (en) | 2010-03-17 | 2011-03-17 | Light-sensitive ion-passing molecules |
| EP18163332.2A EP3399024A1 (en) | 2010-03-17 | 2011-03-17 | Light-sensitive ion-passing molecules |
| JP2013500217A JP5866332B2 (ja) | 2010-03-17 | 2011-03-17 | 感光性イオンを通過させる分子 |
| US13/577,565 US9079940B2 (en) | 2010-03-17 | 2011-03-17 | Light-sensitive ion-passing molecules |
| SG2012065488A SG183899A1 (en) | 2010-03-17 | 2011-03-17 | Light-sensitive ion-passing molecules |
| IL221410A IL221410A0 (en) | 2010-03-17 | 2012-08-12 | Light-sensitive ion-passing molecules |
| US13/622,809 US9249234B2 (en) | 2010-03-17 | 2012-09-19 | Light-sensitive ion-passing molecules |
| US13/623,612 US9359449B2 (en) | 2010-03-17 | 2012-09-20 | Light-sensitive ion-passing molecules |
| US15/153,299 US9604073B2 (en) | 2010-03-17 | 2016-05-12 | Light-sensitive ion-passing molecules |
| US15/447,019 US20170198017A1 (en) | 2010-03-17 | 2017-03-01 | Light-sensitive ion-passing molecules |
| IL261389A IL261389A (en) | 2010-03-17 | 2018-08-27 | Ion-transporting and light-sensitive molecules |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US31496910P | 2010-03-17 | 2010-03-17 | |
| US61/314,969 | 2010-03-17 |
Related Child Applications (3)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US13/577,565 A-371-Of-International US9079940B2 (en) | 2010-03-17 | 2011-03-17 | Light-sensitive ion-passing molecules |
| US13/622,809 Continuation US9249234B2 (en) | 2010-03-17 | 2012-09-19 | Light-sensitive ion-passing molecules |
| US13/623,612 Continuation US9359449B2 (en) | 2010-03-17 | 2012-09-20 | Light-sensitive ion-passing molecules |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2011116238A2 true WO2011116238A2 (en) | 2011-09-22 |
| WO2011116238A3 WO2011116238A3 (en) | 2011-11-10 |
Family
ID=44649837
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2011/028893 Ceased WO2011116238A2 (en) | 2010-03-17 | 2011-03-17 | Light-sensitive ion-passing molecules |
Country Status (11)
| Country | Link |
|---|---|
| US (5) | US9079940B2 (enExample) |
| EP (2) | EP2547762B1 (enExample) |
| JP (2) | JP5866332B2 (enExample) |
| CN (2) | CN102844427B (enExample) |
| AU (1) | AU2011227131B2 (enExample) |
| CA (1) | CA2791094A1 (enExample) |
| ES (1) | ES2676274T3 (enExample) |
| IL (2) | IL221410A0 (enExample) |
| MY (1) | MY175954A (enExample) |
| SG (2) | SG10201505162QA (enExample) |
| WO (1) | WO2011116238A2 (enExample) |
Cited By (40)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2013126521A1 (en) * | 2012-02-21 | 2013-08-29 | The Board Of Trustees Of The Leland Stanford Junior University | Compositions and methods for treating neurogenic disorders of the pelvic floor |
| WO2013090356A3 (en) * | 2011-12-16 | 2013-10-03 | The Board Of Trustees Of The Leland Stanford Junior University | Opsin polypeptides and methods of use thereof |
| JP2013545458A (ja) * | 2010-11-05 | 2013-12-26 | ザ ボード オブ トラスティーズ オブ ザ レランド スタンフォード ジュニア ユニバーシティー | 報酬関連行動の光遺伝学的制御 |
| WO2014100283A1 (en) * | 2012-12-19 | 2014-06-26 | University Of Southern California | Photoactivated molecules for light-induced modulation of the activity of electrically excitable cells and methods of using same |
| US8834546B2 (en) | 2010-11-22 | 2014-09-16 | The Board Of Trustees Of The Leland Stanford Junior University | Optogenetic magnetic resonance imaging |
| US8864805B2 (en) | 2007-01-10 | 2014-10-21 | The Board Of Trustees Of The Leland Stanford Junior University | System for optical stimulation of target cells |
| US8906360B2 (en) | 2005-07-22 | 2014-12-09 | The Board Of Trustees Of The Leland Stanford Junior University | Light-activated cation channel and uses thereof |
| US8926959B2 (en) | 2005-07-22 | 2015-01-06 | The Board Of Trustees Of The Leland Stanford Junior University | System for optical stimulation of target cells |
| US8932562B2 (en) | 2010-11-05 | 2015-01-13 | The Board Of Trustees Of The Leland Stanford Junior University | Optically controlled CNS dysfunction |
| US8956363B2 (en) | 2008-06-17 | 2015-02-17 | The Board Of Trustees Of The Leland Stanford Junior University | Methods, systems and devices for optical stimulation of target cells using an optical transmission element |
| US8962589B2 (en) | 2008-05-29 | 2015-02-24 | The Board Of Trustees Of The Leland Stanford Junior University | Cell line, system and method for optical control of secondary messengers |
| US9079940B2 (en) | 2010-03-17 | 2015-07-14 | The Board Of Trustees Of The Leland Stanford Junior University | Light-sensitive ion-passing molecules |
| US9101759B2 (en) | 2008-07-08 | 2015-08-11 | The Board Of Trustees Of The Leland Stanford Junior University | Materials and approaches for optical stimulation of the peripheral nervous system |
| US20150283398A1 (en) * | 2014-03-27 | 2015-10-08 | Circuit Therapeutics, Inc. | System and method for therapeutic management of cough |
| US9238150B2 (en) | 2005-07-22 | 2016-01-19 | The Board Of Trustees Of The Leland Stanford Junior University | Optical tissue interface method and apparatus for stimulating cells |
| US9274099B2 (en) | 2005-07-22 | 2016-03-01 | The Board Of Trustees Of The Leland Stanford Junior University | Screening test drugs to identify their effects on cell membrane voltage-gated ion channel |
| US9284353B2 (en) | 2007-03-01 | 2016-03-15 | The Board Of Trustees Of The Leland Stanford Junior University | Mammalian codon optimized nucleotide sequence that encodes a variant opsin polypeptide derived from Natromonas pharaonis (NpHR) |
| US9309296B2 (en) | 2008-11-14 | 2016-04-12 | The Board Of Trustees Of The Leland Stanford Junior University | Optically-based stimulation of target cells and modifications thereto |
| EP2635341A4 (en) * | 2010-11-05 | 2016-05-25 | Univ Leland Stanford Junior | UPGRADING LIGHT FOR USE IN OPTOGENETIC PROCESSES |
| US9506073B2 (en) | 2011-11-18 | 2016-11-29 | Board Of Regents, The University Of Texas System | Blue-light inducible system for gene expression |
| EP2950715A4 (en) * | 2013-01-31 | 2016-11-30 | Univ California | SYSTEM AND METHOD FOR MODELING BRAIN DYNAMICS IN NORMAL AND ILLNESS STATES |
| US9636380B2 (en) | 2013-03-15 | 2017-05-02 | The Board Of Trustees Of The Leland Stanford Junior University | Optogenetic control of inputs to the ventral tegmental area |
| US9693692B2 (en) | 2007-02-14 | 2017-07-04 | The Board Of Trustees Of The Leland Stanford Junior University | System, method and applications involving identification of biological circuits such as neurological characteristics |
| US9700736B2 (en) | 2011-07-25 | 2017-07-11 | Neuronexus Technologies, Inc. | Neuromodulation transfection system with active fluid delivery |
| US9850290B2 (en) | 2010-11-05 | 2017-12-26 | The Board Of Trustees Of The Leland Stanford Junior University | Light-activated chimeric opsins and methods of using the same |
| US9878176B2 (en) | 2008-04-23 | 2018-01-30 | The Board Of Trustees Of The Leland Stanford Junior University | System utilizing Volvox carteri light-activated ion channel protein (VChR1) for optical stimulation of target cells |
| US10035027B2 (en) | 2007-10-31 | 2018-07-31 | The Board Of Trustees Of The Leland Stanford Junior University | Device and method for ultrasonic neuromodulation via stereotactic frame based technique |
| US10052497B2 (en) | 2005-07-22 | 2018-08-21 | The Board Of Trustees Of The Leland Stanford Junior University | System for optical stimulation of target cells |
| US10086012B2 (en) | 2010-11-05 | 2018-10-02 | The Board Of Trustees Of The Leland Stanford Junior University | Control and characterization of memory function |
| US10220092B2 (en) | 2013-04-29 | 2019-03-05 | The Board Of Trustees Of The Leland Stanford Junior University | Devices, systems and methods for optogenetic modulation of action potentials in target cells |
| US10232043B2 (en) | 2015-08-19 | 2019-03-19 | California Institute Of Technology | Photoactivated molecules for light-induced modulation of the activity of electrically excitable cells and methods of using the same |
| US10307609B2 (en) | 2013-08-14 | 2019-06-04 | The Board Of Trustees Of The Leland Stanford Junior University | Compositions and methods for controlling pain |
| US10426970B2 (en) | 2007-10-31 | 2019-10-01 | The Board Of Trustees Of The Leland Stanford Junior University | Implantable optical stimulators |
| US10568516B2 (en) | 2015-06-22 | 2020-02-25 | The Board Of Trustees Of The Leland Stanford Junior University | Methods and devices for imaging and/or optogenetic control of light-responsive neurons |
| US10711242B2 (en) | 2008-06-17 | 2020-07-14 | The Board Of Trustees Of The Leland Stanford Junior University | Apparatus and methods for controlling cellular development |
| US10974064B2 (en) | 2013-03-15 | 2021-04-13 | The Board Of Trustees Of The Leland Stanford Junior University | Optogenetic control of behavioral state |
| US11294165B2 (en) | 2017-03-30 | 2022-04-05 | The Board Of Trustees Of The Leland Stanford Junior University | Modular, electro-optical device for increasing the imaging field of view using time-sequential capture |
| US11653851B2 (en) | 2015-12-09 | 2023-05-23 | The Board Of Trustees Of The Leland Stanford Junior University | Methods for functional brain circuit analysis |
| US11684284B2 (en) | 2015-07-21 | 2023-06-27 | The Board Of Trustees Of The Leland Stanford Junior University | Carbon fiber optrodes for magnetic resonance imaging compatible optogenetics |
| US11921271B2 (en) | 2020-05-22 | 2024-03-05 | The Board Of Trustees Of The Leland Stanford Junior Univeristy | Multifocal macroscope for large field of view imaging of dynamic specimens |
Families Citing this family (70)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20130184636A1 (en) * | 2012-01-13 | 2013-07-18 | Graham Creasey | System and Method for Controlling Neural and Muscular Function |
| US20140323924A1 (en) * | 2013-04-26 | 2014-10-30 | David J. Mishelevich | Targeted optogenetic neuromodulation for treatment of clinical conditions |
| US9405975B2 (en) | 2010-03-26 | 2016-08-02 | Brain Corporation | Apparatus and methods for pulse-code invariant object recognition |
| US9015093B1 (en) | 2010-10-26 | 2015-04-21 | Michael Lamport Commons | Intelligent control with hierarchical stacked neural networks |
| US8775341B1 (en) | 2010-10-26 | 2014-07-08 | Michael Lamport Commons | Intelligent control with hierarchical stacked neural networks |
| CN103491770B (zh) | 2010-11-05 | 2016-06-08 | 斯坦福大学托管董事会 | 稳定阶跃函数视蛋白及其使用方法 |
| US9566710B2 (en) | 2011-06-02 | 2017-02-14 | Brain Corporation | Apparatus and methods for operating robotic devices using selective state space training |
| US10478639B2 (en) | 2011-09-09 | 2019-11-19 | The Regents Of The University Of California | In vivo visualization and control of patholigical changes in neural circuits |
| US20130317573A1 (en) * | 2012-05-25 | 2013-11-28 | Boston Scientific Neuromodulation Corporation | Combination electrical stimulation and low-level laser therapy |
| US9412041B1 (en) | 2012-06-29 | 2016-08-09 | Brain Corporation | Retinal apparatus and methods |
| JP6580487B2 (ja) | 2012-11-21 | 2019-09-25 | サーキット セラピューティクス, インコーポレイテッド | 光遺伝学的治療のためのシステムおよび方法 |
| US9764468B2 (en) | 2013-03-15 | 2017-09-19 | Brain Corporation | Adaptive predictor apparatus and methods |
| US9242372B2 (en) | 2013-05-31 | 2016-01-26 | Brain Corporation | Adaptive robotic interface apparatus and methods |
| US9384443B2 (en) | 2013-06-14 | 2016-07-05 | Brain Corporation | Robotic training apparatus and methods |
| US9314924B1 (en) | 2013-06-14 | 2016-04-19 | Brain Corporation | Predictive robotic controller apparatus and methods |
| US9792546B2 (en) | 2013-06-14 | 2017-10-17 | Brain Corporation | Hierarchical robotic controller apparatus and methods |
| US9436909B2 (en) | 2013-06-19 | 2016-09-06 | Brain Corporation | Increased dynamic range artificial neuron network apparatus and methods |
| US9552546B1 (en) | 2013-07-30 | 2017-01-24 | Brain Corporation | Apparatus and methods for efficacy balancing in a spiking neuron network |
| EP3903876B1 (en) | 2013-09-16 | 2024-10-23 | The Board of Trustees of the Leland Stanford Junior University | Multi-element coupler for generation of electromagnetic energy |
| US9296101B2 (en) | 2013-09-27 | 2016-03-29 | Brain Corporation | Robotic control arbitration apparatus and methods |
| US9579789B2 (en) | 2013-09-27 | 2017-02-28 | Brain Corporation | Apparatus and methods for training of robotic control arbitration |
| US9463571B2 (en) | 2013-11-01 | 2016-10-11 | Brian Corporation | Apparatus and methods for online training of robots |
| US9597797B2 (en) | 2013-11-01 | 2017-03-21 | Brain Corporation | Apparatus and methods for haptic training of robots |
| US9248569B2 (en) | 2013-11-22 | 2016-02-02 | Brain Corporation | Discrepancy detection apparatus and methods for machine learning |
| US9358685B2 (en) | 2014-02-03 | 2016-06-07 | Brain Corporation | Apparatus and methods for control of robot actions based on corrective user inputs |
| EP3122761B1 (en) | 2014-03-28 | 2019-03-06 | The Board of Trustees of The Leland Stanford Junior University | Engineered light-activated anion channel proteins and methods of use thereof |
| US9346167B2 (en) | 2014-04-29 | 2016-05-24 | Brain Corporation | Trainable convolutional network apparatus and methods for operating a robotic vehicle |
| JP6425161B2 (ja) * | 2014-04-30 | 2018-11-21 | 国立大学法人名古屋大学 | 投射経路選択的な遺伝子発現制御 |
| US20160336813A1 (en) | 2015-05-15 | 2016-11-17 | NeuSpera Medical Inc. | Midfield coupler |
| JP6524339B2 (ja) | 2014-05-18 | 2019-06-05 | ニュースペラ メディカル インク | ミッドフィールドカプラ |
| US20150360049A1 (en) * | 2014-06-11 | 2015-12-17 | Circuit Therapeutics, Inc. | Optogenetic therapies for movement disorders |
| WO2016019075A1 (en) * | 2014-07-29 | 2016-02-04 | Circuit Therapeutics, Inc. | System and method for optogenetic therapy |
| US9630318B2 (en) | 2014-10-02 | 2017-04-25 | Brain Corporation | Feature detection apparatus and methods for training of robotic navigation |
| US9881349B1 (en) | 2014-10-24 | 2018-01-30 | Gopro, Inc. | Apparatus and methods for computerized object identification |
| US10377818B2 (en) | 2015-01-30 | 2019-08-13 | The Board Of Trustees Of The Leland Stanford Junior University | Method of treating glioma |
| US9717387B1 (en) | 2015-02-26 | 2017-08-01 | Brain Corporation | Apparatus and methods for programming and training of robotic household appliances |
| US10974065B2 (en) * | 2015-04-01 | 2021-04-13 | Arizona Board of Regents of behalf of Arizona State University | System and method for modulating optogenetic vagus nerve in a noninvasive, transcutaneous manner |
| WO2017136346A1 (en) | 2016-02-05 | 2017-08-10 | Boston Scientfic Neuromodulation Corporation | Implantable optical stimulation lead |
| US11278633B2 (en) | 2016-07-21 | 2022-03-22 | Massachusetts Institute Of Technology | Dummy-fluorescent protein fusions and methods of use |
| JP7071332B2 (ja) | 2016-07-29 | 2022-05-18 | ザ リージェンツ オブ ザ ユニバーシティ オブ カリフォルニア | 変異カプシドを有するアデノ随伴ウイルスビリオン及びその使用方法 |
| CN117695375A (zh) | 2016-09-02 | 2024-03-15 | 学校法人庆应义塾 | 视觉功能再生剂或视觉功能降低预防剂 |
| US10625072B2 (en) | 2016-10-21 | 2020-04-21 | Boston Scientific Neuromodulation Corporation | Electrical stimulation methods with optical observation and devices therefor |
| CN106861050A (zh) * | 2017-02-28 | 2017-06-20 | 武汉大学 | 一种基于光遗传学的无线神经调控装置 |
| TWI640308B (zh) * | 2017-03-29 | 2018-11-11 | 林伯剛 | Device for stimulating optic nerve fibers |
| EP3645110B1 (en) | 2017-06-26 | 2022-07-13 | Boston Scientific Neuromodulation Corporation | Systems for visualizing and controlling optogenetic stimulation using optical stimulation systems |
| US20200121746A1 (en) | 2017-06-30 | 2020-04-23 | The Regents Of The University Of California | Adeno-associated virus virions with variant capsids and methods of use thereof |
| US11723579B2 (en) | 2017-09-19 | 2023-08-15 | Neuroenhancement Lab, LLC | Method and apparatus for neuroenhancement |
| US11717686B2 (en) | 2017-12-04 | 2023-08-08 | Neuroenhancement Lab, LLC | Method and apparatus for neuroenhancement to facilitate learning and performance |
| US11478603B2 (en) | 2017-12-31 | 2022-10-25 | Neuroenhancement Lab, LLC | Method and apparatus for neuroenhancement to enhance emotional response |
| US12280219B2 (en) | 2017-12-31 | 2025-04-22 | NeuroLight, Inc. | Method and apparatus for neuroenhancement to enhance emotional response |
| US11135438B2 (en) | 2018-01-11 | 2021-10-05 | Boston Scientific Neuromodulation Corporation | Methods and systems for stimulation for glial modulation |
| EP3520832A1 (en) * | 2018-02-05 | 2019-08-07 | Koninklijke Philips N.V. | Oxytocin release stimulation |
| US11565131B2 (en) | 2018-03-23 | 2023-01-31 | Boston Scientific Neuromodulation Corporation | Optical stimulation systems with calibration and methods of making and using |
| EP3768372A1 (en) | 2018-03-23 | 2021-01-27 | Boston Scientific Neuromodulation Corporation | An optical stimulation system with on-demand monitoring and methods of making and using |
| US11364361B2 (en) | 2018-04-20 | 2022-06-21 | Neuroenhancement Lab, LLC | System and method for inducing sleep by transplanting mental states |
| TWI731255B (zh) * | 2018-08-08 | 2021-06-21 | 緯創資通股份有限公司 | 適用交流和直流輸入訊號的繼電器 |
| WO2020056418A1 (en) | 2018-09-14 | 2020-03-19 | Neuroenhancement Lab, LLC | System and method of improving sleep |
| US11224743B2 (en) | 2018-09-21 | 2022-01-18 | Boston Scientific Neuromodulation Corporation | Systems and methods for making and using modular leads for electrical stimulation systems |
| KR20210084459A (ko) | 2018-09-26 | 2021-07-07 | 캘리포니아 인스티튜트 오브 테크놀로지 | 표적화된 유전자 요법을 위한 아데노-연관 바이러스 조성물 |
| US12121597B2 (en) | 2018-10-19 | 2024-10-22 | The Board Of Trustees Of The University Of Illinois | High-intensity focused ultrasound-induced mechanochemical transduction in synthetic elastomers |
| US11426595B2 (en) | 2018-11-16 | 2022-08-30 | Boston Scientific Neuromodulation Corporation | Optical stimulation system with on-demand monitoring and methods of making and using |
| US11547440B2 (en) * | 2018-11-26 | 2023-01-10 | International Business Machines Corporation | Cranial access device |
| US11786694B2 (en) | 2019-05-24 | 2023-10-17 | NeuroLight, Inc. | Device, method, and app for facilitating sleep |
| EP4029521A4 (en) * | 2019-09-13 | 2023-09-06 | Restore Vision Inc. | Nucleic acid construct that encodes chimeric rhodopsin |
| EP4110171A4 (en) * | 2020-02-24 | 2024-06-26 | The Board of Trustees of the Leland Stanford Junior University | PREDICTION OF SUCCESSFUL GENERATION AND INHIBITION OF EPILEPSIC SEIZURE-LIKE AFTER-DISCHARGE AND MAPPING OF THEIR EPILEPSIC SEIZURE NETWORKS BY FMRI |
| WO2022051295A1 (en) | 2020-09-04 | 2022-03-10 | Boston Scientific Neuromodulation Corporation | Stimulation systems with a lens arrangement for light coupling and methods of making and using |
| EP4056681A1 (en) * | 2021-03-12 | 2022-09-14 | Johann Wolfgang Goethe-Universität Frankfurt | An optogenetic voltage clamp (ovc) and uses thereof |
| EP4288145B1 (en) | 2021-04-08 | 2025-01-15 | Boston Scientific Neuromodulation Corporation | Photobiomodulation system and delivery device |
| CN114099975B (zh) * | 2021-11-15 | 2023-07-14 | 北京京东方技术开发有限公司 | 一种胃部滞留胶囊、腰带及胃部神经刺激的方法 |
| EP4398258A3 (en) | 2023-01-04 | 2024-08-28 | Boston Scientific Neuromodulation Corporation | Systems and methods incorporating a light therapy user interface for optical modulation |
Citations (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4162808A (en) | 1978-05-23 | 1979-07-31 | Gulf Oil Corporation | In-situ retorting of carbonaceous deposits |
| US6790657B1 (en) | 1999-01-07 | 2004-09-14 | The United States Of America As Represented By The Department Of Health And Human Services | Lentivirus vector system |
| US20070054319A1 (en) | 2005-07-22 | 2007-03-08 | Boyden Edward S | Light-activated cation channel and uses thereof |
| US20080085265A1 (en) | 2005-07-22 | 2008-04-10 | Schneider M B | System for optical stimulation of target cells |
| US20090093403A1 (en) | 2007-03-01 | 2009-04-09 | Feng Zhang | Systems, methods and compositions for optical stimulation of target cells |
| US20090099038A1 (en) | 2005-07-22 | 2009-04-16 | Karl Deisseroth | Cell line, system and method for optical-based screening of ion-channel modulators |
| WO2010019619A1 (en) | 2008-08-11 | 2010-02-18 | The Board Of Trustees Of The Leland Stanford Junior Univeristy | Method and composition for controlling gene expression |
| US20100145418A1 (en) | 2007-01-10 | 2010-06-10 | Feng Zhang | System for optical stimulation of target cells |
| US20100190229A1 (en) | 2005-07-22 | 2010-07-29 | Feng Zhang | System for optical stimulation of target cells |
Family Cites Families (265)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US2968302A (en) | 1956-07-20 | 1961-01-17 | Univ Illinois | Multibeam focusing irradiator |
| US3131690A (en) | 1962-10-22 | 1964-05-05 | American Optical Corp | Fiber optics devices |
| US3499437A (en) | 1967-03-10 | 1970-03-10 | Ultrasonic Systems | Method and apparatus for treatment of organic structures and systems thereof with ultrasonic energy |
| US3567847A (en) | 1969-01-06 | 1971-03-02 | Edgar E Price | Electro-optical display system |
| US4343301A (en) | 1979-10-04 | 1982-08-10 | Robert Indech | Subcutaneous neural stimulation or local tissue destruction |
| US4559951A (en) | 1982-11-29 | 1985-12-24 | Cardiac Pacemakers, Inc. | Catheter assembly |
| US4616231A (en) | 1984-03-26 | 1986-10-07 | Hughes Aircraft Company | Narrow-band beam steering system |
| FR2580277B1 (fr) | 1985-04-15 | 1988-06-10 | Oreal | Nouveaux derives naphtaleniques a action retinoique, le ur procede de preparation et compositions medicamenteuse et cosmetique les contenant |
| US4865042A (en) | 1985-08-16 | 1989-09-12 | Hitachi, Ltd. | Ultrasonic irradiation system |
| US5041224A (en) | 1988-03-28 | 1991-08-20 | Canon Kabushiki Kaisha | Ion permeable membrane and ion transport method by utilizing said membrane |
| US5082670A (en) | 1988-12-15 | 1992-01-21 | The Regents Of The University Of California | Method of grafting genetically modified cells to treat defects, disease or damage or the central nervous system |
| JP2882818B2 (ja) | 1989-09-08 | 1999-04-12 | 株式会社エス・エル・ティ・ジャパン | レーザ光の照射装置 |
| CA2028261C (en) | 1989-10-28 | 1995-01-17 | Won Suck Yang | Non-invasive method and apparatus for measuring blood glucose concentration |
| US5032123A (en) | 1989-12-28 | 1991-07-16 | Cordis Corporation | Laser catheter with radially divergent treatment beam |
| IE914102A1 (en) | 1990-11-26 | 1992-06-03 | Genetics Inst | Expression of pace in host cells and methods of use thereof |
| US5550316A (en) | 1991-01-02 | 1996-08-27 | Fox Chase Cancer Center | Transgenic animal model system for human cutaneous melanoma |
| US6497872B1 (en) | 1991-07-08 | 2002-12-24 | Neurospheres Holdings Ltd. | Neural transplantation using proliferated multipotent neural stem cells and their progeny |
| US5249575A (en) | 1991-10-21 | 1993-10-05 | Adm Tronics Unlimited, Inc. | Corona discharge beam thermotherapy system |
| SE9103752D0 (sv) | 1991-12-18 | 1991-12-18 | Astra Ab | New compounds |
| US5670113A (en) | 1991-12-20 | 1997-09-23 | Sibia Neurosciences, Inc. | Automated analysis equipment and assay method for detecting cell surface protein and/or cytoplasmic receptor function using same |
| US5739273A (en) | 1992-02-12 | 1998-04-14 | Yale University | Transmembrane polypeptide and methods of use |
| US5460954A (en) | 1992-04-01 | 1995-10-24 | Cheil Foods & Chemicals, Inc. | Production of human proinsulin using a novel vector system |
| US5330515A (en) | 1992-06-17 | 1994-07-19 | Cyberonics, Inc. | Treatment of pain by vagal afferent stimulation |
| US5382516A (en) | 1992-09-15 | 1995-01-17 | Schleicher & Schuell, Inc. | Method and devices for delivery of substrate for the detection of enzyme-linked, membrane-based binding assays |
| US5527695A (en) | 1993-01-29 | 1996-06-18 | Purdue Research Foundation | Controlled modification of eukaryotic genomes |
| WO1994021789A1 (en) | 1993-03-25 | 1994-09-29 | The Regents Of The University Of California | Expression of heterologous polypeptides in halobacteria |
| JP3128386B2 (ja) | 1993-04-07 | 2001-01-29 | 三洋電機株式会社 | 神経モデル素子 |
| US5411540A (en) | 1993-06-03 | 1995-05-02 | Massachusetts Institute Of Technology | Method and apparatus for preferential neuron stimulation |
| GB2278783A (en) | 1993-06-11 | 1994-12-14 | Daniel Shellon Gluck | Method of magnetically stimulating neural cells |
| US6346101B1 (en) | 1993-07-19 | 2002-02-12 | Research Foundation Of City College Of New York | Photon-mediated introduction of biological materials into cells and/or cellular components |
| US5445608A (en) | 1993-08-16 | 1995-08-29 | James C. Chen | Method and apparatus for providing light-activated therapy |
| JPH07171162A (ja) | 1993-09-07 | 1995-07-11 | Olympus Optical Co Ltd | レーザプローブ |
| US6251100B1 (en) | 1993-09-24 | 2001-06-26 | Transmedica International, Inc. | Laser assisted topical anesthetic permeation |
| US5470307A (en) | 1994-03-16 | 1995-11-28 | Lindall; Arnold W. | Catheter system for controllably releasing a therapeutic agent at a remote tissue site |
| EP0755454B1 (en) | 1994-04-13 | 2008-02-13 | The Rockefeller University | Aav-mediated delivery of dna to cells of the nervous system |
| US6436908B1 (en) | 1995-05-30 | 2002-08-20 | Duke University | Use of exogenous β-adrenergic receptor and β-adrenergic receptor kinase gene constructs to enhance myocardial function |
| US5495541A (en) | 1994-04-19 | 1996-02-27 | Murray; Steven C. | Optical delivery device with high numerical aperture curved waveguide |
| US5807285A (en) | 1994-08-18 | 1998-09-15 | Ethicon-Endo Surgery, Inc. | Medical applications of ultrasonic energy |
| US5520188A (en) | 1994-11-02 | 1996-05-28 | Focus Surgery Inc. | Annular array transducer |
| US5795581A (en) | 1995-03-31 | 1998-08-18 | Sandia Corporation | Controlled release of molecular components of dendrimer/bioactive complexes |
| US6334846B1 (en) | 1995-03-31 | 2002-01-01 | Kabushiki Kaisha Toshiba | Ultrasound therapeutic apparatus |
| WO1996032076A1 (en) | 1995-04-11 | 1996-10-17 | Baxter Internatonal Inc. | Tissue implant systems |
| US6342379B1 (en) | 1995-06-07 | 2002-01-29 | The Regents Of The University Of California | Detection of transmembrane potentials by optical methods |
| US6480743B1 (en) | 2000-04-05 | 2002-11-12 | Neuropace, Inc. | System and method for adaptive brain stimulation |
| US5755750A (en) | 1995-11-13 | 1998-05-26 | University Of Florida | Method and apparatus for selectively inhibiting activity in nerve fibers |
| US5722426A (en) | 1996-02-26 | 1998-03-03 | Kolff; Jack | Coronary light probe and method of use |
| US5703985A (en) | 1996-04-29 | 1997-12-30 | Eclipse Surgical Technologies, Inc. | Optical fiber device and method for laser surgery procedures |
| US5939320A (en) | 1996-05-20 | 1999-08-17 | New York University | G-coupled receptors associated with macrophage-trophic HIV, and diagnostic and therapeutic uses thereof |
| US5898058A (en) | 1996-05-20 | 1999-04-27 | Wellman, Inc. | Method of post-polymerization stabilization of high activity catalysts in continuous polyethylene terephthalate production |
| US20040076613A1 (en) | 2000-11-03 | 2004-04-22 | Nicholas Mazarakis | Vector system |
| US7732129B1 (en) | 1998-12-01 | 2010-06-08 | Crucell Holland B.V. | Method for the production and purification of adenoviral vectors |
| US5741316A (en) | 1996-12-02 | 1998-04-21 | Light Sciences Limited Partnership | Electromagnetic coil configurations for power transmission through tissue |
| AU739469B2 (en) * | 1996-12-20 | 2001-10-11 | Alza Corporation | Gel composition and methods |
| US5756351A (en) | 1997-01-13 | 1998-05-26 | The Regents Of The University Of California | Biomolecular optical sensors |
| US5782896A (en) | 1997-01-29 | 1998-07-21 | Light Sciences Limited Partnership | Use of a shape memory alloy to modify the disposition of a device within an implantable medical probe |
| US5904659A (en) | 1997-02-14 | 1999-05-18 | Exogen, Inc. | Ultrasonic treatment for wounds |
| US5816256A (en) | 1997-04-17 | 1998-10-06 | Bioanalytical Systems, Inc. | Movement--responsive system for conducting tests on freely-moving animals |
| US6436708B1 (en) | 1997-04-17 | 2002-08-20 | Paola Leone | Delivery system for gene therapy to the brain |
| US7276488B2 (en) | 1997-06-04 | 2007-10-02 | Oxford Biomedica (Uk) Limited | Vector system |
| US5984861A (en) | 1997-09-29 | 1999-11-16 | Boston Scientific Corporation | Endofluorescence imaging module for an endoscope |
| US6597954B1 (en) | 1997-10-27 | 2003-07-22 | Neuropace, Inc. | System and method for controlling epileptic seizures with spatially separated detection and stimulation electrodes |
| US6016449A (en) | 1997-10-27 | 2000-01-18 | Neuropace, Inc. | System for treatment of neurological disorders |
| US6647296B2 (en) | 1997-10-27 | 2003-11-11 | Neuropace, Inc. | Implantable apparatus for treating neurological disorders |
| US6790652B1 (en) | 1998-01-08 | 2004-09-14 | Bioimage A/S | Method and apparatus for high density format screening for bioactive molecules |
| AU3550099A (en) | 1998-04-07 | 1999-10-25 | Windy Hill Technology, Inc. | Methods and devices for the localization of lesions in solid tissue |
| US6319241B1 (en) | 1998-04-30 | 2001-11-20 | Medtronic, Inc. | Techniques for positioning therapy delivery elements within a spinal cord or a brain |
| US6108081A (en) | 1998-07-20 | 2000-08-22 | Battelle Memorial Institute | Nonlinear vibrational microscopy |
| US6632672B2 (en) | 1998-08-19 | 2003-10-14 | The Board Of Trustees Of The Leland Stanford Junior University | Methods and compositions for genomic modification |
| US6377842B1 (en) | 1998-09-22 | 2002-04-23 | Aurora Optics, Inc. | Method for quantitative measurement of fluorescent and phosphorescent drugs within tissue utilizing a fiber optic probe |
| US6253109B1 (en) | 1998-11-05 | 2001-06-26 | Medtronic Inc. | System for optimized brain stimulation |
| CA2350028C (en) | 1998-11-06 | 2013-04-09 | University Of Rochester | A method to improve circulation to ischemic tissue |
| US6303362B1 (en) | 1998-11-19 | 2001-10-16 | The Board Of Trustees Of The Leland Stanford Junior University | Adenoviral vector and methods for making and using the same |
| US7507545B2 (en) | 1999-03-31 | 2009-03-24 | Cardiome Pharma Corp. | Ion channel modulating activity method |
| US6224566B1 (en) | 1999-05-04 | 2001-05-01 | Cardiodyne, Inc. | Method and devices for creating a trap for confining therapeutic drugs and/or genes in the myocardium |
| US6161045A (en) | 1999-06-01 | 2000-12-12 | Neuropace, Inc. | Method for determining stimulation parameters for the treatment of epileptic seizures |
| US7655423B2 (en) | 1999-06-14 | 2010-02-02 | Henry Ford Health System | Nitric oxide donors for inducing neurogenesis |
| US6662039B2 (en) | 1999-06-18 | 2003-12-09 | The Trustees Of Columbia University In The City Of New York | Optical probing of neuronal connections with fluorescent indicators |
| US20040034882A1 (en) | 1999-07-15 | 2004-02-19 | Vale Wylie W. | Corticotropin releasing factor receptor 2 deficient mice and uses thereof |
| US7674463B1 (en) | 1999-07-15 | 2010-03-09 | Research Development Foundation | Method of inhibiting angiogenesis by administration of a corticotropin releasing factor receptor 2 agonist |
| WO2001005306A1 (en) | 1999-07-19 | 2001-01-25 | Epicor, Inc. | Apparatus and method for ablating tissue |
| KR100630292B1 (ko) | 1999-08-06 | 2006-09-29 | 알프스 덴키 가부시키가이샤 | 자기 디스크용 자기헤드를 반송하기 위한 트레이 |
| GB9923558D0 (en) | 1999-10-05 | 1999-12-08 | Oxford Biomedica Ltd | Producer cell |
| GB9928248D0 (en) | 1999-12-01 | 2000-01-26 | Gill Steven S | An implantable guide tube for neurosurgery |
| DE60109571D1 (de) | 2000-01-14 | 2005-04-28 | Migenix Corp | Screening-assays unter verwendung von intramitochondrialem kalzium |
| US7706882B2 (en) | 2000-01-19 | 2010-04-27 | Medtronic, Inc. | Methods of using high intensity focused ultrasound to form an ablated tissue area |
| US6595934B1 (en) | 2000-01-19 | 2003-07-22 | Medtronic Xomed, Inc. | Methods of skin rejuvenation using high intensity focused ultrasound to form an ablated tissue area containing a plurality of lesions |
| ATE490338T1 (de) | 2000-02-18 | 2010-12-15 | Univ Leland Stanford Junior | Veränderte rekombinasen zur modifizierung des genoms |
| US6473639B1 (en) | 2000-03-02 | 2002-10-29 | Neuropace, Inc. | Neurological event detection procedure using processed display channel based algorithms and devices incorporating these procedures |
| EP1280929A2 (en) | 2000-05-01 | 2003-02-05 | Novartis AG | Vectors for ocular transduction and use thereof for genetic therapy |
| US6599281B1 (en) | 2000-05-03 | 2003-07-29 | Aspect Medical Systems, Inc. | System and method for adaptive drug delivery |
| US6551346B2 (en) | 2000-05-17 | 2003-04-22 | Kent Crossley | Method and apparatus to prevent infections |
| AU6814901A (en) | 2000-06-01 | 2001-12-11 | Univ North Carolina | Methods and compounds for controlled release of recombinant parvovirus vectors |
| WO2002002639A2 (en) | 2000-07-05 | 2002-01-10 | Pharmacia & Upjohn Company | Human ion channels |
| US6686193B2 (en) | 2000-07-10 | 2004-02-03 | Vertex Pharmaceuticals, Inc. | High throughput method and system for screening candidate compounds for activity against target ion channels |
| AU2001288251A1 (en) | 2000-08-16 | 2002-02-25 | Vanderbilt University | Methods and devices for optical stimulation of neural tissues |
| US6567690B2 (en) | 2000-10-16 | 2003-05-20 | Cole Giller | Method and apparatus for probe localization in brain matter |
| US6584357B1 (en) | 2000-10-17 | 2003-06-24 | Sony Corporation | Method and system for forming an acoustic signal from neural timing difference data |
| US6536440B1 (en) | 2000-10-17 | 2003-03-25 | Sony Corporation | Method and system for generating sensory data onto the human neural cortex |
| US7350522B2 (en) | 2000-10-17 | 2008-04-01 | Sony Corporation | Scanning method for applying ultrasonic acoustic data to the human neural cortex |
| US6631283B2 (en) | 2000-11-15 | 2003-10-07 | Virginia Tech Intellectual Properties, Inc. | B/B-like fragment targeting for the purposes of photodynamic therapy and medical imaging |
| US6506154B1 (en) | 2000-11-28 | 2003-01-14 | Insightec-Txsonics, Ltd. | Systems and methods for controlling a phased array focused ultrasound system |
| SE525540C2 (sv) | 2000-11-30 | 2005-03-08 | Datainnovation I Lund Ab | System och förfarande för automatisk provtagning från ett provobjekt |
| US20070196838A1 (en) | 2000-12-08 | 2007-08-23 | Invitrogen Corporation | Methods and compositions for synthesis of nucleic acid molecules using multiple recognition sites |
| US6489115B2 (en) | 2000-12-21 | 2002-12-03 | The Board Of Regents Of The University Of Nebraska | Genetic assays for trinucleotide repeat mutations in eukaryotic cells |
| US6615080B1 (en) | 2001-03-29 | 2003-09-02 | John Duncan Unsworth | Neuromuscular electrical stimulation of the foot muscles for prevention of deep vein thrombosis and pulmonary embolism |
| US7047078B2 (en) | 2001-03-30 | 2006-05-16 | Case Western Reserve University | Methods for stimulating components in, on, or near the pudendal nerve or its branches to achieve selective physiologic responses |
| AU2002303283A1 (en) | 2001-04-04 | 2002-10-21 | Irm Llc | Methods for treating drug addiction |
| US7107996B2 (en) | 2001-04-10 | 2006-09-19 | Ganz Robert A | Apparatus and method for treating atherosclerotic vascular disease through light sterilization |
| US6961045B2 (en) | 2001-06-16 | 2005-11-01 | Che-Chih Tsao | Pattern projection techniques for volumetric 3D displays and 2D displays |
| US6810285B2 (en) | 2001-06-28 | 2004-10-26 | Neuropace, Inc. | Seizure sensing and detection using an implantable device |
| WO2003016486A2 (en) | 2001-08-16 | 2003-02-27 | Sloan Kettering Institute For Cancer Research | Bio-synthetic photostimulators and methods of use |
| US6974448B2 (en) | 2001-08-30 | 2005-12-13 | Medtronic, Inc. | Method for convection enhanced delivery catheter to treat brain and other tumors |
| US7904176B2 (en) | 2006-09-07 | 2011-03-08 | Bio Control Medical (B.C.M.) Ltd. | Techniques for reducing pain associated with nerve stimulation |
| WO2003020103A2 (en) | 2001-09-04 | 2003-03-13 | Amit Technology Science & Medicine Ltd. | Method of and device for therapeutic illumination of internal organs and tissues |
| CA2481020A1 (en) | 2001-09-28 | 2003-04-03 | Saoirse Corporation | Localized non-invasive biological modulation system |
| US7175596B2 (en) | 2001-10-29 | 2007-02-13 | Insightec-Txsonics Ltd | System and method for sensing and locating disturbances in an energy path of a focused ultrasound system |
| US8308784B2 (en) | 2006-08-24 | 2012-11-13 | Jackson Streeter | Low level light therapy for enhancement of neurologic function of a patient affected by Parkinson's disease |
| US7303578B2 (en) | 2001-11-01 | 2007-12-04 | Photothera, Inc. | Device and method for providing phototherapy to the brain |
| AU2002363478A1 (en) | 2001-11-08 | 2003-05-19 | Children's Medical Center Corporation | Bacterial ion channel and a method for screening ion channel modulators |
| WO2003046141A2 (en) | 2001-11-26 | 2003-06-05 | Advanced Cell Technology, Inc. | Methods for making and using reprogrammed human somatic cell nuclei and autologous and isogenic human stem cells |
| US20030104512A1 (en) | 2001-11-30 | 2003-06-05 | Freeman Alex R. | Biosensors for single cell and multi cell analysis |
| US6873868B2 (en) | 2001-12-31 | 2005-03-29 | Infraredx, Inc. | Multi-fiber catheter probe arrangement for tissue analysis or treatment |
| US6721603B2 (en) | 2002-01-25 | 2004-04-13 | Cyberonics, Inc. | Nerve stimulation as a treatment for pain |
| US6666857B2 (en) | 2002-01-29 | 2003-12-23 | Robert F. Smith | Integrated wavefront-directed topography-controlled photoablation |
| EP1478348A4 (en) | 2002-02-01 | 2008-06-18 | Cleveland Clinic Foundation | MICROFINUSION DEVICE |
| WO2003070105A1 (en) | 2002-02-20 | 2003-08-28 | Liposonix, Inc. | Ultrasonic treatment and imaging of adipose tissue |
| US20030186249A1 (en) | 2002-04-01 | 2003-10-02 | Zairen Sun | Human TARPP genes and polypeptides |
| US20070135875A1 (en) | 2002-04-08 | 2007-06-14 | Ardian, Inc. | Methods and apparatus for thermally-induced renal neuromodulation |
| DE10216005A1 (de) | 2002-04-11 | 2003-10-30 | Max Planck Gesellschaft | Verwendung von biologischen Photorezeptoren als direkt lichtgesteuerte Ionenkanäle |
| US7283861B2 (en) | 2002-04-30 | 2007-10-16 | Alexander Bystritsky | Methods for modifying electrical currents in neuronal circuits |
| US9592409B2 (en) | 2002-04-30 | 2017-03-14 | The Regents Of The University Of California | Methods for modifying electrical currents in neuronal circuits |
| WO2003096045A1 (en) | 2002-05-13 | 2003-11-20 | Koninklijke Philips Electronics N.V. | Reduction of susceptibility artifacts in subencoded single-shot magnetic resonance imaging |
| WO2003102156A2 (en) | 2002-05-31 | 2003-12-11 | Sloan-Kettering Institute For Cancer Research | Heterologous stimulus-gated ion channels and methods of using same |
| AU2003239957A1 (en) | 2002-06-04 | 2003-12-19 | Cyberkinetics, Inc. | Optically-connected implants and related systems and methods of use |
| US7292890B2 (en) | 2002-06-20 | 2007-11-06 | Advanced Bionics Corporation | Vagus nerve stimulation via unidirectional propagation of action potentials |
| US20040049134A1 (en) | 2002-07-02 | 2004-03-11 | Tosaya Carol A. | System and methods for treatment of alzheimer's and other deposition-related disorders of the brain |
| US20060106543A1 (en) | 2002-08-09 | 2006-05-18 | Gustavo Deco | Method for analyzing effectiveness of pharmaceutical preparation |
| DE60326482D1 (de) | 2002-10-10 | 2009-04-16 | Merck & Co Inc | Testverfahren für zustandsabhängige calciumkanal-agonisten/-antagonisten |
| US7355033B2 (en) | 2002-11-18 | 2008-04-08 | Health Research, Inc. | Screening for West Nile Virus antiviral therapy |
| US20040122475A1 (en) | 2002-12-18 | 2004-06-24 | Myrick Andrew J. | Electrochemical neuron systems |
| US7377900B2 (en) | 2003-06-02 | 2008-05-27 | Insightec - Image Guided Treatment Ltd. | Endo-cavity focused ultrasound transducer |
| US7442685B2 (en) | 2003-06-13 | 2008-10-28 | The University Of North Carolina At Chapel Hill | DOT1 histone methyltransferases as a target for identifying therapeutic agents for leukemia |
| US7091500B2 (en) | 2003-06-20 | 2006-08-15 | Lucent Technologies Inc. | Multi-photon endoscopic imaging system |
| US8367410B2 (en) | 2003-06-20 | 2013-02-05 | Massachusetts Institute Of Technology | Application of electrical stimulation for functional tissue engineering in vitro and in vivo |
| JP2005034073A (ja) | 2003-07-16 | 2005-02-10 | Masamitsu Iino | ミオシン軽鎖リン酸化の測定用蛍光性プローブ |
| US20050153885A1 (en) | 2003-10-08 | 2005-07-14 | Yun Anthony J. | Treatment of conditions through modulation of the autonomic nervous system |
| EP1684861B1 (en) | 2003-10-21 | 2014-12-03 | The Regents Of The University Of Michigan | Intracranial neural interface system |
| US6952097B2 (en) | 2003-10-22 | 2005-10-04 | Siemens Aktiengesellschaft | Method for slice position planning of tomographic measurements, using statistical images |
| US20080119421A1 (en) | 2003-10-31 | 2008-05-22 | Jack Tuszynski | Process for treating a biological organism |
| US20060034943A1 (en) | 2003-10-31 | 2006-02-16 | Technology Innovations Llc | Process for treating a biological organism |
| AU2004294933B2 (en) | 2003-11-21 | 2011-11-17 | Johns Hopkins University | Biomolecule partition motifs and uses thereof |
| US20050124897A1 (en) | 2003-12-03 | 2005-06-09 | Scimed Life Systems, Inc. | Apparatus and methods for delivering acoustic energy to body tissue |
| US7783349B2 (en) | 2006-04-10 | 2010-08-24 | Cardiac Pacemakers, Inc. | System and method for closed-loop neural stimulation |
| US7662114B2 (en) | 2004-03-02 | 2010-02-16 | Focus Surgery, Inc. | Ultrasound phased arrays |
| US20050215764A1 (en) | 2004-03-24 | 2005-09-29 | Tuszynski Jack A | Biological polymer with differently charged portions |
| US9801527B2 (en) | 2004-04-19 | 2017-10-31 | Gearbox, Llc | Lumen-traveling biological interface device |
| WO2005107858A1 (en) | 2004-04-30 | 2005-11-17 | Advanced Neuromodulation Systems, Inc. | Method of treating mood disorders and/or anxiety disorders by brain stimulation |
| US7670838B2 (en) | 2004-05-24 | 2010-03-02 | The Board Of Trustees Of The Leland Stanford Junior University | Coupling of excitation and neurogenesis in neural stem/progenitor cells |
| US20050279354A1 (en) | 2004-06-21 | 2005-12-22 | Harvey Deutsch | Structures and Methods for the Joint Delivery of Fluids and Light |
| US20060057614A1 (en) | 2004-08-04 | 2006-03-16 | Nathaniel Heintz | Tethering neuropeptides and toxins for modulation of ion channels and receptors |
| US7699780B2 (en) | 2004-08-11 | 2010-04-20 | Insightec—Image-Guided Treatment Ltd. | Focused ultrasound system with adaptive anatomical aperture shaping |
| US8409099B2 (en) | 2004-08-26 | 2013-04-02 | Insightec Ltd. | Focused ultrasound system for surrounding a body tissue mass and treatment method |
| US8821559B2 (en) | 2004-08-27 | 2014-09-02 | Codman & Shurtleff, Inc. | Light-based implants for treating Alzheimer's disease |
| US7613520B2 (en) | 2004-10-21 | 2009-11-03 | Advanced Neuromodulation Systems, Inc. | Spinal cord stimulation to treat auditory dysfunction |
| US7544171B2 (en) | 2004-10-22 | 2009-06-09 | General Patent Llc | Methods for promoting nerve regeneration and neuronal growth and elongation |
| WO2007013891A2 (en) | 2004-11-12 | 2007-02-01 | Northwestern University | Apparatus and methods for optical stimulation of the auditory nerve |
| EP1814630A4 (en) | 2004-11-15 | 2008-05-07 | Christopher Decharms | APPLICATIONS FOR NERVE BEND STIMULATION BY LIGHT |
| US8109981B2 (en) | 2005-01-25 | 2012-02-07 | Valam Corporation | Optical therapies and devices |
| US7686839B2 (en) | 2005-01-26 | 2010-03-30 | Lumitex, Inc. | Phototherapy treatment devices for applying area lighting to a wound |
| US7553284B2 (en) | 2005-02-02 | 2009-06-30 | Vaitekunas Jeffrey J | Focused ultrasound for pain reduction |
| US9034650B2 (en) | 2005-02-02 | 2015-05-19 | Intrexon Corporation | Site-specific serine recombinases and methods of their use |
| US7548780B2 (en) | 2005-02-22 | 2009-06-16 | Cardiac Pacemakers, Inc. | Cell therapy and neural stimulation for cardiac repair |
| US7288108B2 (en) | 2005-03-14 | 2007-10-30 | Codman & Shurtleff, Inc. | Red light implant for treating Parkinson's disease |
| CA2602835A1 (en) | 2005-03-31 | 2006-10-05 | Esther Mayer | Probe device, system and method for photobiomodulation of tissue lining a body cavity |
| JP2006295350A (ja) | 2005-04-07 | 2006-10-26 | Sony Corp | 撮像装置及び撮像結果の処理方法 |
| US9445211B2 (en) | 2005-04-11 | 2016-09-13 | St. Jude Medical, Atrial Fibrillation Division, Inc. | Methods for manufacturing high intensity ultrasound transducers |
| GB0508254D0 (en) | 2005-04-23 | 2005-06-01 | Smith & Nephew | Ultrasound device |
| US7640057B2 (en) | 2005-04-25 | 2009-12-29 | Cardiac Pacemakers, Inc. | Methods of providing neural markers for sensed autonomic nervous system activity |
| CA2650213A1 (en) | 2005-04-26 | 2006-11-02 | University Of Victoria Innovation And Development Corporation | Production of light from sol-gel derived thin films made with lanthanide doped nanoparticles, and preparation thereof |
| MX2007013734A (es) | 2005-05-02 | 2008-03-14 | Genzyme Corp | Terapia genica para trastornos de la medula espinal. |
| CN1879906A (zh) | 2005-06-15 | 2006-12-20 | 郑云峰 | 中枢神经系统磁刺激装置及其使用方法 |
| US9238150B2 (en) | 2005-07-22 | 2016-01-19 | The Board Of Trustees Of The Leland Stanford Junior University | Optical tissue interface method and apparatus for stimulating cells |
| US8852184B2 (en) | 2005-09-15 | 2014-10-07 | Cannuflow, Inc. | Arthroscopic surgical temperature control system |
| US20080077200A1 (en) | 2006-09-21 | 2008-03-27 | Aculight Corporation | Apparatus and method for stimulation of nerves and automated control of surgical instruments |
| US8058509B2 (en) | 2005-12-21 | 2011-11-15 | Pioneer Hi-Bred International, Inc. | Methods and compositions for in planta production of inverted repeats |
| US7610100B2 (en) | 2005-12-30 | 2009-10-27 | Boston Scientific Neuromodulation Corporation | Methods and systems for treating osteoarthritis |
| US20070191906A1 (en) | 2006-02-13 | 2007-08-16 | Anand Iyer | Method and apparatus for selective nerve stimulation |
| US20070219600A1 (en) | 2006-03-17 | 2007-09-20 | Michael Gertner | Devices and methods for targeted nasal phototherapy |
| US20070282404A1 (en) | 2006-04-10 | 2007-12-06 | University Of Rochester | Side-firing linear optic array for interstitial optical therapy and monitoring using compact helical geometry |
| US20070253995A1 (en) | 2006-04-28 | 2007-11-01 | Medtronic, Inc. | Drug Delivery Methods and Devices for Treating Stress Urinary Incontinence |
| US8057464B2 (en) | 2006-05-03 | 2011-11-15 | Light Sciences Oncology, Inc. | Light transmission system for photoreactive therapy |
| US8470790B2 (en) | 2006-05-04 | 2013-06-25 | Wayne State University | Restoration of visual responses by in vivo delivery of rhodopsin nucleic acids |
| US20080176076A1 (en) | 2006-05-11 | 2008-07-24 | University Of Victoria Innovation And Development Corporation | Functionalized lanthanide rich nanoparticles and use thereof |
| US20080262411A1 (en) | 2006-06-02 | 2008-10-23 | Dobak John D | Dynamic nerve stimulation in combination with other eating disorder treatment modalities |
| EP2965782B1 (en) | 2006-06-19 | 2017-08-09 | Highland Instruments, Inc. | Apparatus for stimulation of biological tissue |
| US7795632B2 (en) | 2006-06-26 | 2010-09-14 | Osram Sylvania Inc. | Light emitting diode with direct view optic |
| US20080027505A1 (en) | 2006-07-26 | 2008-01-31 | G&L Consulting, Llc | System and method for treatment of headaches |
| WO2008014382A2 (en) | 2006-07-26 | 2008-01-31 | Case Western Reserve University | System and method for controlling g-protein coupled receptor pathways |
| US7848797B2 (en) | 2006-08-17 | 2010-12-07 | Neurometrix, Inc. | Motor unit number estimation (MUNE) for the assessment of neuromuscular function |
| US7521590B2 (en) | 2006-09-01 | 2009-04-21 | Korea Institute Of Science And Technology | Phospholipase C β1 (PLCβ1) knockout mice as a model system for testing schizophrenia drugs |
| US10420948B2 (en) | 2006-10-30 | 2019-09-24 | Medtronic, Inc. | Implantable medical device with variable data retransmission characteristics based upon data type |
| EE200600039A (et) | 2006-12-12 | 2008-10-15 | Tartu Ülikool | Transgeenne loommudel patoloogilise ärevuse modelleerimiseks, meetod patoloogilisest ärevusest p?hjustatud haiguste v?i seisundite ravimiseks sobilike ühendite tuvastamiseks ja meetod Wfs1 valgu kasutamiseks sihtmärgina patoloogilise ärevuse vastase |
| US7883536B1 (en) | 2007-01-19 | 2011-02-08 | Lockheed Martin Corporation | Hybrid optical-electrical probes |
| WO2008101128A1 (en) | 2007-02-14 | 2008-08-21 | The Board Of Trustees Of The Leland Stanford Junior University | System, method and applications involving identification of biological circuits such as neurological characteristics |
| US8282559B2 (en) | 2007-03-09 | 2012-10-09 | Philip Chidi Njemanze | Method for inducing and monitoring long-term potentiation and long-term depression using transcranial doppler ultrasound device in head-down bed rest |
| US8139339B2 (en) | 2007-03-16 | 2012-03-20 | Old Dominion University Research Foundation | Modulation of neuromuscular functions with ultrashort electrical pulses |
| US20080287821A1 (en) | 2007-03-30 | 2008-11-20 | Searete Llc, A Limited Liability Corporation Of The State Of Delaware | Computational user-health testing |
| JP5361868B2 (ja) | 2007-05-01 | 2013-12-04 | ニューロフォーカス・インコーポレーテッド | 神経情報貯蔵システム |
| US20110165681A1 (en) | 2009-02-26 | 2011-07-07 | Massachusetts Institute Of Technology | Light-Activated Proton Pumps and Applications Thereof |
| US8097422B2 (en) | 2007-06-20 | 2012-01-17 | Salk Institute For Biological Studies | Kir channel modulators |
| US9138596B2 (en) | 2007-08-22 | 2015-09-22 | Cardiac Pacemakers, Inc. | Optical depolarization of cardiac tissue |
| US10434327B2 (en) | 2007-10-31 | 2019-10-08 | The Board Of Trustees Of The Leland Stanford Junior University | Implantable optical stimulators |
| US10035027B2 (en) | 2007-10-31 | 2018-07-31 | The Board Of Trustees Of The Leland Stanford Junior University | Device and method for ultrasonic neuromodulation via stereotactic frame based technique |
| US9302116B2 (en) | 2007-11-06 | 2016-04-05 | Duke University | Non-invasive energy upconversion methods and systems for in-situ photobiomodulation |
| WO2009070705A2 (en) | 2007-11-26 | 2009-06-04 | Microtransponder Inc. | Transfer coil architecture |
| WO2009072123A2 (en) | 2007-12-06 | 2009-06-11 | Technion Research & Development Foundation Ltd. | Method and system for optical stimulation of neurons |
| US8883719B2 (en) | 2008-01-16 | 2014-11-11 | University Of Connecticut | Bacteriorhodopsin protein variants and methods of use for long term data storage |
| US20090254134A1 (en) | 2008-02-04 | 2009-10-08 | Medtrode Inc. | Hybrid ultrasound/electrode device for neural stimulation and recording |
| JP5544659B2 (ja) | 2008-03-24 | 2014-07-09 | 国立大学法人東北大学 | 改変された光受容体チャネル型ロドプシンタンパク質 |
| EP2268311A4 (en) | 2008-04-04 | 2014-08-27 | Immunolight Llc | NON-INVASIVE SYSTEMS AND IN SITU PHOTOBIOMODULATION METHODS |
| SG189813A1 (en) | 2008-04-23 | 2013-05-31 | Univ Leland Stanford Junior | Systems, methods and compositions for optical stimulation of target cells |
| MX2010012592A (es) | 2008-05-20 | 2011-05-05 | Eos Neuroscience Inc | Vectores para la administracion de proteinas sensibles a la luz y metodos de uso de las mismas. |
| JP5890176B2 (ja) | 2008-05-29 | 2016-03-22 | ザ ボード オブ トラスティーズ オブ ザ レランド スタンフォード ジュニア ユニバーシティー | セカンドメッセンジャーを光制御するためのセルライン、システム、および方法 |
| EP2303405A4 (en) | 2008-06-17 | 2017-12-27 | The Board of Trustees of the Leland Stanford Junior University | Apparatus and methods for controlling cellular development |
| AU2009260029B2 (en) | 2008-06-17 | 2016-03-17 | The Board Of Trustees Of The Leland Stanford Junior University | Methods, systems and devices for optical stimulation of target cells using an optical transmission element |
| US9101759B2 (en) | 2008-07-08 | 2015-08-11 | The Board Of Trustees Of The Leland Stanford Junior University | Materials and approaches for optical stimulation of the peripheral nervous system |
| JP2012503798A (ja) | 2008-09-25 | 2012-02-09 | ザ トラスティーズ オブ コロンビア ユニヴァーシティ イン ザ シティ オブ ニューヨーク | 構造物の光刺激およびイメージングを提供するためのデバイス、装置、および方法 |
| NZ602416A (en) | 2008-11-14 | 2014-08-29 | Univ Leland Stanford Junior | Optically-based stimulation of target cells and modifications thereto |
| US8878760B2 (en) | 2008-11-26 | 2014-11-04 | Sharp Kabushiki Kaisha | Liquid crystal display device, method for driving liquid crystal display device, and television receiver |
| US8380318B2 (en) | 2009-03-24 | 2013-02-19 | Spinal Modulation, Inc. | Pain management with stimulation subthreshold to paresthesia |
| KR101081360B1 (ko) | 2009-03-25 | 2011-11-08 | 한국과학기술연구원 | 어레이형 광 자극 장치 |
| WO2011005978A2 (en) | 2009-07-08 | 2011-01-13 | Duke University | Methods of manipulating cell signaling |
| US20110112463A1 (en) | 2009-11-12 | 2011-05-12 | Jerry Silver | Compositions and methods for treating a neuronal injury or neuronal disorders |
| US8936630B2 (en) | 2009-11-25 | 2015-01-20 | Medtronic, Inc. | Optical stimulation therapy |
| WO2011106783A2 (en) | 2010-02-26 | 2011-09-01 | Cornell University | Retina prosthesis |
| JP5866332B2 (ja) | 2010-03-17 | 2016-02-17 | ザ ボード オブ トラスティーズ オブ ザ レランド スタンフォード ジュニア ユニバーシティー | 感光性イオンを通過させる分子 |
| WO2011127088A2 (en) | 2010-04-05 | 2011-10-13 | Eos Neuroscience, Inc. | Methods and compositions for decreasing chronic pain |
| US10051240B2 (en) | 2010-06-14 | 2018-08-14 | Howard Hughes Medical Institute | Structured plane illumination microscopy |
| US9057734B2 (en) | 2010-08-23 | 2015-06-16 | President And Fellows Of Harvard College | Optogenetic probes for measuring membrane potential |
| SI2614079T1 (sl) | 2010-09-08 | 2015-10-30 | Max-Planck-Gesellschaft Zur Foerderung Der Wissenschaften E.V. | Mutantski kanalnirodopsin 2 |
| CA2817175C (en) * | 2010-11-05 | 2019-09-24 | The Board Of Trustees Of The Leland Stanford Junior University | Upconversion of light using lanthanide-doped nanoparticles for use in optogenetic methods |
| EP3486253A1 (en) | 2010-11-05 | 2019-05-22 | The Board of Trustees of The Leland Stanford Junior University | Light-activated chimeric opsins and methods of using the same |
| US9992981B2 (en) | 2010-11-05 | 2018-06-12 | The Board Of Trustees Of The Leland Stanford Junior University | Optogenetic control of reward-related behaviors |
| CN103491770B (zh) | 2010-11-05 | 2016-06-08 | 斯坦福大学托管董事会 | 稳定阶跃函数视蛋白及其使用方法 |
| WO2012061681A1 (en) | 2010-11-05 | 2012-05-10 | The Board Of Trustees Of The Leland Stanford Junior University. | Control and characterization of memory function |
| CA2816987C (en) | 2010-11-05 | 2018-09-18 | The Board Of Trustees Of The Leland Stanford Junior University | Control and characterization of psychotic states |
| CN106106368A (zh) | 2010-11-05 | 2016-11-16 | 斯坦福大学托管董事会 | 光控cns功能障碍 |
| US8957028B2 (en) | 2010-11-13 | 2015-02-17 | Massachusetts Institute Of Technology | Red-shifted opsin molecules and uses thereof |
| US8696722B2 (en) | 2010-11-22 | 2014-04-15 | The Board Of Trustees Of The Leland Stanford Junior University | Optogenetic magnetic resonance imaging |
| US9939449B2 (en) | 2011-02-01 | 2018-04-10 | The University Of Vermont And State Agricultural College | Diagnostic and therapeutic methods and products related to anxiety disorders |
| US20120253261A1 (en) | 2011-03-29 | 2012-10-04 | Medtronic, Inc. | Systems and methods for optogenetic modulation of cells within a patient |
| CA2839938A1 (en) | 2011-06-28 | 2013-01-03 | University Of Rochester | Photoactivatable receptors and their uses |
| WO2013016389A1 (en) | 2011-07-25 | 2013-01-31 | Neuronexus Technologies, Inc. | Opto-electrical device and method for artifact reduction |
| JP2014521956A (ja) | 2011-07-27 | 2014-08-28 | ザ ボード オブ トラスティーズ オブ ザ ユニヴァーシティー オブ イリノイ | 生体分子を特徴付けるためのナノ細孔センサー |
| EP3524676A1 (en) | 2011-12-16 | 2019-08-14 | The Board of Trustees of The Leland Stanford Junior University | Opsin polypeptides and methods of use thereof |
| ES2628006T3 (es) | 2012-02-21 | 2017-08-01 | Circuit Therapeutics, Inc. | Composiciones para el tratamiento de trastornos neurogénicos del suelo pélvico |
| WO2013126762A1 (en) | 2012-02-23 | 2013-08-29 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Office Of Technology Transfer, National Institutes Of Health | Multi-focal structured illumination microscopy systems and methods |
| US20150040249A1 (en) | 2012-03-20 | 2015-02-05 | The Board Of Trustees Of The Leland Stanford Junior University | Non-Human Animal Models of Depression and Methods of Use Thereof |
| JP6580487B2 (ja) | 2012-11-21 | 2019-09-25 | サーキット セラピューティクス, インコーポレイテッド | 光遺伝学的治療のためのシステムおよび方法 |
| WO2014117079A1 (en) | 2013-01-25 | 2014-07-31 | The Trustees Of Columbia University In The City Of New York | Depth of field 3d imaging slm microscope |
| US9636380B2 (en) | 2013-03-15 | 2017-05-02 | The Board Of Trustees Of The Leland Stanford Junior University | Optogenetic control of inputs to the ventral tegmental area |
| US10974064B2 (en) | 2013-03-15 | 2021-04-13 | The Board Of Trustees Of The Leland Stanford Junior University | Optogenetic control of behavioral state |
| WO2014179331A2 (en) | 2013-04-29 | 2014-11-06 | The Board Of Trustees Of The Leland Stanford Junior University | Devices, systems and methods for optogenetic modulation of action potentials in target cells |
| US20150112411A1 (en) | 2013-10-18 | 2015-04-23 | Varaya Photoceuticals, Llc | High powered light emitting diode photobiology compositions, methods and systems |
| WO2016019075A1 (en) | 2014-07-29 | 2016-02-04 | Circuit Therapeutics, Inc. | System and method for optogenetic therapy |
-
2011
- 2011-03-17 JP JP2013500217A patent/JP5866332B2/ja not_active Expired - Fee Related
- 2011-03-17 US US13/577,565 patent/US9079940B2/en active Active
- 2011-03-17 MY MYPI2015003062A patent/MY175954A/en unknown
- 2011-03-17 AU AU2011227131A patent/AU2011227131B2/en not_active Ceased
- 2011-03-17 EP EP11757027.5A patent/EP2547762B1/en not_active Not-in-force
- 2011-03-17 ES ES11757027.5T patent/ES2676274T3/es active Active
- 2011-03-17 CA CA2791094A patent/CA2791094A1/en not_active Abandoned
- 2011-03-17 CN CN201180014303.3A patent/CN102844427B/zh not_active Expired - Fee Related
- 2011-03-17 SG SG10201505162QA patent/SG10201505162QA/en unknown
- 2011-03-17 EP EP18163332.2A patent/EP3399024A1/en not_active Withdrawn
- 2011-03-17 WO PCT/US2011/028893 patent/WO2011116238A2/en not_active Ceased
- 2011-03-17 CN CN201610380115.7A patent/CN106011073A/zh active Pending
- 2011-03-17 SG SG2012065488A patent/SG183899A1/en unknown
-
2012
- 2012-08-12 IL IL221410A patent/IL221410A0/en not_active IP Right Cessation
- 2012-09-19 US US13/622,809 patent/US9249234B2/en active Active
- 2012-09-20 US US13/623,612 patent/US9359449B2/en active Active
-
2016
- 2016-01-04 JP JP2016000072A patent/JP6235618B2/ja not_active Expired - Fee Related
- 2016-05-12 US US15/153,299 patent/US9604073B2/en active Active
-
2017
- 2017-03-01 US US15/447,019 patent/US20170198017A1/en not_active Abandoned
-
2018
- 2018-08-27 IL IL261389A patent/IL261389A/en not_active IP Right Cessation
Patent Citations (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4162808A (en) | 1978-05-23 | 1979-07-31 | Gulf Oil Corporation | In-situ retorting of carbonaceous deposits |
| US6790657B1 (en) | 1999-01-07 | 2004-09-14 | The United States Of America As Represented By The Department Of Health And Human Services | Lentivirus vector system |
| US20070054319A1 (en) | 2005-07-22 | 2007-03-08 | Boyden Edward S | Light-activated cation channel and uses thereof |
| US20070053996A1 (en) | 2005-07-22 | 2007-03-08 | Boyden Edward S | Light-activated cation channel and uses thereof |
| US20070261127A1 (en) | 2005-07-22 | 2007-11-08 | Boyden Edward S | Light-activated cation channel and uses thereof |
| US20080085265A1 (en) | 2005-07-22 | 2008-04-10 | Schneider M B | System for optical stimulation of target cells |
| US20090099038A1 (en) | 2005-07-22 | 2009-04-16 | Karl Deisseroth | Cell line, system and method for optical-based screening of ion-channel modulators |
| US20100190229A1 (en) | 2005-07-22 | 2010-07-29 | Feng Zhang | System for optical stimulation of target cells |
| US20100234273A1 (en) | 2005-07-22 | 2010-09-16 | The Board Of Trustees Of The Leland Stanford Junior University | Light-activated cation channel and uses thereof |
| US20100145418A1 (en) | 2007-01-10 | 2010-06-10 | Feng Zhang | System for optical stimulation of target cells |
| US20090093403A1 (en) | 2007-03-01 | 2009-04-09 | Feng Zhang | Systems, methods and compositions for optical stimulation of target cells |
| WO2010019619A1 (en) | 2008-08-11 | 2010-02-18 | The Board Of Trustees Of The Leland Stanford Junior Univeristy | Method and composition for controlling gene expression |
Non-Patent Citations (22)
| Title |
|---|
| "Method of the Year", December 2010, SCIENTIFIC AMERICAN |
| ALEXANDER M. ARAVANIS; 4 ET AL.: "An optical neural interface: in vivo control of rodent motor cortex with integrated fiber optic and optogenetic technology", JOURNAL NEURAL ENGINEERING, 2007, pages S143 - S156 |
| ANTOINE R. ADAMANTIDIS ET AL.: "Neural substrates of awakening probed with optogenetic control of hypocretin neurons", NATURE, vol. 450, 15 November 2007 (2007-11-15), pages 420 - 424 |
| BRIGITTE SCHOBERT ET AL.: "Halorhodopsin Is a Light-driven Chloride Pump", THE JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 257, no. 17, 10 September 1982 (1982-09-10), pages 10306 - 10313, XP007902190 |
| DEISSEROTH, K ET AL.: "Excitation-neurogenesis coupling in adult neural stem/progenitor cells", NEURON, vol. 42, 2004, pages 535 - 552, XP003025638, DOI: doi:10.1016/S0896-6273(04)00266-1 |
| FENG ZHANG ET AL.: "Circuit-breakers: optical technologies for probing neural signals and systems", NATURE REVIEWS NEUROSCIENCE, vol. 8, August 2007 (2007-08-01), pages 577 - 581, XP002487914 |
| FENG ZHANG ET AL.: "Multimodal fast optical interrogation of neural circuitry", NATURE, vol. 446, 5 April 2007 (2007-04-05), pages 633 - 639, XP002487911, DOI: doi:10.1038/nature05744 |
| H. POTTER: "Current Protocols in Molecular Biology", 1996, JOHN WILEY & SONS, INC, article "Transfection by Electroporation", pages: 9.3.1 - 9.3.6 |
| MAYBERG HS ET AL.: "Deep Brain Stimulation for Treatment-Resistant Depression", NEURON, vol. 45, 3 March 2005 (2005-03-03), pages 651 - 660 |
| NAQVI NH; RUDRAUF D; DAMASIO H; BECHARA A.: "Damage to the insula disrupts addiction to cigarette smoking", SCIENCE, vol. 315, no. 5811, 26 January 2007 (2007-01-26), pages 531 - 534 |
| R. MORTENSEN; J.D. CHESNUT; J.P. HOEFFLER; R.E. KINGSTON: "Current Protocols in Molecular Biology", 1997, JOHN WILEY & SONS, INC, article "Selection of Transfected Mammalian Cells", pages: 9.5.1 - 09.5.19 |
| R.E. KINGSTON; C.A. CHEN; H. OKAVAMA: "Current Protocols in Immunology (CPI", JOHN WILEY & SONS, INC, article "Transfection and Expression of Cloned DNA", pages: 10.13.1 - 10.13.9 |
| R.E. KINGSTON; C.A. CHEN; H. OKAYAMA; J.K. ROSE: "Current Protocols in Molecular Biology", 1996, JOHN WILEY & SONS, INC., article "Transfection of DNA into Eukarotic Cells", pages: 9.1.1 - 9.1.11 |
| SCHIFF ND; GIACINO JT; KALMAR K; VICTOR JD; BAKER K; GERBER M; FRITZ B; EISENBERG B; O'CONNOR JO; KOBYLARZ EJ: "Behavioral improvements with thalamic stimulation after severe traumatic brain injury", NATURE, vol. 448, 2 August 2007 (2007-08-02), pages 600 - 604 |
| SCHLAEPFER ET AL.: "Deep Brain stimulation to Reward Circuitry Alleviates Anhedonia in Refractory Major Depression", NEUROPSYCHOPHARMACOLOGY, 2007, pages 1 - 10 |
| T. GULICK: "Current Protocols in Molecular Biology", 1997, JOHN WILEY & SONS, INC, article "Transfection using DEAE-Dextran", pages: 9.2.1 - 9.2.10 |
| VIVIANA GRADINARU ET AL.: "Molecular and Cellular Approaches for Diversifying and Extending Optogenetics", CELL, vol. 141, 2 April 2010 (2010-04-02), pages 154 - 165, XP002704864, DOI: doi:10.1016/J.CELL.2010.02.037 |
| VIVIANA GRADINARU ET AL.: "Targeting and Readout Strategies for Fast Optical Neural Control In Vitro and In Vivo", THE JOURNAL OF NEUROSCIENCE, vol. 27, no. 52, 26 December 2007 (2007-12-26), pages 14231 - 14238, XP055401440, DOI: doi:10.1523/JNEUROSCI.3578-07.2007 |
| WARREN PEAR: "Current Protocols in Molecular Biology", 1996, JOHN WILEY & SONS, INC., article "Transient Transfection Methods for Preparation of High-Titer Retroviral Supernatants", pages: 9.11.1 - 9.11.18 |
| ZHANG ET AL.: "Channelrhodopsin-2 and Optical Control of Excitable Cells", NATURE METHODS, vol. 3, no. 10, 2006, XP008144949, DOI: doi:10.1038/nmeth936 |
| ZHANG, F.; PRIGGE, M.; BEYRIERE, F.; TSUNODA, S.P.; MATTIS, J.; YIZHAR, O.; HEGEMANN, P.; DEISSEROTH, K.: "Red-shifted optogenetic excitation: a tool for fast neural control derived from Volvox carteri", NAT. NEUROSCI., vol. 11, 2008, pages 631 - 633, XP002487916, DOI: doi:10.1038/nn.2120 |
| ZHAO, S.; CUNHA, C.; ZHANG, F.; LIU, Q.; GLOSS, B.; DEISSEROTH, K.; AUGUSTINE, G.J.; FENG, G.: "Improved expression of halorhodopsin for light-induced silencing of neuronal activity", BRAIN CELL BIOL., vol. 36, 2008, pages 141 - 154, XP019647658, DOI: doi:10.1007/s11068-008-9034-7 |
Cited By (98)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9829492B2 (en) | 2005-07-22 | 2017-11-28 | The Board Of Trustees Of The Leland Stanford Junior University | Implantable prosthetic device comprising a cell expressing a channelrhodopsin |
| US10422803B2 (en) | 2005-07-22 | 2019-09-24 | The Board Of Trustees Of The Leland Stanford Junior University | Light-activated cation channel and uses thereof |
| US10627410B2 (en) | 2005-07-22 | 2020-04-21 | The Board Of Trustees Of The Leland Stanford Junior University | Light-activated cation channel and uses thereof |
| US9238150B2 (en) | 2005-07-22 | 2016-01-19 | The Board Of Trustees Of The Leland Stanford Junior University | Optical tissue interface method and apparatus for stimulating cells |
| US10094840B2 (en) | 2005-07-22 | 2018-10-09 | The Board Of Trustees Of The Leland Stanford Junior University | Light-activated cation channel and uses thereof |
| US10451608B2 (en) | 2005-07-22 | 2019-10-22 | The Board Of Trustees Of The Leland Stanford Junior University | Cell line, system and method for optical-based screening of ion-channel modulators |
| US9278159B2 (en) | 2005-07-22 | 2016-03-08 | The Board Of Trustees Of The Leland Stanford Junior University | Light-activated cation channel and uses thereof |
| US9274099B2 (en) | 2005-07-22 | 2016-03-01 | The Board Of Trustees Of The Leland Stanford Junior University | Screening test drugs to identify their effects on cell membrane voltage-gated ion channel |
| US9101690B2 (en) | 2005-07-22 | 2015-08-11 | The Board Of Trustees Of The Leland Stanford Junior University | Light-activated cation channel and uses thereof |
| US8906360B2 (en) | 2005-07-22 | 2014-12-09 | The Board Of Trustees Of The Leland Stanford Junior University | Light-activated cation channel and uses thereof |
| US8926959B2 (en) | 2005-07-22 | 2015-01-06 | The Board Of Trustees Of The Leland Stanford Junior University | System for optical stimulation of target cells |
| US9360472B2 (en) | 2005-07-22 | 2016-06-07 | The Board Of Trustees Of The Leland Stanford Junior University | Cell line, system and method for optical-based screening of ion-channel modulators |
| US10036758B2 (en) | 2005-07-22 | 2018-07-31 | The Board Of Trustees Of The Leland Stanford Junior University | Delivery of a light-activated cation channel into the brain of a subject |
| US10046174B2 (en) | 2005-07-22 | 2018-08-14 | The Board Of Trustees Of The Leland Stanford Junior University | System for electrically stimulating target neuronal cells of a living animal in vivo |
| US10569099B2 (en) | 2005-07-22 | 2020-02-25 | The Board Of Trustees Of The Leland Stanford Junior University | System for optical stimulation of target cells |
| US10052497B2 (en) | 2005-07-22 | 2018-08-21 | The Board Of Trustees Of The Leland Stanford Junior University | System for optical stimulation of target cells |
| US10369378B2 (en) | 2007-01-10 | 2019-08-06 | The Board Of Trustees Of The Leland Stanford Junior University | System for optical stimulation of target cells |
| US10105551B2 (en) | 2007-01-10 | 2018-10-23 | The Board Of Trustees Of The Leland Stanford Junior University | System for optical stimulation of target cells |
| US11007374B2 (en) | 2007-01-10 | 2021-05-18 | The Board Of Trustees Of The Leland Stanford Junior University | System for optical stimulation of target cells |
| US8864805B2 (en) | 2007-01-10 | 2014-10-21 | The Board Of Trustees Of The Leland Stanford Junior University | System for optical stimulation of target cells |
| US9693692B2 (en) | 2007-02-14 | 2017-07-04 | The Board Of Trustees Of The Leland Stanford Junior University | System, method and applications involving identification of biological circuits such as neurological characteristics |
| US9757587B2 (en) | 2007-03-01 | 2017-09-12 | The Board Of Trustees Of The Leland Stanford Junior University | Optogenetic method for generating an inhibitory current in a mammalian neuron |
| US9855442B2 (en) | 2007-03-01 | 2018-01-02 | The Board Of Trustees Of The Leland Stanford Junior University | Method for optically controlling a neuron with a mammalian codon optimized nucleotide sequence that encodes a variant opsin polypeptide derived from natromonas pharaonis (NpHR) |
| US9284353B2 (en) | 2007-03-01 | 2016-03-15 | The Board Of Trustees Of The Leland Stanford Junior University | Mammalian codon optimized nucleotide sequence that encodes a variant opsin polypeptide derived from Natromonas pharaonis (NpHR) |
| US10589123B2 (en) | 2007-03-01 | 2020-03-17 | The Board Of Trustees Of The Leland Stanford Junior University | Systems, methods and compositions for optical stimulation of target cells |
| US10035027B2 (en) | 2007-10-31 | 2018-07-31 | The Board Of Trustees Of The Leland Stanford Junior University | Device and method for ultrasonic neuromodulation via stereotactic frame based technique |
| US10426970B2 (en) | 2007-10-31 | 2019-10-01 | The Board Of Trustees Of The Leland Stanford Junior University | Implantable optical stimulators |
| US10434327B2 (en) | 2007-10-31 | 2019-10-08 | The Board Of Trustees Of The Leland Stanford Junior University | Implantable optical stimulators |
| US9878176B2 (en) | 2008-04-23 | 2018-01-30 | The Board Of Trustees Of The Leland Stanford Junior University | System utilizing Volvox carteri light-activated ion channel protein (VChR1) for optical stimulation of target cells |
| US10350430B2 (en) | 2008-04-23 | 2019-07-16 | The Board Of Trustees Of The Leland Stanford Junior University | System comprising a nucleotide sequence encoding a volvox carteri light-activated ion channel protein (VCHR1) |
| US8962589B2 (en) | 2008-05-29 | 2015-02-24 | The Board Of Trustees Of The Leland Stanford Junior University | Cell line, system and method for optical control of secondary messengers |
| US10711242B2 (en) | 2008-06-17 | 2020-07-14 | The Board Of Trustees Of The Leland Stanford Junior University | Apparatus and methods for controlling cellular development |
| US8956363B2 (en) | 2008-06-17 | 2015-02-17 | The Board Of Trustees Of The Leland Stanford Junior University | Methods, systems and devices for optical stimulation of target cells using an optical transmission element |
| US9084885B2 (en) | 2008-06-17 | 2015-07-21 | The Board Of Trustees Of The Leland Stanford Junior University | Methods, systems and devices for optical stimulation of target cells using an optical transmission element |
| US10583309B2 (en) | 2008-07-08 | 2020-03-10 | The Board Of Trustees Of The Leland Stanford Junior University | Materials and approaches for optical stimulation of the peripheral nervous system |
| US9101759B2 (en) | 2008-07-08 | 2015-08-11 | The Board Of Trustees Of The Leland Stanford Junior University | Materials and approaches for optical stimulation of the peripheral nervous system |
| US9308392B2 (en) | 2008-07-08 | 2016-04-12 | The Board Of Trustees Of The Leland Stanford Junior University | Materials and approaches for optical stimulation of the peripheral nervous system |
| US10071132B2 (en) | 2008-11-14 | 2018-09-11 | The Board Of Trustees Of The Leland Stanford Junior University | Optically-based stimulation of target cells and modifications thereto |
| US10064912B2 (en) | 2008-11-14 | 2018-09-04 | The Board Of Trustees Of The Leland Stanford Junior University | Optically-based stimulation of target cells and modifications thereto |
| US9309296B2 (en) | 2008-11-14 | 2016-04-12 | The Board Of Trustees Of The Leland Stanford Junior University | Optically-based stimulation of target cells and modifications thereto |
| US9079940B2 (en) | 2010-03-17 | 2015-07-14 | The Board Of Trustees Of The Leland Stanford Junior University | Light-sensitive ion-passing molecules |
| US9604073B2 (en) | 2010-03-17 | 2017-03-28 | The Board Of Trustees Of The Leland Stanford Junior University | Light-sensitive ion-passing molecules |
| US9249234B2 (en) | 2010-03-17 | 2016-02-02 | The Board Of Trustees Of The Leland Stanford Junior University | Light-sensitive ion-passing molecules |
| US9359449B2 (en) | 2010-03-17 | 2016-06-07 | The Board Of Trustees Of The Leland Stanford Junior University | Light-sensitive ion-passing molecules |
| AU2016202003B2 (en) * | 2010-11-05 | 2018-06-14 | The Board Of Trustees Of The Leland Stanford Junior University | Upconversion of light for use in optogenetic methods |
| EP2635346A4 (en) * | 2010-11-05 | 2014-04-09 | Univ Leland Stanford Junior | OPTOGENETIC CONTROL OF A BEHAVIOR IN CONNECTION WITH REWARD |
| US9850290B2 (en) | 2010-11-05 | 2017-12-26 | The Board Of Trustees Of The Leland Stanford Junior University | Light-activated chimeric opsins and methods of using the same |
| US8932562B2 (en) | 2010-11-05 | 2015-01-13 | The Board Of Trustees Of The Leland Stanford Junior University | Optically controlled CNS dysfunction |
| US10196431B2 (en) | 2010-11-05 | 2019-02-05 | The Board Of Trustees Of The Leland Stanford Junior University | Light-activated chimeric opsins and methods of using the same |
| EP2635341A4 (en) * | 2010-11-05 | 2016-05-25 | Univ Leland Stanford Junior | UPGRADING LIGHT FOR USE IN OPTOGENETIC PROCESSES |
| US9968652B2 (en) | 2010-11-05 | 2018-05-15 | The Board Of Trustees Of The Leland Stanford Junior University | Optically-controlled CNS dysfunction |
| US10252076B2 (en) | 2010-11-05 | 2019-04-09 | The Board Of Trustees Of The Leland Stanford Junior University | Upconversion of light for use in optogenetic methods |
| US9992981B2 (en) | 2010-11-05 | 2018-06-12 | The Board Of Trustees Of The Leland Stanford Junior University | Optogenetic control of reward-related behaviors |
| US10086012B2 (en) | 2010-11-05 | 2018-10-02 | The Board Of Trustees Of The Leland Stanford Junior University | Control and characterization of memory function |
| US9522288B2 (en) | 2010-11-05 | 2016-12-20 | The Board Of Trustees Of The Leland Stanford Junior University | Upconversion of light for use in optogenetic methods |
| JP2013545458A (ja) * | 2010-11-05 | 2013-12-26 | ザ ボード オブ トラスティーズ オブ ザ レランド スタンフォード ジュニア ユニバーシティー | 報酬関連行動の光遺伝学的制御 |
| US9615789B2 (en) | 2010-11-22 | 2017-04-11 | The Board Of Trustees Of The Leland Stanford Junior University | Optogenetic magnetic resonance imaging |
| US10018695B2 (en) | 2010-11-22 | 2018-07-10 | The Board Of Trustees Of The Leland Stanford Junior University | Optogenetic magnetic resonance imaging |
| US10914803B2 (en) | 2010-11-22 | 2021-02-09 | The Board Of Trustees Of The Leland Stanford Junior University | Optogenetic magnetic resonance imaging |
| US8834546B2 (en) | 2010-11-22 | 2014-09-16 | The Board Of Trustees Of The Leland Stanford Junior University | Optogenetic magnetic resonance imaging |
| US10371776B2 (en) | 2010-11-22 | 2019-08-06 | The Board Of Trustees Of The Leland Stanford Junior University | Optogenetic magnetic resonance imaging |
| US9700736B2 (en) | 2011-07-25 | 2017-07-11 | Neuronexus Technologies, Inc. | Neuromodulation transfection system with active fluid delivery |
| US10221422B2 (en) | 2011-11-18 | 2019-03-05 | Board Of Regents, The University Of Texas System | Blue light-inducible system for gene expression |
| US9506073B2 (en) | 2011-11-18 | 2016-11-29 | Board Of Regents, The University Of Texas System | Blue-light inducible system for gene expression |
| US10538560B2 (en) | 2011-12-16 | 2020-01-21 | The Board Of Trustees Of The Leland Stanford Junior University | Opsin polypeptides and methods of use thereof |
| US9840541B2 (en) | 2011-12-16 | 2017-12-12 | The Board Of Trustees Of The Leland Stanford Junior University | Opsin polypeptides and methods of use thereof |
| US10087223B2 (en) | 2011-12-16 | 2018-10-02 | The Board Of Trustees Of The Leland Stanford Junior University | Opsin polypeptides and methods of use thereof |
| WO2013090356A3 (en) * | 2011-12-16 | 2013-10-03 | The Board Of Trustees Of The Leland Stanford Junior University | Opsin polypeptides and methods of use thereof |
| AU2012352429B2 (en) * | 2011-12-16 | 2018-07-19 | The Board Of Trustees Of The Leland Stanford Junior University | Opsin polypeptides and methods of use thereof |
| CN104093833B (zh) * | 2011-12-16 | 2017-11-07 | 斯坦福大学托管董事会 | 视蛋白多肽及其使用方法 |
| US9969783B2 (en) | 2011-12-16 | 2018-05-15 | The Board Of Trustees Of The Leland Stanford Junior University | Opsin polypeptides and methods of use thereof |
| EP2791333A4 (en) * | 2011-12-16 | 2015-10-21 | Univ Leland Stanford Junior | OPSINE POLYPEPTIDES AND METHODS OF USE |
| CN107936097A (zh) * | 2011-12-16 | 2018-04-20 | 斯坦福大学托管董事会 | 视蛋白多肽及其使用方法 |
| JP2015502364A (ja) * | 2011-12-16 | 2015-01-22 | ザ ボード オブ トラスティーズ オブ ザ レランド スタンフォード ジュニア ユニバーシティ | オプシンポリペプチドおよびその使用法 |
| CN104093833A (zh) * | 2011-12-16 | 2014-10-08 | 斯坦福大学托管董事会 | 视蛋白多肽及其使用方法 |
| EP3524676A1 (en) * | 2011-12-16 | 2019-08-14 | The Board of Trustees of The Leland Stanford Junior University | Opsin polypeptides and methods of use thereof |
| CN104363961B (zh) * | 2012-02-21 | 2017-10-03 | 斯坦福大学托管董事会 | 用于治疗盆底神经源性病症的组合物和方法 |
| WO2013126521A1 (en) * | 2012-02-21 | 2013-08-29 | The Board Of Trustees Of The Leland Stanford Junior University | Compositions and methods for treating neurogenic disorders of the pelvic floor |
| AU2013222443B2 (en) * | 2012-02-21 | 2017-12-14 | Circuit Therapeutics, Inc. | Compositions and methods for treating neurogenic disorders of the pelvic floor |
| CN104363961A (zh) * | 2012-02-21 | 2015-02-18 | 斯坦福大学托管董事会 | 用于治疗盆底神经源性病症的组合物和方法 |
| US11103723B2 (en) | 2012-02-21 | 2021-08-31 | The Board Of Trustees Of The Leland Stanford Junior University | Methods for treating neurogenic disorders of the pelvic floor |
| US20140024701A1 (en) * | 2012-02-21 | 2014-01-23 | Circuit Therapeutics, Inc. | Compositions and Methods for Treating Neurogenic Disorders of the Pelvic Floor |
| US10406227B2 (en) | 2012-12-19 | 2019-09-10 | California Institute Of Technology | Photoactivated molecules for light-induced modulation of the activity of electrically excitable cells and methods of using same |
| WO2014100283A1 (en) * | 2012-12-19 | 2014-06-26 | University Of Southern California | Photoactivated molecules for light-induced modulation of the activity of electrically excitable cells and methods of using same |
| US11672466B2 (en) | 2013-01-31 | 2023-06-13 | The Regents Of The University Of California | System and method for modeling brain dynamics in normal and diseased states |
| EP2950715A4 (en) * | 2013-01-31 | 2016-11-30 | Univ California | SYSTEM AND METHOD FOR MODELING BRAIN DYNAMICS IN NORMAL AND ILLNESS STATES |
| US10729354B2 (en) | 2013-01-31 | 2020-08-04 | The Regents Of The University Of California | System and method for modeling brain dynamics in normal and diseased states |
| US9636380B2 (en) | 2013-03-15 | 2017-05-02 | The Board Of Trustees Of The Leland Stanford Junior University | Optogenetic control of inputs to the ventral tegmental area |
| US10974064B2 (en) | 2013-03-15 | 2021-04-13 | The Board Of Trustees Of The Leland Stanford Junior University | Optogenetic control of behavioral state |
| US10220092B2 (en) | 2013-04-29 | 2019-03-05 | The Board Of Trustees Of The Leland Stanford Junior University | Devices, systems and methods for optogenetic modulation of action potentials in target cells |
| US10307609B2 (en) | 2013-08-14 | 2019-06-04 | The Board Of Trustees Of The Leland Stanford Junior University | Compositions and methods for controlling pain |
| US20150283398A1 (en) * | 2014-03-27 | 2015-10-08 | Circuit Therapeutics, Inc. | System and method for therapeutic management of cough |
| US10568516B2 (en) | 2015-06-22 | 2020-02-25 | The Board Of Trustees Of The Leland Stanford Junior University | Methods and devices for imaging and/or optogenetic control of light-responsive neurons |
| US11684284B2 (en) | 2015-07-21 | 2023-06-27 | The Board Of Trustees Of The Leland Stanford Junior University | Carbon fiber optrodes for magnetic resonance imaging compatible optogenetics |
| US10232043B2 (en) | 2015-08-19 | 2019-03-19 | California Institute Of Technology | Photoactivated molecules for light-induced modulation of the activity of electrically excitable cells and methods of using the same |
| US11653851B2 (en) | 2015-12-09 | 2023-05-23 | The Board Of Trustees Of The Leland Stanford Junior University | Methods for functional brain circuit analysis |
| US11294165B2 (en) | 2017-03-30 | 2022-04-05 | The Board Of Trustees Of The Leland Stanford Junior University | Modular, electro-optical device for increasing the imaging field of view using time-sequential capture |
| US11921271B2 (en) | 2020-05-22 | 2024-03-05 | The Board Of Trustees Of The Leland Stanford Junior Univeristy | Multifocal macroscope for large field of view imaging of dynamic specimens |
Also Published As
| Publication number | Publication date |
|---|---|
| US9359449B2 (en) | 2016-06-07 |
| EP2547762A2 (en) | 2013-01-23 |
| US9079940B2 (en) | 2015-07-14 |
| US9249234B2 (en) | 2016-02-02 |
| JP6235618B2 (ja) | 2017-11-22 |
| ES2676274T3 (es) | 2018-07-18 |
| ES2676274T9 (es) | 2018-09-13 |
| US20130090454A1 (en) | 2013-04-11 |
| JP2013524780A (ja) | 2013-06-20 |
| SG183899A1 (en) | 2012-10-30 |
| EP3399024A1 (en) | 2018-11-07 |
| AU2011227131B2 (en) | 2014-11-13 |
| CN102844427A (zh) | 2012-12-26 |
| JP5866332B2 (ja) | 2016-02-17 |
| CA2791094A1 (en) | 2011-09-22 |
| WO2011116238A3 (en) | 2011-11-10 |
| EP2547762B1 (en) | 2018-04-25 |
| US20130089503A1 (en) | 2013-04-11 |
| JP2016144443A (ja) | 2016-08-12 |
| CN106011073A (zh) | 2016-10-12 |
| US20170198017A1 (en) | 2017-07-13 |
| IL261389A (en) | 2018-10-31 |
| US9604073B2 (en) | 2017-03-28 |
| AU2011227131A1 (en) | 2012-09-06 |
| SG10201505162QA (en) | 2015-08-28 |
| IL221410A0 (en) | 2012-10-31 |
| EP2547762A4 (en) | 2013-09-04 |
| MY175954A (en) | 2020-07-16 |
| CN102844427B (zh) | 2016-07-06 |
| US20130019325A1 (en) | 2013-01-17 |
| US20160287895A1 (en) | 2016-10-06 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US9604073B2 (en) | Light-sensitive ion-passing molecules | |
| US10538560B2 (en) | Opsin polypeptides and methods of use thereof | |
| CA2722278C (en) | Systems, methods and compositions for optical stimulation of target cells | |
| AU2015200616B2 (en) | Light-sensitive ion-passing molecules |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 201180014303.3 Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 11757027 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 221410 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2011227131 Country of ref document: AU |
|
| ENP | Entry into the national phase |
Ref document number: 2791094 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2013500217 Country of ref document: JP |
|
| ENP | Entry into the national phase |
Ref document number: 2011227131 Country of ref document: AU Date of ref document: 20110317 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2011757027 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 13577565 Country of ref document: US |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |