WO2011107480A1 - Antigen binding proteins specific for serum amyloid p component - Google Patents

Antigen binding proteins specific for serum amyloid p component Download PDF

Info

Publication number
WO2011107480A1
WO2011107480A1 PCT/EP2011/053038 EP2011053038W WO2011107480A1 WO 2011107480 A1 WO2011107480 A1 WO 2011107480A1 EP 2011053038 W EP2011053038 W EP 2011053038W WO 2011107480 A1 WO2011107480 A1 WO 2011107480A1
Authority
WO
WIPO (PCT)
Prior art keywords
sap
seq
antigen binding
binding protein
substituted
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2011/053038
Other languages
English (en)
French (fr)
Inventor
Tejinder Kaur Bhinder
Susannah Karen Ford
Volker Germaschewski
Alan Peter Lewis
Mark Brian Pepys
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Glaxo Group Ltd
Original Assignee
Glaxo Group Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=43881068&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2011107480(A1) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority to UAA201210015A priority Critical patent/UA108227C2/uk
Priority to ES11705617.6T priority patent/ES2593454T3/es
Priority to HRP20161096TT priority patent/HRP20161096T1/hr
Priority to EP11705617.6A priority patent/EP2542261B1/en
Priority to MEP-2016-161A priority patent/ME02491B/me
Priority to PL15178026T priority patent/PL3025729T3/pl
Priority to SI201130964A priority patent/SI2542261T1/sl
Priority to CA2789557A priority patent/CA2789557A1/en
Priority to EP15178026.9A priority patent/EP3025729B1/en
Priority to RS20160741A priority patent/RS55133B1/sr
Priority to CN201180017717.1A priority patent/CN102858371B/zh
Priority to LTEP11705617.6T priority patent/LT2542261T/lt
Priority to KR1020127025884A priority patent/KR101817265B1/ko
Priority to PH1/2012/501743A priority patent/PH12012501743A1/en
Priority to EA201290671A priority patent/EA026375B1/ru
Application filed by Glaxo Group Ltd filed Critical Glaxo Group Ltd
Priority to JP2012555403A priority patent/JP5922592B2/ja
Priority to NZ601763A priority patent/NZ601763A/en
Priority to BR112012021926-0A priority patent/BR112012021926A2/pt
Priority to AU2011223048A priority patent/AU2011223048C1/en
Priority to DK11705617.6T priority patent/DK2542261T3/en
Priority to MX2012010129A priority patent/MX340350B/es
Priority to HK13101057.3A priority patent/HK1173959B/en
Priority to SG2012060216A priority patent/SG183316A1/en
Priority to MA35252A priority patent/MA34135B1/fr
Publication of WO2011107480A1 publication Critical patent/WO2011107480A1/en
Priority to IL221418A priority patent/IL221418A/en
Priority to ZA2012/06529A priority patent/ZA201206529B/en
Anticipated expiration legal-status Critical
Priority to CY20161100950T priority patent/CY1118046T1/el
Priority to SM201600337T priority patent/SMT201600337B/it
Priority to IL251031A priority patent/IL251031A/en
Priority to CY181101126T priority patent/CY1120803T1/el
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/18Growth factors; Growth regulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/475Growth factors; Growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/22Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/24Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/54F(ab')2
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • the present invention relates to antigen binding proteins, such as antibodies, which bind to serum amyloid P component (SAP), polynucleotides encoding such antigen binding proteins, pharmaceutical compositions comprising said antigen binding proteins and methods of manufacture.
  • SAP serum amyloid P component
  • the present invention also concerns the use of such antigen binding proteins in the treatment or prophylaxis of diseases associated with amyloid deposition including systemic amyloidosis, local amyloidosis, Alzheimer's disease, and type 2 diabetes.
  • Amyloidosis is a serious and usually fatal disease caused by the extracellular accumulation in the tissues of abnormal insoluble protein fibres known as amyloid fibrils. These are derived from more than 20 different proteins in different forms of the disease but all amyloid fibrils share a common cross- ⁇ core structure and all are derived by misfolding of normally soluble precursor proteins (Pepys, M.B. (2006) Annu. Rev. Med., 57: 223-241).
  • a normal non- fibrillar plasma protein, serum amyloid P component (SAP) is also always present in amyloid deposits by virtue of its avid specific calcium dependent binding to all types of amyloid fibrils (Pepys et al. (1979) Clin. Exp. I mmunol., 38: 284-293; Pepys et al. (1997) Amyloid : I nt. J. Exp. Clin. Invest., 4: 274-295).
  • Human SAP is a constitutive protein in the plasma, at a concentration of around 20-40 mg/l (Nelson et al. (1991) Clin. Chim. Acta, 200:191-200) and with a total of about 50-100 mg of SAP in the combined plasma and extravascular compartments both of normal individuals and patients with diseases other than amyloidosis (Hawkins et al. (1990) J. Clin. Invest., 86: 1862-1869). In patients with amyloidosis, SAP is also specifically concentrated in the amyloid deposits and in an individual with extensive systemic amyloidosis there may be as much as 20,000 mg of SAP in the amyloid (Pepys et al.
  • SAP is also a normal tissue matrix constituent associated with elastic fibres and the glomerular basement membrane although its function there is not known.
  • amyloidosis the extracellular amyloid deposits cause disease by progressive accumulation until they damage the structure and thus the function of whatever tissue they occupy (Pepys, M.B. (2006) Annu. Rev. Med., 57: 223-241).
  • amyloidosis can involve any organ, is usually fatal and causes ⁇ 1 per thousand deaths in developed countries.
  • Localised amyloid confined to a single anatomical location or tissue type, can also be very serious, for example cerebral amyloid angiopathy is an important cause of haemorrhagic stroke.
  • the clinical presentations of amyloidosis are extremely diverse and the diagnosis is rarely made before significant organ damage is present.
  • amyloid fibril proteins are responsible for different forms of amyloidosis, but treatments that substantially reduce the abundance of the respective amyloid fibril precursor protein do halt amyloid accumulation and the deposits may regress.
  • effective measures are not always available and, when they do exist, are toxic or hazardous and slow to act (Pepys, M.B (2006) Annu. Rev. Med., 57: 223-241). There is therefore a major unmet medical need for therapy which safely promotes the clearance of established amyloid deposits.
  • amyloid deposits are always present, most importantly Alzheimer's disease (AD) and type 2 diabetes mellitus, in which the contribution of amyloid deposition to the pathogenesis of disease, specifically loss of cognitive and pancreatic islet function, respectively, is not known (Pepys, M.B. (2006) Annu. Rev. Med., 57: 223-241).
  • AD Alzheimer's disease
  • type 2 diabetes mellitus in which the contribution of amyloid deposition to the pathogenesis of disease, specifically loss of cognitive and pancreatic islet function, respectively, is not known
  • amyloid deposits anywhere else in the body are demonstrably pathogenic and it is likely that the cerebral deposits of AD and the islet amyloid deposits of type 2 diabetes are also harmful. Since treatment which clears amyloid deposits in systemic amyloidosis will certainly be therapeutic (Pepys, M.B. (2006) Annu. Rev. Med., 57: 223-241), removal of the amyloid deposits in AD and type 2 diabetes should also be clinically beneficial.
  • SAP binding of SAP stabilises amyloid fibrils, protects them from proteolysis in vitro (Tennent et al., (1995) PNAS, 92: 4299-4303), can enhance amyloid fibrillogenesis in vitro (Myers et al., (2006), Biochemistry, 45: 2311-2321) and contributes to pathogenesis of systemic amyloidosis in vivo (Botto et al., (1997) Nature Med., 3: 855-859). Coupled with its universal presence in all amyloid deposits, these properties of SAP make it an attractive therapeutic target.
  • EP 0915088 discloses D-proline derivative compounds that are competitive inhibitors of binding of SAP to amyloid fibrils, as well as methods for their manufacture.
  • a preferred compound disclosed in EP 0915088 is (R)-l-[6-[(R)-2-Carboxy- pyrrolidin-l-yl]-6-oxo oxohexanoyl] pyrrolidine-2-carboxylic acid (CPHPC).
  • antibodies particularly humanised or human antibodies, which specifically target SAP and provide improved therapeutic efficacy in patients, particularly human patients, with diseases associated with amyloid deposition in order to preserve organ function and prolong life.
  • the present invention provides, in a first aspect, an antigen binding protein which specifically binds to SAP and competes for binding to SAP with a reference antibody which comprises a heavy chain variable region sequence of SEQ ID NO:7, and a light chain variable region sequence of SEQ ID NO:9.
  • a reference antibody which comprises a heavy chain variable region sequence of SEQ ID NO:7, and a light chain variable region sequence of SEQ ID NO:9.
  • an antigen binding protein which binds to SAP and comprises CDRH3 set forth in SEQ ID NO: 3 or a functional variant of CDRH3.
  • an antigen binding protein which specifically binds to SAP wherein the antigen binding protein is a chimeric or a humanised antibody comprising the corresponding CDRH3 of the variable domain sequence of SEQ ID NO:7, or a functional variant of CDRH3.
  • an antigen binding protein which specifically binds to SAP and comprises a binding unit H3 comprising Kabat residues 95-101 of SEQ ID NO:7, or a functional variant of binding unit H3.
  • an antigen binding protein which specifically binds to SAP and comprises a heavy chain variable region selected from SEQ ID NO:27-31; and/or a light chain variable region selected from SEQ ID NO:34-36; or a variant heavy chain variable region or light chain variable region with 75% or greater sequence identity.
  • an antigen binding protein which specifically binds to SAP and comprises a heavy chain of SEQ ID NO:62; and/or a light chain of SEQ ID NO:64; or a variant heavy chain or light chain with 75% or greater sequence identity.
  • the present invention also provides a nucleic acid molecule encoding an antigen binding protein of the invention, expression vectors comprising the same, and host cells capable of producing antigen binding proteins of the invention.
  • a pharmaceutical composition comprising an antigen binding protein as defined herein.
  • the present invention also provides methods of preventing and/or treating a subject susceptible to or afflicted with a disease associated with amyloid deposition, which method comprises the step of administering a prophylactically or therapeutically effective amount of an antigen binding protein to said subject.
  • the use of an antigen binding protein as defined herein for preventing and/or treating a subject susceptible to or afflicted with a disease associated with amyloid deposition is provided.
  • the use of an antigen binding protein as defined herein for the manufacture of a medicament for preventing and/or treating a subject susceptible to or afflicted with a disease associated with amyloid deposition is also provided.
  • Figure 1 shows the binding curves for murine antibodies SAP-E and SAP-K at a 1 ⁇ g/mL coating concentration of human SAP.
  • Figure 2 shows the binding curves for murine antibodies SAP-E and SAP-K at a 5 ⁇ g/mL coating concentration of human SAP.
  • Figure 3 shows the binding curves for chimeric antibodies cSAP-E and cSAP-K.
  • the profile of the curves for the chimeric antibodies is the same as that of the equivalent hybridomas.
  • Figure 4 shows the binding curves for SAP-K H0L0, SAP-K H1L0, SAP-K H2L0 and SAP-K H3L0 compared to the SAP-K chimera and the SAP-E H1L1 compared to the SAP-E chimera.
  • An irrelevant human IgGl kappa antibody was also tested as a negative control.
  • Figure 5 shows purified SAP-K and SAP-E murine monoclonal antibodies in a competition ELISA with the SAP-E chimera.
  • Figure 6 shows purified SAP-K and SAP-E murine monoclonal antibodies in a competition ELISA with the SAP-K chimera.
  • Figure 7 shows an immunoradiometric assay for binding of monoclonal mouse antibodies SAP-E and SAP-K to human SAP captured by immobilised sheep polyclonal anti-human SAP antibody.
  • Figure 8 shows epitope mapping for monoclonal anti-human SAP antibody SAP-E.
  • Figure 9 shows the location of the epitopes on human SAP recognised by SAP-K (A, highlighted in black) and SAP-E (B, shown in white).
  • Figure 10 shows C3 activation by humanised monoclonal anti-human SAP antibodies in whole human serum.
  • Figure 11 shows C3 activation by low dose humanised monoclonal anti-human SAP antibodies in whole human serum.
  • Figure 12 shows C3 activation by humanised monoclonal anti-human SAP antibodies in whole mouse serum supplemented with pure human SAP.
  • the present invention provides an antigen binding protein which binds to serum amyloid P component (SAP), for example human SAP, as its specific antigen (i.e. a SAP binding protein).
  • SAP serum amyloid P component
  • the antigen binding protein activates the body's potent mechanisms for clearance of abnormal debris from tissues.
  • the antigen binding protein may be an antibody, for example a monoclonal antibody.
  • An antigen binding protein of the invention is not a murine antibody.
  • an antigen binding protein of the invention is not a murine antigen binding protein.
  • an antigen binding protein of the invention is a chimeric, humanised or human antigen binding protein.
  • Spentameric plasma glycoprotein of the pentraxin family refers to a homopentameric plasma glycoprotein of the pentraxin family. Each molecule is composed of 5 identical protomers, each with a flattened ⁇ -jelly roll fold and single alpha helix, non-covalently associated in a disc-like ring with cyclic pentameric symmetry (Hutchinson et al., (2000) Mol. Med., 6: 482-493); Pepys et al., (2002) Nature, 417: 254-259).
  • SAP as used herein also includes the individual subunit encoded by the human gene APCS (chromosome: 1; Location: Iq21-q23) or homologous genes in other organisms, for example the human SAP polypeptide subunit having the sequence as set forth in SEQ I D NO:43 as well as the native pentameric form of SAP, and any fragments and variants of SAP that retain the biological activity of binding to amyloid fibrils in vivo.
  • the SAP binding protein of the invention can bind to any one or any combination of the above described different forms of SAP. I n a particular embodiment, the antigen binding protein of the invention binds human SAP.
  • the SAP binding protein of the invention can bind to SAP when the SAP is bound to amyloid fibrils of any type and in any extracellular location within the body.
  • the antigen binding protein of the invention may also bind to native unbound SAP.
  • SAP-binding proteins of the invention in therapeutic methods is that the concentration of SAP in the circulation must be reduced by at least 90% below its normal value before administration of the SAP-binding protein. Specifically, this can be achieved by compounds that decrease the amount of circulating SAP and, in particular, compounds that result in the depletion of circulating SAP, defined here as "SAP depleting compounds". Such compounds are ligands bound by SAP and are competitive inhibitors of the binding of SAP to amyloid fibrils, such as D-proline derivatives and glycerol cyclic pyruvate derivatives.
  • D-proline derivatives are disclosed in EP 0915088, which is incorporated herein by reference in its entirety, and the term "D-proline derivatives" includes prodrugs, such as those disclosed in WO 03/051836, which is also incorporated herein by reference in its entirety. D-prolines of the following formula are contemplated:
  • R 1 is hydrogen or halogen
  • X' is -(CH 2 )n-; -(CH 2 ) n CH(R 2 )-; -(CH 2 ) n OCH 2 -; -NHCH 2 -;
  • -CH C(R 2 )-; CH(OH)CH 2 ; or thiazol-2,5-diyl; -0-;
  • R 2 is lower alkyl, lower alkoxy or benzyl
  • n 0-3 and wherein
  • alkyl or lower alkyl is Ci_ 6 alkyl; alkoxy or lower alkoxy is Ci_ 6 alkoxy; cycloalkyl is C 3 _ 6 cyclocalkyl; halogen is F, CI or Br; and the location where the dotted line appears in the formula is either a single or double bond ⁇ or a pharmaceutically acceptable salt or mono- or diester thereof.
  • D-prolines of formula l-A above can be written as Ligand - linker - Ligand, wherein the X-Y-X' moiety of formal l-A forms the linker.
  • the linker ( ⁇ - ⁇ - ⁇ ') can be from 4 to 20 linear carbon atoms in length, including from 4-15 linear carbon atoms, 5-10 linear carbon atoms, and 6-8 linear carbon atoms in length.
  • the linker can be a straight or branched chain, or can optionally form one or more ring structures, with the proviso that at least 4 linear or straight-chain carbon atoms are present in the linker.
  • At least one of the linear or straight- chain C atoms can be optionally substituted by at least one hetero atom selected from N, O, or S, advantageously O or S, advantageously O.
  • an "optionally substituted linker” can have one or more substitutions that lead to branching and/or one or more substitutions of carbon atom(s) of the linear or straight chain carbon atoms of the linker, e.g. the linker can be an ether or a substituted ether.
  • CPHPC is a specific D-proline contemplated by the invention.
  • CPHPC is to be administered to a human patient.
  • Gylcerol cyclic pyruvate derivatives are disclosed in WO 2004/099173, which is incorporated herein by reference in its entirety.
  • antigen binding protein refers to antibodies, antibody fragments and other protein constructs, such as domains, which are capable of binding to SAP.
  • antibody is used herein in the broadest sense to refer to molecules with an immunoglobulin-like domain and includes monoclonal, recombinant, polyclonal, chimeric, humanised, bispecific and heteroconjugate antibodies; a single variable domain, a domain antibody, antigen binding fragments, immunologically effective fragments, single chain Fv, diabodies, TandabsTM, etc. (for a summary of alternative "antibody” formats see Holliger and Hudson, Nature Biotechnology, 2005, Vol 23, No. 9, 1126-1136).
  • single variable domain refers to an antigen binding protein variable domain (for example, VH, VHH, VL) that specifically binds an antigen or epitope independently of a different variable region or domain.
  • a “domain antibody” or “dAb” may be considered the same as a “single variable domain” which is capable of binding to an antigen.
  • a single variable domain may be a human antibody variable domain, but also includes single antibody variable domains from other species such as rodent (for example, as disclosed in WO 00/29004), nurse shark and Camelid VHH dAbs.
  • Camelid VHH are immunoglobulin single variable domain polypeptides that are derived from species including camel, llama, alpaca, dromedary, and guanaco, which produce heavy chain antibodies naturally devoid of light chains.
  • Such VHH domains may be humanised according to standard techniques available in the art, and such domains are considered to be "domain antibodies”.
  • VH includes camelid VHH domains.
  • domain refers to a folded protein structure which has tertiary structure independent of the rest of the protein. Generally, domains are responsible for discrete functional properties of proteins, and in many cases may be added, removed or transferred to other proteins without loss of function of the remainder of the protein and/or of the domain.
  • single variable domain is a folded polypeptide domain comprising sequences characteristic of antibody variable domains.
  • variable domains and modified variable domains, for example, in which one or more loops have been replaced by sequences which are not characteristic of antibody variable domains, or antibody variable domains which have been truncated or comprise N- or C-terminal extensions, as well as folded fragments of variable domains which retain at least the binding activity and specificity of the full-length domain.
  • a domain can bind an antigen or epitope independently of a different variable region or domain.
  • An antigen binding fragment may be provided by means of arrangement of one or more CDRs on non-antibody protein scaffolds such as a domain.
  • the domain may be a domain antibody or may be a domain which is a derivative of a scaffold selected from the group consisting of CTLA-4, lipocalin, SpA, an Affibody, an avimer, GroEI, transferrin, GroES and fibronectin/adnectin, which has been subjected to protein engineering in order to obtain binding to an antigen, such as SAP, other than the natural ligand.
  • a scaffold selected from the group consisting of CTLA-4, lipocalin, SpA, an Affibody, an avimer, GroEI, transferrin, GroES and fibronectin/adnectin, which has been subjected to protein engineering in order to obtain binding to an antigen, such as SAP, other than the natural ligand.
  • An antigen binding fragment or an immunologically effective fragment may comprise partial heavy or light chain variable sequences. Fragments are at least 5, 6, 7, 8, 9 or 10 amino acids in length. Alternatively the fragments are at least 15, at least 20, at least 50, at least 75, or at least 100 amino acids in length.
  • the term "specifically binds" as used throughout the present specification in relation to antigen binding proteins means that the antigen binding protein binds to SAP with no or insignificant binding to any other proteins, including closely related molecules such as C-reactive protein (CRP) which, in humans, shares 55% of strict residue for residue amino acid sequence homology and has essentially the same protein fold.
  • CRP C-reactive protein
  • the equilibrium dissociation constant (KD) of the antigen binding protein-SAP interaction may be 1 mM or less, 100 nM or less, 10 nM or less, 2 nM or less or 1 nM or less. Alternatively the KD may be between 5 and 10 nM; or between 1 and 2 nM. The KD may be between 1 pM and 500 pM; or between 500 pM and 1 nM.
  • the binding affinity may be measured by BIAcoreTM, for example by antigen capture with SAP coupled onto a carboxymethydextran chip by primary amine coupling and antibody capture onto this surface.
  • the binding affinity can be measured by BIAcoreTM by binding of anti-SAP antibodies to human SAP captured by O-phosphoethanolamine immobilised on a CM5 chip.
  • the BIAcoreTM methods described in Example 8 may be used to measure binding affinity.
  • the dissociation rate constant (kd) may be lxlO "3 s 1 or less, lxlO "4 s 1 or less, or 1x10 " 5 s 1 or less.
  • the kd may be between lxlO "5 s 1 and lxlO "4 s "1 ; or between lxlO "4 s 1 and lxlO "3 s "1 .
  • a small kd may result in a slow dissociation of the antigen binding protein-ligand complex and improved clearance of complexes of SAP bound to amyloid.
  • the term "derived” is intended to define not only the source in the sense of it being the physical origin for the material but also to define material which is structurally identical to the material but which does not originate from the reference source.
  • “residues found in the donor antibody” need not necessarily have been purified from the donor antibody.
  • isolated it is intended that the molecule, such as an antigen binding protein, is removed from the environment in which it may be found in nature. For example, the molecule may be purified away from substances with which it would normally exist in nature. For example, the mass of the molecule in a sample may be 95% of the total mass.
  • a “chimeric antibody” refers to a type of engineered antibody which contains a naturally- occurring variable region (light chain and heavy chains) derived from a donor antibody in association with light and heavy chain constant regions derived from an acceptor antibody.
  • a “humanised antibody” refers to a type of engineered antibody having its CDRs derived from a non-human donor immunoglobulin, the remaining immunoglobulin-derived parts of the molecule being derived from one or more human immunoglobulin(s).
  • framework support residues may be altered to preserve binding affinity (see, e.g., Queen et al. Proc. Natl Acad Sci USA, 86:10029-10032 (1989), Hodgson et al. Bio/Technology, 9:421 (1991)).
  • a suitable human acceptor antibody may be one selected from a conventional database, e.g., the KABAT ® database, Los Alamos database, and Swiss Protein database, by homology to the nucleotide and amino acid sequences of the donor antibody.
  • a human antibody characterized by a homology to the framework regions of the donor antibody (on an amino acid basis) may be suitable to provide a heavy chain constant region and/or a heavy chain variable framework region for insertion of the donor CDRs.
  • a suitable acceptor antibody capable of donating light chain constant or variable framework regions may be selected in a similar manner. It should be noted that the acceptor antibody heavy and light chains are not required to originate from the same acceptor antibody.
  • donor antibody refers to an antibody which contributes the amino acid sequences of its variable regions, CDRs, or other functional fragments or analogs thereof to a first immunoglobulin partner.
  • the donor therefore provides the altered immunoglobulin coding region and resulting expressed altered antibody with the antigenic specificity and neutralising activity characteristic of the donor antibody.
  • acceptor antibody refers to an antibody which is heterologous to the donor antibody, which contributes all (or any portion) of the amino acid sequences encoding its heavy and/or light chain framework regions and/or its heavy and/or light chain constant regions to the first immunoglobulin partner.
  • a human antibody may be the acceptor antibody.
  • human antibody refers to an antibody derived from human immunoglobulin gene sequences. These fully human antibodies provide an alternative to re-engineered, or de-immunized, rodent monoclonal antibodies (e.g. humanised antibodies) as a source of low immunogenicity therapeutic antibodies and they are normally generated using either phage display or transgenic mouse platforms.
  • an antibody of the invention is a human antibody.
  • VH and VL are used herein to refer to the heavy chain variable region and light chain variable region respectively of an antigen binding protein.
  • CDRs are defined as the complementarity determining region amino acid sequences of an antigen binding protein. These are the hypervariable regions of immunoglobulin heavy and light chains. There are three heavy chain and three light chain CDRs (or CDR regions) in the variable portion of an immunoglobulin. Thus, “CDRs” as used herein refers to all three heavy chain CDRs, all three light chain CDRs, all heavy and light chain CDRs, or at least two CDRs.
  • Table 1 represents one definition using each numbering convention for each CDR or binding unit.
  • the Kabat numbering scheme is used in Table 1 to number the variable domain amino acid sequence. It should be noted that some of the CDR definitions may vary depending on the individual publication used.
  • the term "antigen binding site” refers to a site on an antigen binding protein which is capable of specifically binding to an antigen. This may be a single domain (for example, an epitope-binding domain), or single-chain Fv (ScFv) domains or it may be paired VH/VL domains as can be found on a standard antibody.
  • epitope refers to that portion of the antigen that makes contact with a particular binding domain of the antigen binding protein.
  • An epitope may be linear, comprising an essentially linear amino acid sequence from the antigen.
  • an epitope may be conformational or discontinuous.
  • a conformational epitope comprises amino acid residues which require an element of structural constraint. In the case of a conformational epitope, although the residues may be from different regions of the peptide chain, they may be in close proximity in the three dimensional structure of the antigen.
  • a conformational epitope may include residues from different peptide chains that may be in close proximity in the three dimensional structure of the antigen.
  • Such structurally neighbouring residues can be determined through computer modelling programs or via three-dimensional structures obtained through methods known in the art, such as X-ray crystallography.
  • a discontinuous epitope comprises amino acid residues that are separated by other sequences, i.e. not in a continuous sequence in the antigen's primary sequence.
  • the residues of a discontinuous epitope are near enough to each other to be bound by an antigen binding protein.
  • an antigen binding protein of the invention binds to an epitope within residues 140-158 of human SAP.
  • nucleotide and amino acid sequences For nucleotide and amino acid sequences, the term “identical” or “sequence identity” indicates the degree of identity between two nucleic acid or two amino acid sequences when optimally aligned and compared with appropriate insertions or deletions.
  • the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm, as described below.
  • the percent identity between two nucleotide sequences can be determined using the GAP program in the GCG software package, using a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80 and a length weight of 1, 2, 3, 4, 5, or 6.
  • the percent identity between two nucleotide or amino acid sequences can also be determined using the algorithm of E. Meyers and W. Miller (Comput. Appl. Biosci., 4:11-17 (1988)) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
  • the percent identity between two amino acid sequences can be determined using the Needleman and Wunsch (J. Mol. Biol.
  • a polynucleotide sequence may be identical to a reference polynucleotide sequence as described herein (see for example SEQ ID NO:8, 10, 18, 20, 45- 48, 51-61, 63, 65-73), that is be 100% identical, or it may include up to a certain integer number of nucleotide alterations as compared to the reference sequence, such as at least 50, 60, 70, 75, 80, 85, 90, 95, 96, 97, 98, or 99% identical.
  • Such alterations are selected from at least one nucleotide deletion, substitution, including transition and transversion, or insertion, and wherein said alterations may occur at the 5' or 3' terminal positions of the reference nucleotide sequence or anywhere between those terminal positions, interspersed either individually among the nucleotides in the reference sequence or in one or more contiguous groups within the reference sequence.
  • the number of nucleotide alterations is determined by multiplying the total number of nucleotides in the reference polynucleotide sequence as described herein (see for example SEQ ID NO:8, 10, 18, 20, 45-48, 51-61, 63, 65-73), by the numerical percent of the respective percent identity (divided by 100) and subtracting that product from said total number of nucleotides in the reference polynucleotide sequence as described herein (see for example SEQ ID NO:8, 10, 18, 20, 45- 48, 51-61, 63, 65-73), or:
  • n n is the number of nucleotide alterations
  • x n is the total number of nucleotides in the reference polynucleotide sequence as described herein (see for example SEQ ID NO:8, 10, 18, 20, 45-48, 51-61, 63, 65-73)
  • y is 0.50 for 50%, 0.60 for 60%, 0.70 for 70%, 0.75 for 75%, 0.80 for 80%, 0.85 for 85%, 0.90 for 90%, 0.95 for 95%, 0.98 for 98%, 0.99 for 99% or 1.00 for 100%
  • is the symbol for the multiplication operator, and wherein any non- integer product of x n and y is rounded down to the nearest integer prior to subtracting it from x n .
  • a polypeptide sequence may be identical to a polypeptide reference sequence as described herein (see for example SEQ ID NO:l-7, 9, 11-17, 19, 21-24, 27-31, 34-42, 62, 64, 74), that is be 100% identical, or it may include up to a certain integer number of amino acid alterations as compared to the reference sequence such that the % identity is less than 100%, such as at least 50, 60, 70, 75, 80, 85, 90, 95, 96, 97, 98, or 99% identical.
  • Such alterations are selected from the group consisting of at least one amino acid deletion, substitution, including conservative and non-conservative substitution, or insertion, and wherein said alterations may occur at the amino- or carboxy-terminal positions of the reference polypeptide sequence or anywhere between those terminal positions, interspersed either individually among the amino acids in the reference sequence or in one or more contiguous groups within the reference sequence.
  • the number of amino acid alterations for a given % identity is determined by multiplying the total number of amino acids in the polypeptide sequence encoded by the polypeptide reference sequence as described herein (see for example SEQ ID NO:l-7, 9, 11-17, 19, 21-24, 27-31, 34-42, 62, 64, 74) by the numerical percent of the respective percent identity (divided by 100) and then subtracting that product from said total number of amino acids in the polypeptide reference sequence as described herein (see for example SEQ ID NO:l-7, 9, 11-17, 19, 21-24, 27-31, 34-42, 62, 64, 74), or:
  • n a is the number of amino acid alterations
  • x a is the total number of amino acids in the reference polypeptide sequence as described herein (see for example SEQ ID NO:l-7, 9, 11-17, 19, 21-24, 27-31, 34-42, 62, 64, 74)
  • y is, 0.50 for 50%, 0.60 for 60%, 0.70 for 70%, 0.75 for 75%, 0.80 for 80%, 0.85 for 85%, 0.90 for 90%, 0.95 for 95%, 0.98 for 98%, 0.99 for 99%, or 1.00 for 100%
  • is the symbol for the multiplication operator, and wherein any non-integer product of x a and y is rounded down to the nearest integer prior to subtracting it from x a .
  • % identity may be determined across the length of the sequence.
  • peptide polypeptide
  • protein each refers to a molecule comprising two or more amino acid residues.
  • a peptide may be monomeric or polymeric.
  • the antigen binding protein may compete for binding to SAP with a reference antibody comprising a heavy chain variable region sequence of SEQ ID NO: 7, and a light chain variable region sequence of SEQ ID NO: 9.
  • the antigen binding protein may compete for binding to SAP with a reference antibody comprising a heavy chain variable region sequence of SEQ ID NO: 17, and a light chain variable region sequence of SEQ ID NO: 19.
  • Competition between the antigen binding protein and the reference antibody may be determined by competition ELISA, FMAT or BIAcore.
  • a competing antigen binding protein may bind to the same epitope, an overlapping epitope, or an epitope in close proximity of the epitope to which the reference antibody binds.
  • the present invention also provides an antigen binding protein which specifically binds to SAP and comprises CDRH3 of SEQ ID NO:3 or a variant CDR thereof.
  • the antigen binding protein may further comprise one or more CDRs, or all CDRs, in any combination, selected from: CDRHl (SEQ ID NO:l), CDRH2 (SEQ ID NO:2), CDRL1 (SEQ ID NO:4), CDRL2 (SEQ ID NO:5), and CDRL3 (SEQ ID NO:6); or a variant thereof.
  • the antigen binding protein may comprise CDRH3 (SEQ ID NO:3) and CDRHl (SEQ ID NO:l), or variants thereof.
  • the antigen binding protein may comprise CDRH3 (SEQ ID NO:3) and CDRH2 (SEQ ID NO:2), or variants thereof.
  • the antigen binding protein may comprise CDRHl (SEQ ID NO:l) and CDRH2 (SEQ ID NO:2), and CDRH3 (SEQ ID NO:3), or variants thereof.
  • the antigen binding protein may comprise CDRL1 (SEQ ID NO:4) and CDRL2 (SEQ ID NO:5), or variants thereof.
  • the antigen binding protein may comprise CDRL2 (SEQ ID NO:5) and CDRL3 (SEQ ID NO:6), or variants thereof.
  • the antigen binding protein may comprise CDRL1 (SEQ ID NO:4), CDRL2 (SEQ ID NO:5) and CDRL3 (SEQ ID NO:6), or variants thereof.
  • the antigen binding protein may comprise CDRH3 (SEQ ID NO:3) and CDRL3 (SEQ ID NO:6), or variants thereof.
  • the antigen binding protein may comprise CDRH3 (SEQ ID NO:3), CDRH2 (SEQ ID NO:2) and CDRL3 (SEQ ID NO:6), or variants thereof.
  • the antigen binding protein may comprise CDRH3 (SEQ ID NO:3), CDRH2 (SEQ ID NO:2), CDRL2 (SEQ ID NO:5) and CDRL3 (SEQ ID NO:6), or variants thereof.
  • the antigen binding protein may comprise CDRHl (SEQ ID NO:l), CDRH2 (SEQ ID NO:2), CDRH3 (SEQ ID NO:3), CDRL1 (SEQ ID NO:4), CDRL2 (SEQ ID NO:5) and CDRL3 (SEQ ID NO:6), or variants thereof.
  • the present invention also provides an antigen binding protein which specifically binds to SAP and comprises CDRH3 of SEQ ID NO:13 or a variant CDR thereof.
  • the antigen binding protein may further comprise one or more CDRs, or all CDRs, in any combination, selected from: CDRHl (SEQ ID NO:ll), CDRH2 (SEQ ID NO:12), CDRL1 (SEQ ID NO:14), CDRL2 (SEQ ID NO:15), and CDRL3 (SEQ ID NO:16); or a variant thereof.
  • the present invention also provides an antigen binding protein which specifically binds to SAP, wherein the antigen binding protein is a chimeric or a humanised antibody comprising the corresponding CDRH3 of the variable domain sequence of SEQ ID NO:7, or a variant CDRH3.
  • the chimeric or humanised antigen binding protein may further comprise one or more, or all of the corresponding CDRs selected from the variable domain sequence of SEQ ID NO:7 or SEQ ID NO:9, or a variant CDR thereof.
  • the antigen binding protein may comprise corresponding CDRH3 and corresponding CDRH1, or variants thereof.
  • the antigen binding protein may comprise corresponding CDRH3 and corresponding CDRH2, or variants thereof.
  • the antigen binding protein may comprise corresponding CDRH1, corresponding CDRH2, and corresponding CDRH3; or variants thereof.
  • the antigen binding protein may comprise corresponding CDRLl and corresponding CDRL2, or variants thereof.
  • the antigen binding protein may comprise corresponding CDRL2 and corresponding CDRL3, or variants thereof.
  • the antigen binding protein may comprise corresponding CDRLl, corresponding CDRL2 and corresponding CDRL3, or variants thereof.
  • the antigen binding protein may comprise corresponding CDRH3 and corresponding CDRL3, or variants thereof.
  • the antigen binding protein may comprise corresponding CDRH3, corresponding CDRH2 and corresponding CDRL3, or variants thereof.
  • the antigen binding protein may comprise corresponding CDRH3, corresponding CDRH2, corresponding CDRL2 and corresponding CDRL3, or variants thereof.
  • the antigen binding protein may comprise corresponding CDRH1, corresponding CDRH2, corresponding CDRH3, corresponding CDRLl, corresponding CDRL2 and corresponding CDRL3, or variants thereof.
  • the corresponding CDRs can be defined by reference to Kabat (1987), Chothia (1989), AbM or contact methods, or a combination of these methods.
  • One definition of each of the methods can be found at Table 1 and can be applied to the reference heavy chain variable domain SEQ ID NO:7 and the reference light chain variable domain SEQ ID NO:9 to determine the corresponding CDR.
  • the present invention also provides an antigen binding protein which specifically binds to SAP, wherein the antigen binding protein is a chimeric or a humanised antibody comprising the corresponding CDRH3 of the variable domain sequence of SEQ ID NO:17, or a variant CDRH3.
  • the chimeric or humanised antigen binding protein may further comprise one or more, or all of the corresponding CDRs selected from the variable domain sequence of SEQ ID NO:17 or SEQ ID NO:19, or a variant CDR thereof.
  • the present invention also provides an antigen binding protein which specifically binds to SAP, and comprises a binding unit H3 comprising Kabat residues 95-101 of SEQ ID NO:7, or a variant H3.
  • the antigen binding protein may further comprise one or more or all binding units selected from: HI comprising Kabat residues 31-32 of SEQ ID NO:7, H2 comprising Kabat residues 52-56 of SEQ ID NO:7, LI comprising Kabat residues 30-34 of SEQ ID NO:9, L2 comprising Kabat residues 50-55 of SEQ ID NO:9 and L3 comprising Kabat residues 89-96 of SEQ ID NO:9; or a variant binding unit.
  • the antigen binding protein may comprise a binding unit H3 and a binding unit HI, or variants thereof.
  • the antigen binding protein may comprise a binding unit H3 and a binding unit H2, or variants thereof.
  • the antigen binding protein may comprise a binding unit HI, a binding unit H2, and a binding unit H3; or variants thereof.
  • the antigen binding protein may comprise a binding unit LI and a binding unit L2, or variants thereof.
  • the antigen binding protein may comprise a binding unit L2 and a binding unit L3, or variants thereof.
  • the antigen binding protein may comprise a binding unit LI, a binding unit L2, and a binding unit L3; or variants thereof.
  • the antigen binding protein may comprise a binding unit H3 and a binding unit L3, or variants thereof.
  • the antigen binding protein may comprise a binding unit H3, a binding unit H2, and a binding unit L3; or variants thereof.
  • the antigen binding protein may comprise a binding unit H3, a binding unit H2, a binding unit L2, and a binding unit L3; or variants thereof.
  • the antigen binding protein may comprise a binding unit HI, a binding unit H2, a binding unit H3, a binding unit LI, a binding unit L2, and a binding unit L3; or variants thereof.
  • the present invention also provides an antigen binding protein which specifically binds to SAP, and comprises a binding unit H3 comprising Kabat residues 95-101 of SEQ ID NO:17, or a variant H3.
  • the antigen binding protein may further comprise one or more or all binding units selected from: HI comprising Kabat residues 31-32 of SEQ ID NO:17, H2 comprising Kabat residues 52-56 of SEQ ID NO:17, LI comprising Kabat residues 30-34 of SEQ ID NO:19, L2 comprising Kabat residues 50-55 of SEQ ID NO:19 and L3 comprising Kabat residues 89-96 of SEQ ID NO:19; or a variant binding unit.
  • a CDR variant or variant binding unit includes an amino acid sequence modified by at least one amino acid, wherein said modification can be chemical or a partial alteration of the amino acid sequence (for example by no more than 10 amino acids), which modification permits the variant to retain the biological characteristics of the unmodified sequence.
  • the variant is a functional variant which specifically binds to SAP and activates clearance of complexes of SAP bound to amyloid from tissues.
  • a partial alteration of the CDR amino acid sequence may be by deletion or substitution of one to several amino acids, or by addition or insertion of one to several amino acids, or by a combination thereof (for example by no more than 10 amino acids).
  • the CDR variant or binding unit variant may contain 1, 2, 3, 4, 5 or 6 amino acid substitutions, additions or deletions, in any combination, in the amino acid sequence.
  • the CDR variant or binding unit variant may contain 1, 2 or 3 amino acid substitutions, insertions or deletions, in any combination, in the amino acid sequence.
  • the substitutions in amino acid residues may be conservative substitutions, for example, substituting one hydrophobic amino acid for an alternative hydrophobic amino acid.
  • leucine may be substituted with valine, or isoleucine.
  • One or more of the CDRs, corresponding CDRs, variant CDRs or binding units described herein may be present in the context of a human framework, for example as a humanised or chimeric variable domain. Fully human antibodies comprising one or more of the CDRs, corresponding CDRs, variant CDRs or binding units described herein are also contemplated and are within the scope of the invention.
  • the CDRs LI, L2, L3, HI and H2 tend to structurally exhibit one of a finite number of main chain conformations.
  • the particular canonical structure class of a CDR is defined by both the length of the CDR and by the loop packing, determined by residues located at key positions in both the CDRs and the framework regions (structurally determining residues or SDRs).
  • Martin and Thornton (1996; J Mol Biol 263:800-815) have generated an automatic method to define the "key residue" canonical templates.
  • Cluster analysis is used to define the canonical classes for sets of CDRs, and canonical templates are then identified by analysing buried hydrophobics, hydrogen-bonding residues, and conserved glycines and prolines.
  • the CDRs of antibody sequences can be assigned to canonical classes by comparing the sequences to the key residue templates and scoring each template using identity or similarity matrices.
  • CDR canonicals within the scope of the invention are given below.
  • the amino acid numbering used is Kabat.
  • Examples of canonicals for CDRHl as set out in SEQ ID NO:l, a variant thereof, the CDRHl of SEQ ID NO:7 or a corresponding CDR are: Tyr 32 is substituted for lie, His, Phe, Thr, Asn, Cys, Glu or Asp; Asn 33 is substituted for Tyr, Ala, Trp, Gly, Thr, Leu or Val; Met 34 is substituted for lie, Val or Trp; and/or His 35 is substituted for Glu, Asn, Gin, Ser, Tyr or Thr.
  • Examples of canonicals for CDRH2 as set out in SEQ ID NO:2, a variant thereof, the CDRH2 of SEQ ID NO:7 or a corresponding CDR are: Tyr 50 is substituted for Arg, Glu, Trp, Gly, Gin, Val, Leu, Asn, Lys or Ala; Ile51 is substituted for Leu, Val, Thr, Ser or Asn; Tyr 52 is substituted for Asp, Leu, Asn or Ser; Gly 53 is substituted for Ala, Tyr, Ser, Lys, Thr or Asn; Asp 54 is substituted for Asn, Ser, Thr, Lys or Gly; Asn 56 is substituted for Tyr, Arg, Glu, Asp, Gly, Val, Ser or Ala; and/or Asn 58 is substituted for Lys, Thr, Ser, Asp, Arg, Gly, Phe or Tyr.
  • Examples of canonicals for CDRH3 as set out in SEQ ID NO:3, a variant thereof, the CDRH3 of SEQ ID NO:7 or a corresponding CDR are: Ser 102 is substituted for Tyr, His, Val, lie, Asp or Gly.
  • Examples of canonicals for CDRL1 as set out in SEQ ID NO:4, a variant thereof, the CDRL1 of SEQ ID NO:9 or a corresponding CDR are: Asn 28 is substituted for Ser, Asp, Thr or Glu; lie 29 is substituted for Val; Tyr 30 is substituted for Asp, Leu, Val, lie, Ser, Asn, Phe, His, Gly or Thr; Ser 31 is substituted for Asn, Thr, Lys or Gly; Tyr 32 is substituted for Phe, Asn, Ala, His, Ser or Arg; Leu 33 is substituted for Met, Val, lie or Phe; and/or Ala 34 is substituted for Gly, Asn, Ser, His, Val or Phe.
  • Examples of canonicals for CDRL2 as set out in SEQ ID NO:5, a variant thereof, the CDRL1 of SEQ ID NO:9 or a corresponding CDR are: Ala 51 is substituted for Thr, Gly or Val.
  • Examples of canonicals for CDRL3 as set out in SEQ ID NO:6, a variant thereof, the CDRL1 of SEQ ID NO:9 or a corresponding CDR are: Gin 89 is substituted for Ser, Gly, Phe or Leu; His 90 is substituted for Gin or Asn; His 91 is substituted for Asn, Phe, Gly, Ser, Arg, Asp, Thr, Tyr or Val; Tyr 92 is substituted for Asn, Trp, Thr, Ser, Arg, Gin, His, Ala or Asp; Gly 93 is substituted for Glu, Asn, His, Thr, Ser, Arg or Ala; Ala 94 is substituted for Asp, Tyr, Thr, Val, Leu, His, Asn, lie, Trp, Pro or Ser; and/or Leu 96 is substituted for Pro, Tyr, Arg, lie, Trp or Phe.
  • Examples of canonicals for CDRH1 as set out in SEQ ID NO:ll, a variant thereof, the CDRH1 of SEQ ID NO:17 or a corresponding CDR are: Tyr 32 is substituted for lie, His, Phe, Thr, Asn, Cys, Glu or Asp; Trp 33 is substituted for Tyr, Ala, Gly, Thr, Leu or Val; Met 34 is substituted for lie, Val or Trp; and/or His 35 is substituted for Glu, Asn, Gin, Ser, Tyr or Thr.
  • Examples of canonicals for CDRH2 as set out in SEQ ID NO:12, a variant thereof, the CDRH1 of SEQ ID NO:17 or a corresponding CDR are: Met 50 is substituted for Arg, Glu, Trp, Tyr, Gly, Gin, Val, Leu, Asn, Lys or Ala; Ile51 is substituted for Leu, Val, Thr, Ser or Asn; His 52 is substituted for Asp, Leu, Asn, Ser or Tyr; Asn 53 is substituted for Ala, Gly, Tyr, Ser, Lys or Thr; Ser 54 is substituted for Asn, Thr, Lys, Asp or Gly; Asn 56 is substituted for Tyr, Arg, Glu, Asp, Gly, Val, Ser or Ala; and/or Asn 58 is substituted for Lys, Thr, Ser, Asp, Arg, Gly, Phe or Tyr.
  • Examples of canonicals for CDRH3 as set out in SEQ ID NO:13, a variant thereof, the CDRH1 of SEQ ID NO:17 or a corresponding CDR are: Val 102 is substituted for Tyr, His, lie, Ser, Asp or Gly.
  • Examples of canonicals for CDRL1 as set out in SEQ ID NO:14, a variant thereof, the CDRL1 of SEQ ID NO:19 or a corresponding CDR are: Asn 28 is substituted for Ser, Asp, Thr or Glu; Val 29 is substituted for lie; Asn 30 is substituted for Asp, Leu, Tyr, Val, lie, Ser, Phe, His, Gly or Thr; Ser 31 is substituted for Asn, Thr, Lys or Gly; Asn 32 is substituted for Phe, Tyr, Ala, His, Ser or Arg; Val 33 is substituted for Met, Leu, lie or Phe; Ala 34 is substituted for Gly, Asn, Ser, His, Val or Phe.
  • Examples of canonicals for CDRL2 as set out in SEQ ID NO:15, a variant thereof, the CDRL1 of SEQ ID NO:19 or a corresponding CDR are: Ala 51 is substituted for Thr, Gly or Val.
  • Examples of canonicals for CDRL3 as set out in SEQ ID NO:16, a variant thereof, the CDRL1 of SEQ ID NO:19 or a corresponding CDR are: Gin 89 is substituted for Ser, Gly, Phe or Leu; Gin 90 is substituted for Asn or His; Cys 91 is substituted for Asn, Phe, Gly, Ser, Arg, Asp, His, Thr, Tyr or Val; Asn 92 is substituted for Tyr, Trp, Thr, Ser, Arg, Gin, His, Ala or Asp; Asn 93 is substituted for Glu, Gly, His, Thr, Ser, Arg or Ala; Tyr 94 is substituted for Asp, Thr, Val, Leu, His, Asn, lie, Trp, Pro or Ser; and/or Phe 96 is substituted for Pro, Leu, Tyr, Arg, lie or Trp.
  • the particular canonical structure class of a CDR is defined by both the length of the CDR and by the loop packing, determined by residues located at key positions in both the CDRs and the framework regions.
  • the canonical framework residues of an antigen binding protein of the invention may include (using Kabat numbering):
  • Heavy chain Val, lie or Gly at position 2; Leu or Val at position 4; Leu, lie, Met or Val at position 20; Cys at position 22; Thr, Ala, Val, Gly or Ser at position 24; Gly at position 26; lie, Phe, Leu or Ser at position 29; Trp at position 36; Trp or Tyr at position 47; lie, Met, Val or Leu at position 48; lie, Leu, Phe, Met or Val at position 69; Val, Ala or Leu at position 71; Ala, Leu, Val, Tyr or Phe at position 78; Leu or Met at position 80; Tyr or Phe at position 90; Cys at position 92; and/or Arg, Lys, Gly, Ser, His or Asn at position 94.
  • Light chain lie, Leu or Val at position 2; Val, Gin, Leu or Glu at position 3; Met or Leu at position 4; Cys at position 23; Trp at position 35; Tyr, Leu or Phe at position 36; Leu, Arg or Val at position 46; Tyr, His, Phe or Lys at position 49; Tyr or Phe at position 71; Cys at position 88; and/or Phe at position 98.
  • the heavy chain framework comprises the following residues: Val at position 2, Leu at position 4, Val at position 20, Cys at position 22, Ala at position 24, Gly at position 26, Phe at position 29, Trp at position 36, Trp at position 47, Met at position 48, lie at position 69, Ala at position 71, Ala at position 78, Met at position 80, Tyr at position 90, Cys at position 92, and Arg at position 94; and the light chain framework comprises the following residues: lie at position 2, Gin at position 3, Met at position 4, Cys at position 23, Trp at position 35, Tyr at position 36, Leu at position 46, His at position 49, Phe at position 71, Cys at position 88, and Phe at position 98.
  • any one, any combination, or all of the framework positions described above may be present in the antigen binding protein of the invention.
  • the humanised heavy chain variable domain may comprise the CDRs listed in SEQ ID NO:l- 3; variant CDRs; corresponding CDRs in SEQ ID NO:7; binding units; or variants thereof, within an acceptor antibody framework having 75% or greater, 80% or greater, 85% or greater, 90% or greater, 95% or greater, 98% or greater, 99% or greater or 100% identity in the framework regions to the human acceptor variable domain sequence in SEQ ID NO:25.
  • the humanised light chain variable domain may comprise the CDRs listed in SEQ ID NO:4-6; variant CDRs; corresponding CDRs in SEQ ID NO:9; binding units; or variants thereof, within an acceptor antibody framework having 75% or greater, 80% or greater, 85% or greater, 90% or greater, 95% or greater, 98% or greater, 99% or greater or 100% identity in the framework regions to the human acceptor variable domain sequence in SEQ ID NO:32.
  • the humanised heavy chain variable domain may comprise the CDRs listed in SEQ ID NO:ll- 13; variant CDRs; corresponding CDRs in SEQ ID NO:17; binding units; or variants thereof, within an acceptor antibody framework having 75% or greater, 80% or greater, 85% or greater, 90% or greater, 95% or greater, 98% or greater, 99% or greater or 100% identity in the framework regions to the human acceptor variable domain sequence in SEQ ID NO:25.
  • the humanised light chain variable domain may comprise the CDRs listed in SEQ ID NO:14- 16; variant CDRs; corresponding CDRs in SEQ ID NO:19; binding units; or variants thereof, within an acceptor antibody framework having 75% or greater, 80% or greater, 85% or greater, 90% or greater, 95% or greater, 98% or greater, 99% or greater or 100% identity in the framework regions to the human acceptor variable domain sequence in SEQ ID NO:32.
  • the invention also provides an antigen binding protein which specifically binds to SAP and comprises a heavy chain variable region selected from any one of SEQ ID NO:27-31.
  • the antigen binding protein may comprise a light chain variable region selected from any one of SEQ ID NO:34-36 Any of the heavy chain variable regions may be combined with any of the light chain variable regions.
  • the antigen binding protein may comprise any one of the following heavy chain and light chain variable region combinations: H0L0 (SEQ ID NO:27 and SEQ ID NO:34), H0L1 (SEQ ID NO:27 and SEQ ID NO:35), H0L2 (SEQ ID NO:27 and SEQ ID NO:36), H1L0 (SEQ ID NO:28 and SEQ ID NO:34), H1L1 (SEQ ID NO:28 and SEQ ID NO:35), H1L2 (SEQ ID NO:28 and SEQ ID NO:36), H2L0 (SEQ ID NO:29 and SEQ ID NO:34), H2L1 (SEQ ID NO:29 and SEQ ID NO:35), H2L2 (SEQ ID NO:29 and SEQ ID NO:36), H3L0 (SEQ ID NO:30 and SEQ ID NO:34), H3L1 (SEQ ID NO:30 and SEQ ID NO:35), H3L2 (SEQ ID NO:30 and SEQ ID NO:36), H4L0 (
  • the invention also provides an antigen binding protein which specifically binds to SAP and comprises a heavy chain variable region selected from any one of SEQ ID NO:37-40.
  • the antigen binding protein may comprise a light chain variable region of SEQ ID NO:41, SEQ ID NO:42 or SEQ ID NO:74. Any of the heavy chain variable regions may be combined with any of the light chain variable regions.
  • the antigen binding protein may comprise any one of the following heavy chain and light chain variable region combinations: H0L0 (SEQ ID NO:37 and SEQ ID NO:41), H0L1 (SEQ ID NO:37 and SEQ ID NO:42), H1L0 (SEQ ID NO:38 and SEQ ID NO:41), H1L1 (SEQ ID NO:38 and SEQ ID NO:42), H2L0 (SEQ ID NO:39 and SEQ ID NO:41), H2L1 (SEQ ID NO:39 and SEQ ID NO:42), H3L0 (SEQ ID NO:40 and SEQ ID NO:41), or H3L1 (SEQ ID NO:40 and SEQ ID NO:42).
  • L0 (SEQ ID NO:41) may be substituted with L0 91 A (SEQ ID NO:74).
  • the antibody heavy chain variable region may have 75% or greater, 80% or greater, 85% or greater, 90% or greater, 95% or greater, 96% or greater, 97% or greater, 98% or greater, 99% or greater or 100% identity to SEQ ID NO:28.
  • the antibody light chain variable region may have 75% or greater, 80% or greater, 85% or greater, 90% or greater, 95% or greater, 96% or greater, 97% or greater, 98% or greater, 99% or greater, or 100% identity to SEQ ID NO:35.
  • the antibody heavy chain variable region may have 75% or greater, 80% or greater, 85% or greater, 90% or greater, 95% or greater, 96% or greater, 97% or greater, 98% or greater, 99% or greater or 100% identity to SEQ ID NO:40.
  • the antibody light chain variable region may have 75% or greater, 80% or greater, 85% or greater, 90% or greater, 95% or greater, 96% or greater, 97% or greater, 98% or greater, 99% or greater, or 100% identity to SEQ ID NO:41.
  • the antibody light chain variable region may have 75% or greater, 80% or greater, 85% or greater, 90% or greater, 95% or greater, 96% or greater, 97% or greater, 98% or greater, 99% or greater, or 100% identity to SEQ ID NO:74.
  • the antibody heavy chain variable region may be a variant of any one of SEQ ID NO:27-31 which contains 30, 25, 20, 15, 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1 amino acid substitutions, insertions or deletions.
  • the antibody light chain variable region may be a variant of any one of SEQ ID NO:34-36 which contains 30, 25, 20, 15, 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1 amino acid substitutions, insertions or deletions.
  • the antibody heavy chain variable region may be a variant of any one of SEQ ID NO:37-40 which contains 30, 25, 20, 15, 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1 amino acid substitutions, insertions or deletions.
  • the antibody light chain variable region may be a variant of SEQ ID NO:41, 42 or 74 which contains 30, 25, 20, 15, 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1 amino acid substitutions, insertions or deletions.
  • canonical CDRs and canonical framework residue substitutions described above may also be present in the variant heavy or light chain variable regions as variant sequences that are at least 75% identical or which contain up to 30 amino acid substitutions.
  • the antigen binding protein of the invention may comprise a heavy chain of SEQ ID NO:62 and/or a light chain variable region of SEQ ID NO:64.
  • the antibody heavy chain may have 75% or greater, 80% or greater, 85% or greater, 90% or greater, 95% or greater, 96% or greater, 97% or greater, 98% or greater, 99% or greater or 100% identity to SEQ ID NO:62.
  • the antibody light chain may have 75% or greater, 80% or greater, 85% or greater, 90% or greater, 95% or greater, 96% or greater, 97% or greater, 98% or greater, 99% or greater, or 100% identity to SEQ ID NO:64.
  • the antibody heavy chain may be a variant of any one of SEQ ID NO:62 which contains 30, 25, 20, 15, 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1 amino acid substitutions, insertions or deletions.
  • the antibody light chain may be a variant of any one of SEQ ID NO:64 which contains 30, 25, 20, 15, 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1 amino acid substitutions, insertions or deletions.
  • the disc-like SAP molecule has two faces.
  • the single alpha helix present on each of the 5 protomers is located on the A face.
  • the calcium dependent ligand binding pocket of each protomer is located on the B face and this face is therefore occluded when SAP is bound to amyloid fibrils.
  • the epitope recognised by the antigen binding protein described herein is desirably accessible in SAP when SAP is bound to amyloid deposits and is therefore located on the A face or the edges of the SAP molecule.
  • the antigen binding protein can then recognise and bind to amyloid bound SAP, leading to complement activation that triggers the body's efficient macrophage dependent clearance mechanism.
  • the antigen binding protein binds human SAP which is bound to amyloid fibrils in vivo.
  • the antigen binding protein binds to the A face of human SAP.
  • the antigen binding protein may be derived from rat, mouse, rabbit, camel (or related camelid species), or primate (e.g. cynomolgus, Old World monkey, Great Ape or human). In a particular embodiment the antigen binding protein is derived from mouse. In another embodiment the antigen binding protein is derived from human. The antigen binding protein may be a humanised or chimeric antibody. The antigen binding protein may be a human antibody. The antigen binding protein is not a murine antibody.
  • the antigen binding protein may comprise a constant region, which may be of any isotype or subclass.
  • the constant region may be of the IgG isotype, for example IgGl, lgG2, lgG3, lgG4 or variants thereof.
  • the antigen binding protein constant region may be IgGl.
  • the antigen binding protein comprises a constant region that is functional in activating complement e.g. human IgGl, lgG2 or lgG3.
  • the antigen binding protein comprises a constant region that is functional in binding macrophages e.g. human IgGl or lgG3.
  • the antigen binding protein comprises a constant region that is functional in both activating com plement and binding macrophages e.g. human IgGl or lgG3.
  • the antigen binding protein may comprise one or more modifications selected from a mutated constant domain such that the antibody has altered effector functions/ADCC and/or complement activation. Examples of suitable modifications are described in Shields et al. J. Biol. Chem (2001) 276: 6591-6604, Lazar et al. PNAS (2006) 103 : 4005-4010 and US6737056, WO2004063351 and WO2004029207.
  • the antigen binding protein may comprise a constant domain with an altered glycosylation profile such that the antigen binding protein has altered effector functions/ADCC and/or complement activation. Examples of suitable methodologies to produce an antigen binding protein with an altered glycosylation profile are described in WO2003/011878, WO2006/014679 and EP1229125.
  • antigen binding proteins are selected which do not have residues within regions that are responsible for antigen binding, e.g. the CDRs, that are susceptible to deamidation. In a further embodiment of the invention, antigen binding proteins are selected which do not have residues within regions responsible for complement activation that are susceptible to deamidation.
  • the present invention also provides a nucleic acid molecule which encodes an antigen binding protein as described herein.
  • the nucleic acid molecule may comprise sequences encoding both the heavy chain variable or full length sequence; and the light chain variable or full length sequence.
  • the nucleic acid molecule which encodes an antigen binding protein described herein may comprise sequences encoding the heavy chain variable or full length sequence; or light chain variable or full length sequence.
  • the nucleic acid molecule which encodes the heavy chain variable region may comprise any one of SEQ ID NO:51 or 53-57.
  • the nucleic acid molecule which encodes the light chain variable region may comprise any one of SEQ ID NO:52 or 58-60.
  • the nucleic acid molecule which encodes the heavy chain may comprise SEQ ID NO:61.
  • the nucleic acid molecule which encodes the light chain may comprise SEQ ID NO:63.
  • the nucleic acid molecule which encodes the heavy chain variable region may comprise any one of SEQ ID NO:65 or 67-70.
  • the nucleic acid molecule which encodes the light chain variable region may comprise any one of SEQ ID NO:66 or 71-73.
  • the nucleic acid molecule may also contain one or more nucleotide substitutions which do not alter the amino acid sequence of the encoded heavy and/or light chain.
  • the present invention also provides an expression vector comprising a nucleic acid molecule as described herein. Also provided is a recombinant host cell, comprising an expression vector as described herein.
  • the antigen binding protein described herein may be produced in a suitable host cell.
  • a method for the production of the antigen binding protein as described herein may comprise the step of culturing a host cell as described herein and recovering the antigen binding protein.
  • a recombinant transformed, transfected, or transduced host cell may comprise at least one expression cassette, whereby said expression cassette comprises a polynucleotide encoding a heavy chain of the antigen binding protein described herein and further comprises a polynucleotide encoding a light chain of the antigen binding protein described herein.
  • a recombinant transformed, transfected or transduced host cell may comprise at least one expression cassette, whereby a first expression cassette comprises a polynucleotide encoding a heavy chain of the antigen binding protein described herein and further comprise a second cassette comprising a polynucleotide encoding a light chain of the antigen binding protein described herein.
  • a stably transformed host cell may comprise a vector comprising one or more expression cassettes encoding a heavy chain and/or a light chain of the antigen binding protein described herein.
  • host cells may comprise a first vector encoding the light chain and a second vector encoding the heavy chain.
  • the host cell may be eukaryotic, for example mammalian.
  • Examples of such cell lines include CHO or NSO.
  • the host cell may be cultured in a culture media, for example serum-free culture media.
  • the antigen binding protein may be secreted by the host cell into the culture media.
  • the antigen binding protein can be purified to at least 95% or greater (e.g. 98% or greater) with respect to said culture media containing the antigen binding protein.
  • a pharmaceutical composition comprising the antigen binding protein and a pharmaceutically acceptable carrier may be provided.
  • a kit-of-parts comprising the pharmaceutical composition together with instructions for use may be provided.
  • the kit may comprise the reagents in predetermined amounts with instructions for use.
  • the light chains of antibodies from most vertebrate species can be assigned to one of two types called Kappa and Lambda based on the amino acid sequence of the constant region.
  • human antibodies can be assigned to five different classes, IgA, IgD, IgE, IgG and IgM.
  • IgG and IgA can be further subdivided into subclasses, IgGl, lgG2, lgG3 and lgG4; and IgAl and lgA2.
  • Species variants exist with mouse and rat having at least lgG2a, lgG2b.
  • variable region The more conserved portions of the variable region are called Framework regions (FR).
  • the variable domains of intact heavy and light chains each comprise four FR connected by three CDRs.
  • the CDRs in each chain are held together in close proximity by the FR regions and with the CDRs from the other chain contribute to the formation of the antigen binding site of antibodies.
  • the constant regions are not directly involved in the binding of the antibody to the antigen but exhibit various effector functions such as participation in antibody dependent cell- mediated cytotoxicity (ADCC), phagocytosis via binding to Fey receptor, half-life/clearance rate via neonatal Fc receptor (FcRn) and complement activation via the Clq component, leading to the chemotactic, opsonic and, potentially in the case of a viable cellular antigen target, cytolytic actions of complement.
  • ADCC antibody dependent cell- mediated cytotoxicity
  • FcRn neonatal Fc receptor
  • complement activation via the Clq component leading to the chemotactic, opsonic and, potentially in the case of a viable cellular antigen target, cytolytic actions of complement.
  • Human antibodies of the IgGl class are the most potent in activating the complement system and are therefore the desirable isotype for the therapeutic application of the antibodies of the present invention.
  • the human lgG2 constant region has been reported to essentially lack the ability to activate complement by the classical pathway or to mediate antibody-dependent cellular cytotoxicity.
  • the lgG4 constant region has been reported to lack the ability to activate complement by the classical pathway and mediates antibody-dependent cellular cytotoxicity only weakly. Antibodies essentially lacking these effector functions may be termed 'non-lytic' antibodies.
  • Human antibodies may be produced by a number of methods known to those of skill in the art. Human antibodies can be made by the hybridoma method using human myeloma or mouse-human heteromyeloma cells lines see Kozbor (1984) J. Immunol 133, 3001, and Brodeur, Monoclonal Antibody Production Techniques and Applications, 51-63 (Marcel Dekker Inc, 1987). Alternative methods include the use of phage libraries or transgenic mice both of which utilize human variable region repertories (see Winter (1994) Annu. Rev. Immunol 12: 433-455; Green (1999) J. Immunol. Methods 231: 11-23).
  • mice Several strains of transgenic mice are now available wherein their mouse immunoglobulin loci has been replaced with human immunoglobulin gene segments (see Tomizuka (2000) PNAS 97: 722-727; Fishwild (1996) Nature Biotechnol. 14: 845-851; Mendez (1997) Nature Genetics, 15: 146-156). Upon antigen challenge such mice are capable of producing a repertoire of human antibodies from which antibodies of interest can be selected.
  • Phage display technology can be used to produce human antigen binding proteins (and fragments thereof), see McCafferty (1990) Nature 348: 552-553 and Griffiths et al. (1994) EMBO 13: 3245-3260.
  • affinity maturation (Marks Bio/technol (1992) 10: 779-783) may be used to improve binding affinity wherein the affinity of the primary human antibody is improved by sequentially replacing the heavy (H) and light (L) chain variable regions with naturally occurring variants and selecting on the basis of improved binding affinities.
  • Variants of this technique such as "epitope imprinting" are now also available, see for example WO 93/06213; Waterhouse (1993) Nucl. Acids Res. 21: 2265-2266.
  • Chimeric antibodies are typically produced using recombinant DNA methods.
  • DNA encoding the antibodies e.g. cDNA
  • DNA encoding the antibodies is isolated and sequenced using conventional procedures (e.g. by using oligonucleotide probes that are capable of binding specifically to genes encoding the H and L chains of the antibody.
  • Hybridoma cells serve as a typical source of such DNA.
  • the DNA is placed into expression vectors which are then transfected into host cells such as E. coli, COS cells, CHO cells or myeloma cells that do not otherwise produce immunoglobulin protein to obtain synthesis of the antibody.
  • the DNA may be modified by substituting the coding sequence for human L and H chains for the corresponding non- human (e.g. murine) H and L constant regions, see for example Morrison (1984) PNAS 81: 6851.
  • a large decrease in immunogenicity can be achieved by grafting only the CDRs of non-human (e.g. murine) antibodies ("donor” antibodies) onto human framework ("acceptor framework") and constant regions to generate humanised antibodies (see Jones et al. (1986) Nature 321: 522-525; and Verhoeyen et al. (1988) Science 239: 1534-1536).
  • CDR grafting per se may not result in the complete retention of antigen-binding properties and it is frequently found that some framework residues (sometimes referred to as "back mutations") of the donor antibody need to be preserved in the humanised molecule if significant antigen-binding affinity is to be recovered (see Queen et al.
  • human variable regions showing the greatest sequence homology to the non-human donor antibody are chosen from a database in order to provide the human framework (FR).
  • the selection of human FRs can be made either from human consensus or individual human antibodies. Where necessary, key residues from the donor antibody can be substituted into the human acceptor framework to preserve CDR conformations. Computer modelling of the antibody maybe used to help identify such structurally important residues, see WO 99/48523.
  • humanisation maybe achieved by a process of "veneering".
  • a statistical analysis of unique human and murine immunoglobulin heavy and light chain variable regions revealed that the precise patterns of exposed residues are different in human and murine antibodies, and most individual surface positions have a strong preference for a small number of different residues (see Padlan et al. (1991) Mol. Immunol. 28: 489-498; and Pedersen et al. (1994) J. Mol. Biol. 235: 959-973). Therefore it is possible to reduce the immunogenicity of a non-human Fv by replacing exposed residues in its framework regions that differ from those usually found in human antibodies.
  • Bispecific antigen binding proteins A bispecific antigen binding protein is an antigen binding protein having binding specificities for at least two different epitopes. Methods of making such antigen binding proteins are known in the art. Traditionally, the recombinant production of bispecific antigen binding proteins is based on the co-expression of two immunoglobulin H chain-L chain pairs, where the two H chains have different binding specificities, see Millstein et al. (1983) Nature 305: 537-539; WO 93/08829; and Traunecker et al. (1991) EMBO 10: 3655-3659. Because of the random assortment of H and L chains, a potential mixture of ten different antibody structures are produced of which only one has the desired binding specificity.
  • variable domains with the desired binding specificities to heavy chain constant region comprising at least part of the hinge region, CH2 and CH3 regions.
  • the CHI region containing the site necessary for light chain binding may be present in at least one of the fusions.
  • DNA encoding these fusions, and if desired the L chain are inserted into separate expression vectors and are then co-transfected into a suitable host organism. It is possible though to insert the coding sequences for two or all three chains into one expression vector.
  • the bispecific antibody is composed of a H chain with a first binding specificity in one arm and a H-L chain pair, providing a second binding specificity in the other arm, see WO 94/04690. Also see Suresh et al. (1986) Methods in Enzymology 121: 210.
  • Fragments lacking the constant region lack the ability to activate complement by the classical pathway or to mediate antibody-dependent cellular cytotoxicity.
  • Such fragments are produced by the proteolytic digestion of intact antibodies by e.g. papain digestion (see for example, WO 94/29348) but may be produced directly from recombinantly transformed host cells.
  • papain digestion see for example, WO 94/29348
  • antigen binding fragments may be produced using a variety of engineering techniques as described below. Fv fragments appear to have lower interaction energy of their two chains than Fab fragments. To stabilise the association of the VH and VL domains, they have been linked with peptides (Bird et al.
  • ScFv fragments can be produced by methods well known to those skilled in the art, see Whitlow et al. (1991) Methods Companion Methods Enzymol, 2: 97-105 and Huston et al. (1993) Int. Rev. Immunol 10: 195-217. ScFv may be produced in bacterial cells such as E. coli or in eukaryotic cells.
  • ScFv monovalency of the product, which precludes an increased avidity due to polyvalent binding, and their short half-life.
  • Attempts to overcome these problems include bivalent (ScFv')2 produced from ScFv containing an additional C- terminal cysteine by chemical coupling (Adams et al. (1993) Can. Res 53: 4026-4034; and McCartney et al. (1995) Protein Eng. 8: 301-314) or by spontaneous site-specific dimerisation of ScFv containing an unpaired C-terminal cysteine residue (see Kipriyanov et al. (1995) Cell. Biophys 26: 187-204).
  • ScFv can be forced to form multimers by shortening the peptide linker to 3 to 12 residues to form "diabodies”, see Holliger et al. (1993) PNAS 90: 6444-6448. Reducing the linker still further can result in ScFv trimers ("triabodies”, see Kortt et al. (1997) Protein Eng 10: 423-433) and tetramers ("tetrabodies", see Le Gall et al. (1999) FEBS Lett, 453: 164-168). Construction of bivalent ScFv molecules can also be achieved by genetic fusion with protein dimerising motifs to form "miniantibodies" (see Pack et al.
  • ScFv-Sc-Fv tandems (ScFV)2) may also be produced by linking two ScFv units by a third peptide linker, see Kurucz et al. (1995) J. Immol. 154: 4576-4582.
  • Bispecific diabodies can be produced through the non-covalent association of two single chain fusion products consisting of VH domain from one antibody connected by a short linker to the VL domain of another antibody, see Kipriyanov et al. (1998) Int. J. Can 77: 763-772.
  • bispecific diabodies can be enhanced by the introduction of disulphide bridges or "knob in hole” mutations as described supra or by the formation of single chain diabodies (ScDb) wherein two hybrid ScFv fragments are connected through a peptide linker see Kontermann et al. (1999) J. Immunol. Methods 226:179-188.
  • Tetravalent bispecific molecules are available by e.g. fusing a ScFv fragment to the CH3 domain of an IgG molecule or to a Fab fragment through the hinge region, see Coloma et al. (1997) Nature Biotechnol. 15: 159-163.
  • tetravalent bispecific molecules have been created by the fusion of bispecific single chain diabodies (see Alt et al. (1999) FEBS Lett 454: 90-94.
  • Smaller tetravalent bispecific molecules can also be formed by the dimerization of either ScFv-ScFv tandems with a linker containing a helix-loop-helix motif (DiBi miniantibodies, see Muller et al. (1998) FEBS Lett 432: 45-49) or a single chain molecule comprising four antibody variable domains (VH and VL) in an orientation preventing intramolecular pairing (tandem diabody, see Kipriyanov et al. (1999) J. Mol. Biol.
  • Bispecific F(ab')2 fragments can be created by chemical coupling of Fab' fragments or by heterodimerization through leucine zippers (see Shalaby et al. (1992) J. Exp. Med. 175: 217-225; and Kostelny et al. (1992), J. Immunol. 148: 1547-1553). Also available are isolated VH and VL domains (Domantis pic), see US 6,248,516; US 6,291,158; and US 6,172,197.
  • Heteroconjugate antibodies are composed of two covalently joined antibodies formed using any convenient cross-linking methods. See, for example, US 4,676,980.
  • the antigen binding proteins of the present invention may comprise other modifications to enhance or change their effector functions.
  • the interaction between the Fc region of an antibody and various Fc receptors (FcyR) is believed to mediate the effector functions of the antibody which include antibody-dependent cellular cytotoxicity (ADCC), fixation of complement, phagocytosis and half-life/clearance of the antibody.
  • FcyR Fc receptors
  • ADCC antibody-dependent cellular cytotoxicity
  • fixation of complement phagocytosis
  • half-life/clearance of the antibody include antibody-dependent cellular cytotoxicity (ADCC), fixation of complement, phagocytosis and half-life/clearance of the antibody.
  • Various modifications to the Fc region of antibodies may be carried out depending on the desired property. For example, specific mutations in the Fc region to render an otherwise lytic antibody, non-lytic are detailed in EP 0629240 and EP 0307434 or one may incorporate a salvage receptor binding epitope into the antibody to increase serum
  • Human Fey receptors include FcyR (I), FcyRlla, FcyRllb, FcyRllla and neonatal FcRn. Shields et al. (2001) J. Biol. Chem 276: 6591-6604 demonstrated that a common set of IgGl residues is involved in binding all FcyRs, while FcyRII and FcyRIII utilize distinct sites outside of this common set.
  • One group of IgGl residues reduced binding to all FcyRs when altered to alanine: Pro-238, Asp-265, Asp-270, Asn-297 and Pro-239. All are in the IgG CH2 domain and clustered near the hinge joining CHI and CH2.
  • FcyRI utilizes only the common set of IgGl residues for binding
  • FcyRII and FcyRIII interact with distinct residues in addition to the common set. Alteration of some residues reduced binding only to FcyRII (e.g. Arg-292) or FcyRIII (e.g. Glu- 293).
  • Some variants showed improved binding to FcyRII or FcyRIII but did not affect binding to the other receptor (e.g. Ser-267Ala improved binding to FcyRII but binding to FcyRIII was unaffected).
  • Other variants exhibited improved binding to FcyRII or FcyRIII with reduction in binding to the other receptor (e.g.
  • Ser-298Ala improved binding to FcyRIII and reduced binding to FcyRII).
  • FcyRllla the best binding IgGl variants had combined alanine substitutions at Ser-298, Glu-333 and Lys-334.
  • the neonatal FcRn receptor is believed to be involved in both antibody clearance and the transcytosis across tissues (see Junghans (1997) Immunol. Res 16: 29-57; and Ghetie et al. (2000) Annu. Rev. Immunol. 18: 739-766).
  • Human IgGl residues determined to interact directly with human FcRn includes Ile253, Ser254, Lys288, Thr307, Gln311, Asn434 and His435. Substitutions at any of the positions described in this section may enable increased serum half-life and/or altered effector properties of the antibodies.
  • glycosylation variants of the antibodies include glycosylation variants of the antibodies. Glycosylation of antibodies at conserved positions in their constant regions is known to have a profound effect on antibody function, particularly effector functioning such as those described above, see for example, Boyd et al. (1996) Mol. Immunol. 32: 1311-1318. Glycosylation variants of the antibodies or antigen binding fragments thereof wherein one or more carbohydrate moiety is added, substituted, deleted or modified are contemplated. Introduction of an asparagine-X-serine or asparagine-X-threonine motif creates a potential site for enzymatic attachment of carbohydrate moieties and may therefore be used to manipulate the glycosylation of an antibody. In Raju et al.
  • the antibodies for example of the IgG isotype, e.g. IgGl
  • the antibodies may comprise a defined number (e.g. 7 or less, for example 5 or less, such as two or a single) of glycoform(s).
  • the antibodies may be coupled to a non-proteinaeous polymer such as polyethylene glycol (PEG), polypropylene glycol or polyoxyalkylene.
  • PEG polyethylene glycol
  • PEG polypropylene glycol
  • polyoxyalkylene polyethylene glycol
  • Conjugation of proteins to PEG is an established technique for increasing half-life of proteins, as well as reducing antigenicity and immunogenicity of proteins.
  • the use of PEGylation with different molecular weights and styles (linear or branched) has been investigated with intact antibodies as well as Fab' fragments, see Koumenis et al. (2000) Int. J. Pharmaceut. 198: 83-95.
  • Antigen binding proteins may be produced in transgenic organisms such as goats (see Pollock et al. (1999) J. Immunol. Methods 231: 147-157), chickens (see Morrow (2000) Genet. Eng. News 20: 1-55, mice (see Pollock et al.) or plants (see Doran (2000) Curr. Opinion Biotechnol. 11: 199-204; Ma (1998) Nat. Med. 4: 601-606; Baez et al. (2000) BioPharm 13: 50-54; Stoger et al. (2000) Plant Mol. Biol. 42: 583-590). Antigen binding proteins may also be produced by chemical synthesis.
  • antigen binding proteins are typically produced using recombinant cell culturing technology well known to those skilled in the art.
  • a polynucleotide encoding the antigen binding protein is isolated and inserted into a replicable vector such as a plasmid for further cloning (amplification) or expression.
  • a replicable vector such as a plasmid for further cloning (amplification) or expression.
  • One expression system is a glutamate synthetase system (such as sold by Lonza Biologies), particularly where the host cell is CHO or NS0.
  • Polynucleotide encoding the antigen binding protein is readily isolated and sequenced using conventional procedures (e.g. oligonucleotide probes).
  • Vectors that may be used include plasmid, virus, phage, transposons, minichromosomes of which plasmids are typically used. Generally such vectors further include a signal sequence, origin of replication, one or more marker genes, an enhancer element, a promoter and transcription termination sequences operably linked to the antigen binding protein polynucleotide so as to facilitate expression. Polynucleotide encoding the light and heavy chains may be inserted into separate vectors and introduced (for example by transformation, transfection, electroporation or transduction) into the same host cell concurrently or sequentially or, if desired, both the heavy chain and light chain can be inserted into the same vector prior to said introduction.
  • Codon optimisation may be used with the intent that the total level of protein produced by the host cell is greater when transfected with the codon-optimised gene in comparison with the level when transfected with the sequence.
  • Several methods have been published (Nakamura et al. (1996) Nucleic Acids Research 24: 214-215; W098/34640; W097/11086). Due to the redundancy of the genetic code, alternative polynucleotides to those disclosed herein (particularly those codon optimised for expression in a given host cell) may also encode the antigen binding proteins described herein.
  • the codon usage of the antigen binding protein of this invention therefore can be modified to accommodate codon bias of the host cell such to augment transcript and/or product yield (e.g. Hoekema et al Mol Cell Biol 1987 7(8): 2914-24). The choice of codons may be based upon suitable compatibility with the host cell used for expression.
  • Antigen binding proteins may be produced as a fusion protein with a heterologous signal sequence having a specific cleavage site at the N-terminus of the mature protein.
  • the signal sequence should be recognised and processed by the host cell.
  • the signal sequence may be for example an alkaline phosphatase, penicillinase, or heat stable enterotoxin II leaders.
  • yeast secretion the signal sequences may be for example a yeast invertase leader, a factor leader or acid phosphatase leaders see e.g. WO90/13646.
  • viral secretory leaders such as herpes simplex gD signal and a native immunoglobulin signal sequence may be suitable.
  • the signal sequence is ligated in reading frame to DNA encoding the antigen binding protein.
  • a murine signal sequence such as that shown in SEQ ID NO: 79 may be used.
  • Origin of replications are well known in the art with pBR322 suitable for most gram-negative bacteria, 2 ⁇ plasmid for most yeast and various viral origins such as SV40, polyoma, adenovirus, VSV or BPV for most mammalian cells.
  • origin of replication component is not needed for mammalian expression vectors but the SV40 may be used since it contains the early promoter.
  • Typical selection genes encode proteins that (a) confer resistance to antibiotics or other toxins e.g. ampicillin, neomycin, methotrexate or tetracycline or (b) complement auxiotrophic deficiencies or supply nutrients not available in the complex media or (c) combinations of both.
  • the selection scheme may involve arresting growth of the host cell. Cells, which have been successfully transformed with the genes encoding the antigen binding protein, survive due to e.g. drug resistance conferred by the co-delivered selection marker.
  • One example is the DHFR selection marker wherein transformants are cultured in the presence of methotrexate. Cells can be cultured in the presence of increasing amounts of methotrexate to amplify the copy number of the exogenous gene of interest.
  • CHO cells are a particularly useful cell line for the DHFR selection.
  • a further example is the glutamate synthetase expression system (Lonza Biologies).
  • An example of a selection gene for use in yeast is the trpl gene, see Stinchcomb et al. (1979) Nature 282: 38.
  • Suitable promoters for expressing antigen binding proteins are operably linked to DNA/polynucleotide encoding the antigen binding protein.
  • Promoters for prokaryotic hosts include phoA promoter, beta-lactamase and lactose promoter systems, alkaline phosphatase, tryptophan and hybrid promoters such as Tac.
  • Promoters suitable for expression in yeast cells include 3-phosphoglycerate kinase or other glycolytic enzymes e.g.
  • I nducible yeast promoters include alcohol dehydrogenase 2, isocytochrome C, acid phosphatase, metallothionein and enzymes responsible for nitrogen metabolism or ma Itose/ga lactose utilization.
  • Promoters for expression in mammalian cell systems include viral promoters such as polyoma, fowlpox and adenoviruses (e.g. adenovirus 2), bovine papilloma virus, avian sarcoma virus, cytomegalovirus (in particular the immediate early gene promoter), retrovirus, hepatitis B virus, actin, rous sarcoma virus (RSV) promoter and the early or late Simian virus 40.
  • viral promoters such as polyoma, fowlpox and adenoviruses (e.g. adenovirus 2), bovine papilloma virus, avian sarcoma virus, cytomegalovirus (in particular the immediate early gene promoter), retrovirus, hepatitis B virus, actin, rous sarcoma virus (RSV) promoter and the early or late Simian virus 40.
  • adenoviruses e.g. a
  • a first plasmid may comprise a RSV and/or SV40 and/or CMV promoter, DNA encoding light chain variable region (VL), KC region together with neomycin and ampicillin resistance selection markers and a second plasmid comprising a RSV or SV40 promoter, DNA encoding the heavy chain variable region (VH), DNA encoding the ⁇ constant region, DHFR and ampicillin resistance markers.
  • an enhancer element operably linked to the promoter element in a vector may be used.
  • Mammalian enhancer sequences include enhancer elements from globin, elastase, albumin, fetoprotein and insulin.
  • an enhancer element from a eukaroytic cell virus such as SV40 enhancer (at bplOO-270), cytomegalovirus early promoter enhancer, polyma enhancer, baculoviral enhancer or murine lgG2a locus (see WO04/009823).
  • the enhancer may be located on the vector at a site upstream to the promoter. Alternatively, the enhancer may be located elsewhere, for example within the untranslated region or downstream of the polyadenylation signal. The choice and positioning of enhancer may be based upon suitable compatibility with the host cell used for expression.
  • polyadenylation signals are operably linked to DNA/polynucleotide encoding the antigen binding protein. Such signals are typically placed 3' of the open reading frame.
  • non-limiting examples include signals derived from growth hormones, elongation factor-1 alpha and viral (e.g. SV40) genes or retroviral long terminal repeats.
  • polydenylation/termination signals include those derived from the phosphoglycerate kinase (PGK) and the alcohol dehydrogenase 1 (ADH) genes.
  • PGK phosphoglycerate kinase
  • ADH alcohol dehydrogenase 1
  • polyadenylation signals are typically not required and it is instead usual to employ shorter and more defined terminator sequences. The choice of polyadenylation/termination sequences may be based upon suitable compatibility with the host cell used for expression.
  • Suitable host cells for cloning or expressing vectors encoding antigen binding proteins are prokaroytic, yeast or higher eukaryotic cells.
  • Suitable prokaryotic cells include eubacteria e.g. enterobacteriaceae such as Escherichia e.g. E. coli (for example ATCC 31,446; 31,537; 27,325), Enterobacter, Erwinia, Klebsiella Proteus, Salmonella e.g. Salmonella typhimurium, Serratia e.g. Serratia marcescans and Shigella as well as Bacilli such as B. subtilis and B. licheniformis (see DD 266 710), Pseudomonas such as P.
  • enterobacteriaceae such as Escherichia e.g. E. coli (for example ATCC 31,446; 31,537; 27,325)
  • Enterobacter Erwinia
  • Klebsiella Proteus Salmonella
  • yeast host cells Saccharomyces cerevisiae, Schizosaccharomyces pombe, Kluyveromyces (e.g. ATCC 16,045; 12,424; 24178; 56,500), yarrowia (EP402, 226), Pichia pastoris (EP 183 070, see also Peng et al. (2004) J. Biotechnol. 108: 185-192), Candida, Trichoderma reesia (EP 244 234), Penicillin, Tolypocladium and Aspergillus hosts such as A. nidulans and A. niger are also contemplated.
  • Higher eukaryotic host cells include mammalian cells such as COS-1 (ATCC No.CRL 1650) COS-7 (ATCC CRL 1651), human embryonic kidney line 293, baby hamster kidney cells (BHK) (ATCC CRL.1632), BHK570 (ATCC NO: CRL 10314), 293 (ATCC NO.CRL 1573), Chinese hamster ovary cells CHO (e.g. CHO-K1, ATCC NO: CCL 61, DHFR-CHO cell line such as DG44 (see Urlaub et al. (1986) Somatic Cell Mol.
  • Genet.12 555-556
  • those CHO cell lines adapted for suspension culture mouse Sertoli cells, monkey kidney cells, African green monkey kidney cells (ATCC CRL-1587), HELA cells, canine kidney cells (ATCC CCL 34), human lung cells (ATCC CCL 75), Hep G2 and myeloma or lymphoma cells e.g. NS0 (see US 5,807,715), Sp2/0, Y0.
  • Such host cells may also be further engineered or adapted to modify quality, function and/or yield of the antigen binding protein.
  • Non-limiting examples include expression of specific modifying (e.g. glycosylation) enzymes and protein folding chaperones.
  • Host cells transformed with vectors encoding antigen binding proteins may be cultured by any method known to those skilled in the art.
  • Host cells may be cultured in spinner flasks, roller bottles or hollow fibre systems but for large scale production that stirred tank reactors are used particularly for suspension cultures.
  • the stirred tankers may be adapted for aeration using e.g. spargers, baffles or low shear impellers. For bubble columns and airlift reactors direct aeration with air or oxygen bubbles maybe used.
  • the host cells are cultured in a serum free culture media, the media is supplemented with a cell protective agent such as pluronic F-68 to help prevent cell damage as a result of the aeration process.
  • a cell protective agent such as pluronic F-68 to help prevent cell damage as a result of the aeration process.
  • microcarriers may be used as growth substrates for anchorage dependent cell lines or the cells may be adapted to suspension culture (which is typical).
  • the culturing of host cells, particularly invertebrate host cells may utilise a variety of operational modes such as fed-batch, repeated batch processing (see Drapeau et al. (1994) Cytotechnology 15: 103-109), extended batch process or perfusion culture.
  • recombinantly transformed mammalian host cells may be cultured in serum-containing media such as fetal calf serum (FCS), such host cells may be cultured in synthetic serum-free media such as disclosed in Keen et al.
  • FCS fetal calf serum
  • the serum-free culturing of host cells may require that those cells are adapted to grow in serum free conditions.
  • One adaptation approach is to culture such host cells in serum containing media and repeatedly exchange 80% of the culture medium for the serum-free media so that the host cells learn to adapt in serum free conditions (see e.g. Scharfenberg et al. (1995) in Animal Cell Technology: Developments towards the 21st century (Beuvery et al. eds, 619-623, Kluwer Academic publishers).
  • Antigen binding proteins secreted into the media may be recovered and purified using a variety of techniques to provide a degree of purification suitable for the intended use.
  • the use of antigen binding proteins for the treatment of human patients typically mandates at least 95% purity, more typically 98% or 99% or greater purity (compared to the crude culture medium).
  • Cell debris from the culture media is typically removed using centrifugation followed by a clarification step of the supernatant using e.g. microfiltration, ultrafiltration and/or depth filtration.
  • HA hydroxyapatite
  • affinity chromatography optionally involving an affinity tagging system such as polyhistidine
  • HIC hydrophobic interaction chromatography
  • the antibodies following various clarification steps, can be captured using Protein A or G affinity chromatography. Further chromatography steps can follow such as ion exchange and/or HA chromatography, anion or cation exchange, size exclusion chromatography and ammonium sulphate precipitation.
  • virus removal steps may also be employed (e.g. nanofiltration using e.g. a DV-20 filter).
  • a purified (for example a monoclonal) preparation comprising at least 75mg/ml or greater, or lOOmg/ml or greater, of the antigen binding protein is provided.
  • Such preparations are substantially free of aggregated forms of antigen binding proteins.
  • Bacterial systems may be used for the expression of antigen binding fragments. Such fragments can be localised intracellularly, within the periplasm or secreted extracellularly. Insoluble proteins can be extracted and refolded to form active proteins according to methods known to those skilled in the art, see Sanchez et al. (1999) J. Biotechnol. 72: 13-20; and Cupit et al. (1999) Lett Appl Microbiol 29: 273-277.
  • Deamidation is a chemical reaction in which an amide functional group is removed. In biochemistry, the reaction is important in the degradation of proteins because it damages the amide-containing side chains of the amino acids asparagine and glutamine. Asparagine is converted to a mixture of isoaspartate and aspartate. Deamidation of glutamine residues occurs at a much lower rate. Deamidation reactions are believed to be one of the factors that can limit the useful lifetime of a protein, they are also one of the most common post- translational modifications occurring during the manufacture of therapeutic proteins. For example, a reduction or loss of in vitro or in vivo biological activity has been reported for recombinant human DNAse and recombinant soluble CD4, whereas other recombinant proteins appear to be unaffected.
  • compositions Purified preparations of an antigen binding protein as described herein may be incorporated into pharmaceutical compositions for use in the treatment of the human diseases, disorders and conditions described herein.
  • diseases, disorders and conditions are used interchangeably.
  • the pharmaceutical composition can be used in the treatment of any diseases where amyloid deposits are present in the tissues and contribute to structural and functional damage leading to clinical illness.
  • SAP is always present in all amyloid deposits in vivo and the pharmaceutical composition comprising a therapeutically effective amount of the antigen binding protein described herein can be used in the treatment of diseases responsive to clearance of amyloid deposits from the tissues.
  • the pharmaceutical preparation may comprise an antigen binding protein in combination with a pharmaceutically acceptable carrier.
  • the antigen binding protein may be administered alone, or as part of a pharmaceutical composition.
  • compositions comprise a pharmaceutically acceptable carrier as known and called for by acceptable pharmaceutical practice, see e.g. Remingtons Pharmaceutical Sciences, 16th edition (1980) Mack Publishing Co.
  • pharmaceutically acceptable carriers include sterilised carriers such as saline, Ringers solution or dextrose solution, optionally buffered with suitable buffers to a pH within a range of 5 to 8.
  • compositions may be administered by injection or continuous infusion (e.g. intravenous, intraperitoneal, intradermal, subcutaneous, intramuscular or intraportal). Such compositions are suitably free of visible particulate matter. Pharmaceutical compositions may also be administered orally, specifically those containing CPHPC.
  • compositions may comprise between lmg to lOg of antigen binding protein, for example between 5 mg and 1 g of antigen binding protein.
  • the composition may comprise between 5 mg and 500 mg, for example between 5 mg and 50 mg.
  • compositions may comprise between 1 mg to 10 g of antigen binding protein in unit dosage form, optionally together with instructions for use. Pharmaceutical compositions may be lyophilised (freeze dried) for reconstitution prior to administration according to methods well known or apparent to those skilled in the art. Where antibodies have an IgGl isotype, a chelator of copper, such as citrate (e.g. sodium citrate) or EDTA or histidine, may be added to the pharmaceutical composition to reduce the degree of copper-mediated degradation of antibodies of this isotype, see EP0612251. Pharmaceutical compositions may also comprise a solubiliser such as arginine base, a detergent/anti-aggregation agent such as polysorbate 80, and an inert gas such as nitrogen to replace vial headspace oxygen.
  • a solubiliser such as arginine base
  • a detergent/anti-aggregation agent such as polysorbate 80
  • an inert gas such as nitrogen to replace vial headspace oxygen.
  • Effective doses and treatment regimes for administering the antigen binding protein are generally determined empirically and may be dependent on factors such as the age, weight and health status of the patient and disease or disorder to be treated. Such factors are within the purview of the attending physician. Guidance in selecting appropriate doses may be found in e.g. Smith et al (1977) Antibodies in human diagnosis and therapy, Raven Press, New York.
  • the dosage of antigen binding protein administered to a subject is generally between 1 ⁇ g/kg to 150 mg/kg, between 0.1 mg/kg and 100 mg/kg, between 0.5 mg/kg and 50 mg/kg, between 1 and 25 mg/kg or between 1 and 10 mg/kg of the subject's body weight.
  • the dose may be 10 mg/kg, 30 mg/kg, or 60 mg/kg.
  • the antigen binding protein may be administered parenterally, for example subcutaneously, intravenously or intramuscularly.
  • the SAP-depleting compound may be administered at a dose of between 0.1 mg/kg and 2 mg/kg, depending on its activity.
  • the SAP-depleting compound may be administered as a fixed dose, independent of a dose per subject weight ratio.
  • the SAP-depleting compound may be administered in one or more separate, simultaneous or sequential parenteral doses of 100 mg or less, of 50 mg or less, 25 mg or less, or 10 mg or less.
  • the effective daily dose of a therapeutic composition may be administered as two, three, four, five, six or more sub-doses administered separately at appropriate intervals throughout the day, optionally, in unit dosage forms.
  • the antigen binding protein may be administered in a single large dose or in smaller repeated doses.
  • the administration of a dose may be by slow continuous infusion over a period of from 2 to 24 hours, such as from 2 to 12 hours, or from 2 to 6 hours. This may result in reduced toxic side effects.
  • the administration of a dose may be repeated one or more times as necessary, for example, three times daily, once every day, once every 2 days, once a week, once a fortnight, once a month, once every 3 months, once every 6 months, or once every 12 months.
  • the antigen binding proteins may be administered by maintenance therapy, for example once a week for a period of 6 months or more.
  • the antigen binding proteins may be administered by intermittent therapy, for example for a period of 3 to 6 months and then no dose for 3 to 6 months, followed by administration of antigen binding proteins again for 3 to 6 months, and so on in a cycle.
  • the dose may be administered subcutaneously, once every 14 or 28 days in the form of multiple sub-doses on each day of administration.
  • the antigen binding protein may be administered to the subject in such a way as to target therapy to a particular site.
  • the antigen binding protein may be injected locally into a circumscribed local amyloid mass in the tissues, or infused into the blood supply to an amyloidotic organ.
  • the antigen binding protein must be used in combination with one or more other therapeutically active agents, specifically SAP depleting compounds, for the treatment of the diseases described herein. Effective depletion of SAP from the circulation must be achieved before administration of the SAP binding protein in order for the latter to be given both safely and effectively.
  • the SAP depleting compound is administered first so that almost all of the circulating SAP is cleared. Since this leaves substantial amounts of SAP associated with the amyloid deposits in the tissues the sequential administration of an anti-SAP antigen binding protein enables the localisation and specific binding to the amyloid deposits to promote their rapid and extensive regression.
  • the anti-SAP antigen binding protein may be administered 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 20 or 25 or more days after starting the treatment(s) with the SAP depleting compound.
  • the sequential administration may involve two or more sequential treatments with SAP depleting compound followed by two or more sequential treatments with the anti-SAP antigen binding protein.
  • the sequential administration may involve one treatment with SAP depleting compound followed by one sequential treatment with the anti-SAP antigen binding protein, which is then repeated one or more times.
  • the sequential/subsequent dose may be an amount that is more than the initial/previous dose or less than the initial/previous dose.
  • the administration of an initial dose of SAP-depleting compound protein may be followed by the administration of one or more sequential (e.g. subsequent) doses of SAP depleting compound and/or the anti-SAP antigen binding protein, and wherein said one or more sequential doses may be in an amount that is approximately the same or less than the initial dose.
  • the administration of further doses of SAP depleting compound and the first dose of anti-SAP antigen binding protein may be followed by the administration of one or more sequential (e.g. subsequent) doses, and wherein at least one of the subsequent doses is in an amount that is more than the initial dose.
  • the administration may use a pre-determined or routine schedule for administration, thereby resulting in a predetermined designated period of time between dose administrations.
  • the schedule may encompass periods of time which are identical or which differ in length, as long as the schedule is predetermined. Any particular combination would be covered by the schedule as long as it is determined ahead of time that the appropriate schedule involves administration on a certain day.
  • the pharmaceutical composition may comprise a kit of parts of the antigen binding protein together with other medicaments, optionally with instructions for use.
  • the kit may comprise the reagents in predetermined amounts with instructions for use.
  • the terms "individual”, “subject” and “patient” are used herein interchangeably.
  • the subject may be a primate (e.g. a marmoset or monkey).
  • the subject is typically a human.
  • Treatment can be therapeutic, prophylactic or preventative.
  • the subject will be one who is in need thereof. Those in need of treatment may include individuals already suffering from a particular medical disease in addition to those who may develop the disease in the future.
  • the SAP depleting compound followed by the SAP antigen binding protein described herein can be used for prophylactic or preventative treatment.
  • the sequential treatments described herein are administered to an individual in order to prevent or delay the onset of one or more aspects or symptoms of the disease.
  • the subject can be asymptomatic or may have a genetic predisposition to the disease, as amyloid deposits are known to be present in the tissues and to accumulate for periods of time before they cause sufficient damage to produce clinical symptoms.
  • Such sub-clinical amyloid deposition can be detected by histological examination of tissue biopsies or by non-invasive imaging procedures, including radiolabeled SAP scintigraphy, echocardiography and cardiac magnetic resonance imaging.
  • a prophylactically effective amount of the antigen binding protein is administered to such an individual.
  • a prophylactically effective amount is an amount which prevents or delays the onset of one or more aspects or symptoms of a disease described herein.
  • the antigen binding protein described herein may also be used in methods of therapy.
  • therapy encompasses alleviation, reduction, or prevention of at least one aspect or symptom of a disease.
  • the antigen binding protein described herein may be used to ameliorate or reduce one or more aspects or symptoms of a disease described herein.
  • the antigen binding protein described herein is used in an effective amount for therapeutic, prophylactic or preventative treatment.
  • a therapeutically effective amount of the antigen binding protein described herein is an amount effective to ameliorate or reduce one or more aspects or symptoms of the disease.
  • the antigen binding protein described herein may also be used to treat, prevent, or cure the disease described herein.
  • the antigen binding protein described herein can have a generally beneficial effect on the subject's health, for example it can increase the subject's expected longevity.
  • the antigen binding protein described herein need not affect a complete cure, or eradicate every symptom or manifestation of the disease to constitute a viable therapeutic treatment.
  • drugs employed as therapeutic agents may reduce the severity of a given disease state, but need not abolish every manifestation of the disease to be regarded as useful therapeutic agents.
  • a prophylactically administered treatment need not be completely effective in preventing the onset of a disease in order to constitute a viable prophylactic agent.
  • Antigen binding proteins described herein may be used in treating or preventing a disease associated with amyloid deposition i.e. amyloidosis.
  • Amyloidosis is any disease characterized by the extracellular accumulation of amyloid in various organs and tissues of the body.
  • the term “amyloid” refers to extracellular deposits in the tissues of insoluble protein fibres composed of fibrils with characteristic ultrastructural morphology, a cross- ⁇ sheet core structure and the pathognomonic histochemical tinctorial property of binding Congo red dye from alkaline alcoholic solution and then giving red-green dichroism when viewed microscopically in strong cross polarised light. About 25 different unrelated proteins are known to form amyloid fibrils which deposit in human tissues and share all these typical properties. Amyloid deposits in the brain substance, cerebral amyloid, differ somewhat from amyloid deposits elsewhere in the body in that they are always focal and microscopic in size, and are commonly referred to as amyloid plaques.
  • Amyloidosis that is disease directly caused by deposition of amyloid in the tissues, comprises both local amyloidosis, in which the deposits are confined to one anatomical region and/or one tissue or organ system, and systemic amyloidosis in which the deposits can occur in any organ or tissue in the body, including blood vessels and connective tissues.
  • the cause of amyloidosis can be either acquired or hereditary. Acquired amyloidosis arises as a complication of a preceding medical condition, which can itself be either acquired or hereditary.
  • amyloid A protein (AA) type is a complication of chronic active inflammatory diseases such as rheumatoid arthritis, juvenile rheumatoid arthritis, Crohn's disease, chronic infections and chronic sepsis, and of hereditary periodic fever syndromes such as familial Mediterranean fever, Muckle-Wells syndrome and CINCA syndrome.
  • Dialysis related amyloidosis is caused by accumulation of 2-microglobulin as a result of end stage renal failure.
  • Monoclonal immunoglobulin light chain (AL) amyloidosis is a complication of multiple myeloma or otherwise benign monoclonal gammopathy (monoclonal gammopathy of uncertain significance, MGUS).
  • Acquired amyloidosis of transthyretin type can occur without any preceding illness and is merely a complication of old age.
  • Hereditary amyloidosis is caused by mutations in the genes for various proteins which encode expression of variant proteins having an increased propensity to form amyloid fibrils, and includes disease caused by transthyretin, apolipoprotein Al, gelsolin, lysozyme, cystatin C and amyloid ⁇ -protein.
  • Alzheimer's disease AD
  • type 2 diabetes in which amyloid deposits are always present but in which the precise mechanisms causing these respective diseases are not yet known. Nevertheless the local deposition of amyloid in the brain and cerebral blood vessels in Alzheimer's disease, and in the pancreatic islets in diabetes is very likely to exacerbate pathology and disease. Accordingly, the present invention includes treatment of both Alzheimer's disease and type 2 diabetes, indeed of any condition associated with the presence of amyloid deposits in the tissues, with antigen binding proteins as disclosed herein.
  • transmissible spongiform encephalopathy are associated with amyloid deposits in the brain, and the present invention therefore relates to all these conditions, including variant Creutzfeldt-Jakob disease in humans, Creutzfeldt-Jakob disease itself, kuru and the various other forms of human prion disease, and also bovine spongiform encephalopathy, chronic wasting disease of mule-deer and elk, and transmissible encephalopathy of mink.
  • the antigen binding proteins described herein may be used to detect SAP in a biological sample in vitro or in vivo for diagnostic purposes.
  • the anti-SAP antigen binding proteins can be used to detect SAP in serum or in associated with amyloid e.g. amyloid plaques.
  • the amyloid may have been first removed (for example a biopsy) from a human or animal body.
  • Conventional immunoassays may be employed, including ELISA, Western blot, immunohistochemistry, or immunoprecipitation.
  • the antigen binding proteins may be provided in a diagnostic kit comprising one or more antigen binding proteins, a detectable label, and instructions for use of the kit.
  • the kit may comprise the reagents in predetermined amounts with instructions for use.
  • SAP-E and SAP-K are from two groups of anti-SAP monoclonals, each group having been tested separately for their binding to human SAP in vitro.
  • SAP-E and SAP-K showed the strongest binding to SAP, within their groups, and were compared with each other in different assays.
  • the first group of antibodies comprised antibodies from 7 hybridomas generated in a single conventional immunization with purified human SAP (SEQ ID NO:43 shown below) (details of method for purifying human SAP are given in Hawkins et al. (1991) Clin. Exp. Immunol. 84, 308-316) and fusion protocol and are designated SAP-A to SAP-G.
  • Two of these antibodies, SAP-E and SAP-B, are lgG2a isotype while the others are all IgGl isotype (see Example 13, Table 11).
  • the second group of antibodies comprised 6 different lgG2a monoclonals (SAP-H to SAP-M) derived by standard techniques from immunization with purified human SAP (SEQ ID NO:43 shown below) (Hawkins et al. (1991) Clin. Exp. Immunol. 84, 308-316) and a conventional fusion to produce hybridomas which were cloned by routine methods.
  • SAP-H to SAP-M 6 different lgG2a monoclonals derived by standard techniques from immunization with purified human SAP (SEQ ID NO:43 shown below) (Hawkins et al. (1991) Clin. Exp. Immunol. 84, 308-316) and a conventional fusion to produce hybridomas which were cloned by routine methods.
  • homo sapiens SAP mature amino acid sequence SEQ ID NO:43
  • mice SAP sequence which has a 69.4% identity with human SAP, is given below.
  • mus musculus SAP mature protein (SEQ ID NO:44)
  • AccessQuick RT-PCR System (A1702) was used to produce cDNA of the variable heavy and light regions using degenerate primers specific for the murine immunoglobulin gene leader sequences and murine lgG2a/ K constant regions.
  • the purified RT-PCR fragments were cloned using the TA cloning kit from Invitrogen (K2000-01).
  • a consensus sequence was obtained for each hybridoma by sequence alignment, and alignment with known immunoglobulin variable sequences listed in KABAT (Sequences of Proteins of Immunological Interest, 4th Ed., U.S. Department of Health and Human Services, National Institutes of Health (1987)).
  • the consensus sequences for SAP-E and SAP-K are shown below.
  • SAP-E CDRH2 (SEQ ID NO:2) YIYPGDGNANYNQQFKG
  • SAP-K VH amino acid sequence (SEQ ID N0:17) with CDRs underlined QVQLQQPGAELI KPGASVKLSCKASGYTFTSYWMHWVKQRPGQGLEWIGMIH PNSVNTNYNEKFKSK ATLTVDKSSSTAYMQLNSLTSEDSAVYYCARRN DYYWYFDVWGTGTTVTVSS
  • SAP-K V L amino acid sequence (SEQ ID N0:19) with CDRs underlined DIVMTQSQKFMSTSVGDRVSVTCKASQNVNSNVAWYQQKPGQSPKALIYSASYRYSGVPDRFTGSGSG TDFTLTITNVQSEDLAEYFCQQCNNYPFTFGSGTKLEIK
  • Chimeric antibodies comprising parent murine variable domains grafted onto human lgGl/ ⁇ wild-type constant regions were constructed by PCR cloning for SAP-E and SAP-K. Based on the consensus sequence, primers to amplify the murine variable domains were designed, incorporating restriction sites required to facilitate cloning into mammalian expression vectors.
  • FR4 Framework Region 4 (V-region sequence following CDR3 and preceding first constant domain)
  • amino acid sequence in SAP-E was changed from TTLTVSS as shown in SEQ ID NO:7 to TLVTVSS and the V
  • SAP-K variable light chain an internal EcoRI site was present in CDRLl and mutagenesis primers were designed to remove this undesired internal EcoRI site by changing one base pair - this did not change the amino acid sequence.
  • the full length heavy and light chain protein sequences of the SAP-E chimeric antibody (cSAP-E) are given in SEQ ID NO:21 and SEQ ID NO:22 respectively.
  • the full length heavy and light chain protein sequences of the SAP-K chimeric antibody (cSAP-K) are given in SEQ ID NO:23 and SEQ ID NO:24 respectively.
  • SAP-E VH chimera nucleotide sequence (SEQ ID NO:45) CAGGCTTCTCTACAGCAGTCTGGGACTGAGCTGGTGAGGTCTGGGGCCTCAGTGAAGATGTCCTGC A AG G CTTCTG G CTTC AC ATTTG CC ACTTAC A ATATG C ACTG G ATTA AG CAGACACCCGGACAGGGCC TGGAATGGATTGGGTATATTTATCCTGGAGATGGTAATGCTAACTACAATCAGCAGTTCAAGGGCAA GGCCACATTGACTGCAGACACATCCTCCAACACAGCCTACATGCAGATCAGCAGCCTGACATCTGAA G ACTCTG CG GTCT ATTTCTGTG C A AG AG G G G G G ACTTTG ATT ACG ACG G AG G GTACTACTTTG ACTCCT GGGGCCAGGGCACACTAGTGACCGTGTCCAGCGCCAGCACCAAGGGCCCCAGCGTGTTCCCTGG CCCCCAGCAGCAAGAGCACCAGCGGCGGCACAGC
  • SAP-K VL chimera nucleotide sequence (SEQ ID NO:48) GACATTGTGATGACCCAGTCTCAAAAATTCATGTCCACATCAGTAGGAGACAGGGTCAGCGTCACCT GCAAGGCCAGTCAGAATGTGAACTCTAATGTAGCCTGGTATCAACAGAAACCAGGGCAATCTCCTA AAG CACTG ATTTACTCG GCTTCCTACCG GTACAGTG G AGTCCCTG ATCG CTTC AC AGG CAGTG G ATC TGGGACAGATTTCACTCTCACCATCACCAATGTGCAGTCTGAAGACTTGGCAGAGTATTTCTGTCAG CAATGTAACAACTATCCATTCACGTTCGGCTCGGGGACAAAGTTGGAAATAAAACGTACGGTGGCC GCCCCCAGCGTGTTCATCTTCCCCCAGCGATGAGCAGCTGAAGAGCGGCACCGCCAGCGTGGTG TGTCTGCTGAACAACTTCTACCCCCGGGAGCTGAAGCGATGAGCAGCTGAAGAGCGGCACCGCCAGC
  • Humanised antibodies were generated by a process of grafting CDRH1, CDRH2, CDRH3, CDRLl, CDRL2 and CDRL3 from the murine antibody onto a suitable human framework sequence.
  • SAP-E mouse variable heavy chain sequence a human germ line acceptor framework was selected (IGHV1-69, SEQ ID NO:25) which had 60% identity (including CDRs) with the mouse SAP-E variable heavy chain sequence (SEQ ID NO:7) together with the JH1 minigene (Kabat: AEYFQHWGQGTLVTVSS (SEQ ID NO:26)).
  • the first six residues of the JH1 minigene residues fall within the CDR3 region and were replaced by the incoming CDR from the donor antibody.
  • Construct HO was a straight graft of murine CDRs (using the Kabat definition) into the human acceptor framework selected above.
  • Construct HI has additional back-mutations at residues 27 and 30.
  • Constructs H2 and H3 were based on HI with additional back-mutations at residues 2 (H2), and 48 and 67 (H3).
  • Construct H4 was based on H3 with additional back-mutations at residues 69, 73 and 91. See Table 3.
  • sequences of the humanised variable heavy domains of HO, HI, H2, H3 and H4 are given below (SEQ ID NO:27, SEQ ID NO:28 SEQ ID NO:29, SEQ ID NO:30 and SEQ ID NO:31 respectively).
  • a human germ line acceptor framework was selected (IGKVl-39, SEQ ID NO:32) which had 68% identity (including CDRs) with the mouse SAP-E variable light chain sequence (SEQ ID No:9) together with the J-region kappa 2 minigene (Kabat: YTFGQGTKLEIK, SEQ ID NO:33)) based on sequence similarity.
  • the first two residues of the JK-2 minigene residues fall within the CDR3 region and were replaced by the incoming CDR from the donor antibody.
  • Three humanised variants were generated on the basis of sequence comparison and possible impact on antibody function.
  • Construct LO was a straight graft of murine CDRs (using the Kabat definition) into the human acceptor framework selected above.
  • Construct LI has a back-mutation at residue 49 and construct L2 has back mutations at positions 48 and 49. See Table 4.
  • sequences of the humanised variable light domains of LO, LI and L2 are given below (SEQ ID NO:34, SEQ ID NO:35 and SEQ ID NO:36 respectively).
  • SAP-K mouse variable heavy chain sequence a human germ line acceptor framework was selected (IGHV1-69, SEQ ID NO:25) which had 65% identity (including CDRs) with the mouse SAP-K variable heavy chain sequence (SEQ ID NO:17) together with the JH1 minigene (Kabat: AEYFQHWGQGTLVTVSS (SEQ ID NO:26)).
  • the first six residues of the JH1 minigene residues fall within the CDR3 region and were replaced by the incoming CDR from the donor antibody.
  • Construct HO was a straight graft of murine CDRs (using the Kabat definition) into the human acceptor framework selected above.
  • Construct HI has additional back-mutations at residues 27 and 30.
  • Construct H2 was based on HI with additional back-mutations at residues 48 and 67.
  • Construct H3 was based on H2 with additional back-mutations at residues 69 and 71. See Table 5.
  • sequences of the humanised variable heavy domains of HO, HI, H2 and H3 are given below (SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:39 and SEQ ID NO:40 respectively).
  • SAP-K mouse variable light chain sequence a human germ line acceptor framework was selected (IGKV1-39, SEQ ID NO:32) which had 63% identity (including CDRs) with the mouse SAP-K variable light chain sequence (SEQ ID NO:19) together with the J-region kappa 2 minigene (Kabat: YTFGQGTKLEIK, SEQ ID NO:33) based on sequence similarity.
  • the first two residues of the JK-2 minigene residues fall within the CDR3 region and were replaced by the incoming CDR from the donor antibody.
  • Construct LO was a straight graft of murine CDRs (using the Kabat definition) into the human acceptor framework selected above.
  • Construct LI has a back-mutation at residue 46.
  • sequences of the humanised variable light domains of LO and LI are given below (SEQ ID NO:41 and SEQ ID NO:42 respectively).
  • the humanised variable region DNA sequences were sequence optimised. DNA fragments encoding the humanised variable heavy and variable light regions were constructed de novo using a PCR-based strategy and overlapping oligonucleotides. The PCR product was cloned into mammalian expression vectors containing the human gamma 1 constant region and the human kappa constant region respectively. This is the wild-type Fc region.
  • IGHVl-69 human variable heavy chain germline acceptor nucleotide sequence (SEQ ID NO:49) CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGTCCTCGGTGAAGGTCTCCTG C A AG G CTTCTG G AG G C ACCTTC AG C AG CT ATG CT ATC AG CTG GGTGCGACAGG CCCCTG G AC A AG G GCTTGAGTGGATGGGAGGGATCATCCCTATCTTTGGTACAGCAAACTACGCACAGAAGTTCCAGGG CAGAGTCACGATTACCGCGGACAAATCCACGAGCACAGCCTACATGGAGCTGAGCAGCCTGAGATC TGAGGACACGGCCGTGTATTACTGTGCGAGA IGHVl-69 human variable heavy chain germline acceptor amino acid sequence (SEQ I D NO:25)
  • SAP-E humanised heavy chain V region variant HO nucleotide sequence non-codon optimised (SEQ ID NO:51) CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGTCCTCGGTGAAGGTCTCCTG CAAGGCTTCTGGAGGCACCTTCAGCACTTACAATATGCACTGGGTGCGACAGGCCCCTGGACAAGG GCTTGAGTGGATGGGATATATTTATCCTGGAGATGGTAATGCTAACTACAATCAGCAGTTCAAGGGC AG AGTCACG ATTACCGCG G AC AAATCCACG AG CAC AG CCTAC ATG G AG CTG AG CTG AG C AGCCTG AG ATCT GAGGACACGGCCGTGTATTACTGTGCGAGAGGGGACTTTGATTACGACGGAGGGTACTACTTTGAC TCCTGGGGCCAGGGCACCCTGGTCACCGTCCTCA
  • SAP-E humanised light chain V region variant LP nucleotide sequence non-codon optimised SEQ I D NO:52
  • SAP-E humanised heavy chain V region variant HO nucleotide sequence (codon optimised) (SEQ I D NO:53) CAGGTGCAGCTGGTGCAGAGCGGCGCCGAGGTGAAGAAACCCGGCAGCAGCGTGAAGGTGAGCT GCAAGGCTAGCGGGGGCACCTTCTCCACCTACAACATGCACTGGGTCAGGCAGGCACCCGGCCAGG GCCTGGAGTGGATGGGCTATATCTACCCCGGCGACGGCAACGCCAACTACAACCAGCAGTTCAAGG GCAGGGTGACCATCACCGCCGACAAGAGCACCAGCACCGCCTACATGGAACTGAGCAGCCTGAGG AGCGAGGATACCGCCGTGTACTACTGCGCCAGGGGCGACTTCGACTACGACGGCGGCTACTACTTC GACAGCTGGGGACAGGGCACACTAGTGACCGTGTCCAGC SAP-E humanised heavy chain V region variant HO amino acid sequence (SEQ ID NO:27)
  • SAP-E humanised heavy chain V region variant HI nucleotide sequence (codon optimised) (SEQ I D NO:54)
  • SAP-E humanised heavy chain V region variant HI amino acid sequence (SEQ ID NO:28)
  • SAP-E humanised heavy chain V region variant H3 amino acid sequence (SEQ ID NO:30) QVQLVQSGAEVKKPGSSVKVSCKASGFTFATYNMHWVRQAPGQGLEWIGYIYPGDGNANYNQQFKG RATITADKSTSTAYMELSSLRSEDTAVYYCARGDFDYDGGYYFDSWGQGTLVTVSS
  • SAP-E humanised heavy chain V region variant H4 nucleotide sequence (codon optimised) (SEQ I D NO:57)
  • SAP-E humanised light chain V region variant LP nucleotide sequence (codon optimised) (SEQ I D NO:58) GACATCCAGATGACCCAGAGCCCCAGCTCACTGAGCGCCAGCGTGGGCGACAGGGTGACCATTACC TGCAGGGCCTCCGAGAACATCTACAGCTACCTGGCCTGGTACCAGCAGAAGCCCGGCAAGGCCCCC AAGCTGCTGATCTACAACGCCAAGACCCTCGCCGAGGGCGTCCCTAGCAGGTTCTCTGGAAGCGGC AG CG GC ACCG ACTTCACCCTG ACCATCAG CAG CCTG C AGCCCG AG G ACTTCGCC ACCTATTACTG CC AG CACCACTACG GCGCCCCJG ACCTTTGG CC AGG G CACCAAACTG G AG ATC AAG
  • SAP-E humanised light chain V region variant LI nucleotide sequence (codon optimised) (SEQ I D NO:59)
  • SAP-E humanised light chain V region variant LI amino acid sequence (SEQ ID NO:35)
  • SAP-E humanised light chain V region variant L2 nucleotide sequence (codon optimised) (SEQ I D NO:60)
  • SAP-E humanised light chain V region variant L2 amino acid sequence (SEQ I D NO:36) DIQMTQSPSSLSASVGDRVTITCRASEN IYSYLAWYQQKPGKAPKLLVHNAKTLAEGVPSRFSGSGSGTD FTLTISSLQPEDFATYYCQHHYGAPLTFGQGTKLEI K SAP-E humanised heavy chain HI full mature nucleotide sequence (codon optimised) (SEQ I D NO:61)
  • SAP-E humanised heavy chain HI full mature amino acid sequence (SEQ ID NO:62) QVQLVQSGAEVKKPGSSVKVSCKASGFTFATYNMHWVRQAPGQGLEWMGYIYPGDGNANYNQQFK GRVTITADKSTSTAYMELSSLRSEDTAVYYCARGDFDYDGGYYFDSWGQGTLVTVSSASTKGPSVFPLAP SSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICN VN HKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPE VKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG QPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVE
  • SAP-E humanised light chain LI full mature nucleotide sequence (codon optimised) (SEQ I D NO:63) GACATCCAGATGACCCAGAGCCCCAGCTCACTGAGCGCCAGCGTGGGCGACAGGGTGACCATTACC TGCAGGGCCTCCGAGAACATCTACAGCTACCTGGCCTGGTACCAGCAGAAGCCCGGCAAGGCCCCC AAGCTGCTGATCCACAACGCCAAGACCCTCGCCGAGGGCGTCCCTAGCAGGTTCTCTGGAAGCGGC AG CG GC ACCG ACTTCACCCTG ACCATCAG CAG CCTG C AGCCCG AG G ACTTCGCC ACCTATTACTG CC AGCACCACTACGGCGCCCCTGACCTTTGGCCAGGGCACCAAACTGGAGATCAAGCGTACGGTGG CCGCCCAGCGTGTTCATCTTCCCCCAGCGATGAGCAGCTGAAGCGGCACCGCCAGCGTGG TGTCTGCTGAACAACTTCTACCCCCGGGAGGCCAAGGTGCAG
  • SAP-K humanised heavy chain V region variant HO nucleotide sequence non-codon optimised SEQ ID NO:65
  • SAP-K humanised heavy chain V region variant HP nucleotide sequence (codon optimised) (SEQ IS NO:67) CAGGTGCAGCTGGTGCAGAGCGGCGCCGAAGTGAAGAAGCCCGGCAGCAGCGTGAAAGTGAGCT GCAAGGCCAGCGGCGGAACCTTCAGCAGCTACTGGATGCACTGGGTGAGGCAGGCACCCGGCCAG GGCCTGGAGTGGATGGGCATGATCCACCCCAACAGCGTGAACACCAACTACAACGAGAAGTTCAAG AGCAGAGTGACCATCACCGCCGACAAGAGCACCAGCACCGCCTATATGGAGCTGAGCTCTCTGAGG AGCGAGGATACCGCCGTGTACTACTGCGCCAGGAGGAACGACTACTACTGGTACTTCGACGTCTGG G GCC AG GG CACACTAGTG ACCGTGTCCAG C
  • SAP-K humanised heavy chain V region variant HP amino acid sequence SEQ I D NO:37
  • SAP-K humanised heavy chain V region variant HI nucleotide sequence (codon optimised) (SEQ I D NO:68)
  • SAP-K humanised heavy chain V region variant H2 nucleotide sequence (codon optimised) (SEQ I D NO:69)
  • SAP-K humanised heavy chain V region variant H2 amino acid sequence (SEQ I D NO:39)
  • SAP-K humanised heavy chain V region variant H3 amino acid sequence (SEQ I D NO:40)
  • SAP-K humanised light chain V region variant LP amino acid sequence (SEQ I D NO:41)
  • SAP-K humanised light chain V region variant LI nucleotide sequence (codon optimised) (SEQ I D NO:72)
  • SAP-K humanised H3 heavy chain nucleotide sequence (codon optimised) (SEQ ID NO:75)
  • SAP-K humanised H3 heavy chain amino acid sequence (SEQ I D NO:76)
  • SAP-K humanised LP light chain nucleotide sequence (codon optimised) (SEQ ID NO:77) GACATCCAGATGACCCAGAGCCCCTCTTCACTGAGCGCTAGCGTGGGCGACAGGGTGACCATCACC TGCAAGGCCAGCCAGAACGTGAACAGCAACGTGGCCTGGTACCAGCAGAAGCCCGGCAAAGCCCC CAAGCTCCTGATCTACAGCGCCAGCTACAGATATAGCGGCGTGCCTAGCAGGTTTAGCGGCAGCGG AAGCGGGACCGATTTCACCCTGACCATCAGCAGCCTGCAGCCCGAGGACTTCGCCACTTACTACTGC CAGCAGTGCAACAACTACCCCTTCACCTTCGGCCAGGGCACCAAGCTGGAGATCAAGCGTACGGTG GCCGCCCAGCGTGTTCATCTTCCCCCCCAGCGATGAGCAGCTGAAGAGCGGCACCGCCAGCGTG GTGTGTCTGCTGAACAACTTCTACCCCCGGGAGGCACCGCCAGCGTG GTGTGTCTGCTGAACAACT
  • Example 4 - Antibody expression Recombinant antibody expression
  • Expression plasmids encoding the heavy and light chains respectively of chimeric or humanised antibodies were transiently co-transfected into HEK2936E cells by lipid transfection using Fectin 293.
  • Cells were grown in Freestyle expression media 293 with 10% pluronic F68 and 50mg/ml geneticin, 37 degrees C, 5% C02 for 72 - 120 hrs, supernatant was harvested by centrifugation. In some instances the supernatant material was used as the test article in binding assays. In other instances, the supernatant material was filter sterilised and the antibody recovered by affinity chromatography using Protein A MAbSelect SuRE column followed by dialysis into PBS.
  • the hybridoma cells were grown in shake flasks in Ex620 medium supplemented with 4mM glutamax and 10% low IgG FCS. The cells were passaged and weaned off serum until growing well in serum free medium. The cells were then used as a seed for a 10L wavebag. The cells were grown in the wavebag at 22 rocks/min, 37 degrees C, 5% C02 @ O.lL/min until viability dropped to 30%. The conditioned medium was collected by sterile filtration. Antibody was recovered by affinity chromatography using recombinant Protein A followed by dialysis into PBS.
  • Examples 5-7 Comparative data between hybridomas and/or chimeric mAbs and/or humanised Mabs
  • Figure 1 shows the binding curves for murine antibodies SAP-E and SAP-K at a 1 ⁇ g/mL coating concentration of human SAP.
  • Figure 2 shows the binding curves for murine antibodies SAP-E and SAP-K at a 5 ⁇ g/mL coating concentration of human SAP.
  • SAP-K and SAP-E showed similar binding to the immobilised human SAP, whereas at the 1 ⁇ g/mL lower density coating SAP-K showed greater binding than the SAP-E. All subsequent human SAP binding ELISAs using this format used the lower density 1 ⁇ g/mL coating concentration to distinguish between the binding properties of the two antibodies.
  • Figure 4 shows the binding curves for SAP-K H0L0, SAP-K H1L0, SAP-K H2L0 and SAP-K H3L0 compared to the SAP-K chimera and the SAP-E H1L1 compared to the SAP-E chimera.
  • An irrelevant human IgGl kappa antibody was also tested as a negative control. The data shows that humanisation of the SAP-K antibody resulted in a loss of human SAP binding activity of approximately 2-fold compared to the parental SAP-K chimera, whilst the humanised SAP-E antibody retained binding activity compared to the parental SAP-E chimera.
  • Example 7 Competition ELISA ELISA plates were coated with human SAP at either ⁇ g/mL (for competition with SAP-K chimera) or 5 ⁇ g/mL (for competition with SAP-E chimera) and blocked with 1% BSA/PBS.
  • a constant concentration of chimeric anti-SAP imAb was mixed with serial diluted (1:1) amounts of mouse anti-SAP imAbs. Plates were washed and the amount of chimeric antibody bound to the immobilised human SAP was detected using goat anti-human Kappa Light chain peroxidase conjugate (Sigma, A7164).
  • the ELISA was developed using O- phenylenediamine dihydrochloride (OPD) peroxidase substrate (Sigma, P9187).
  • OPD O- phenylenediamine dihydrochloride
  • Figure 5 shows purified SAP-K and SAP-E murine monoclonal antibodies in the competition ELISA with the SAP-E chimera.
  • Figure 6 shows purified SAP-K and SAP-E murine monoclonal antibodies in the competition ELISA with the SAP-K chimera.
  • Human and cynomologus monkey SAP were immobilised on a Biacore CI chip by primary amine coupling in accordance with the manufacturer's instructions.
  • Humanised anti-SAP antibody contained in culture supernatants and purified chimeric antibodies at 512nM were passed over both human and cynomologus monkey SAP surfaces and binding sensograms obtained.
  • _AII runs were double referenced with a buffer injection for purified sample or media for the supernatant samples over the human and cyno SAP surfaces. Analysis was carried out at 25 C using HBS-EP buffer. Regeneration of surface was done in the presence of 3M MgCI2 and did not affect the ability of antibodies to rebind to human SAP in a subsequent cycle. Data were analysed using the 1 to 1 dissociation model within the Biacore T100 evaluation software.
  • Tables 6a and 6b show off-rates (kd) of the humanised SAP-E and SAP-K antibody supernatants respectively. The values were based on a single curve and used for ranking purposes between the different constructs for binding to human SAP.
  • Humanised SAP-E antibodies showed better off-rates than the humanised SAP-K antibodies for binding human SAP.
  • a number of the SAP-K humanised antibody variants showed binding to cynomologus monkey SAP (N.B. the SAP-K chimera bound cynomologus monkey SAP) whilst none of the humanised SAP-E antibody variants bound cynomologus monkey SAP (N.B. the SAP-E chimera likewise did not bind cynomologous monkey SAP).
  • Humanised SAP-E variants which contained either the straight graft humanised heavy chain (HO) or the straight graft humanised light chain (L0) or a combination of both showed the poorest off- rates.
  • the SAP-E humanised LI light chain was the best light chain variant and combination of the LI with the HI heavy chain variant gave a humanised antibody with an acceptable off- rate whilst keeping the number of back mutations to a minimum.
  • Off-rate ranking of the humanised SAP-K variants showed the L0 straight graft to be the best humanised light chain variant and the HO straight graft to be the poorest humanised heavy chain variant.
  • Table 6a Table 6a
  • Human SAP was immobilised on a Biacore CM3 chip by primary amine coupling in accordance with the manufacturer's instructions. Anti SAP antibodies were passed over this surface at 512, 128, 32, 8, 2, 0.5nM and binding sensorgrams obtained. All runs were double referenced with a buffer injection over the human SAP surface. Analysis was carried out at 25 C using HBS-EP buffer. Regeneration of surface was done by allowing buffer to flow over the surface for several minutes and did not affect the ability of human SAP to rebind antibodies in a subsequent cycle. Data were analysed from the 128 - 0.5nM runs using the bivalent analyte model inherent to the Biacore T100 evaluation software.
  • O-phosphoethanolamine was immobilised on a Biacore CM5 chip by primary amine coupling in accordance with the manufacturer's instructions. Human SAP was then captured on the surface in the presence of calcium chloride, in order to replicate in the Biacore system in vitro, the precise orientation of SAP molecules bound to amyloid fibrils in vivo. Anti SAP antibodies were then passed over this surface at 256, 64, 16, 4, InM and a binding sensorgrams obtained. Analysis was carried out at 25°C using 4% BSA, lOmM Tris, 140mM NaCI, 2mM CaCI 2 , 0.05% surfactant P20, 0.02% NaN 3 , pH 8.0 as running buffer.
  • Tris-EDTA lOmM Tris, 140mM NaCI, lOmM EDTA, pH 8.0
  • Data generated were double referenced with a buffer injection over the human SAP surface and analyzed using the bivalent analyte model in the Biacore T100 evaluation software.
  • the data generated, as shown in Table 8, are intended only for comparison between the constructs. They do not constitute accurate kinetic values, due to possible modification of binding by the avidity effect inherent in the assay format. Avidity is more likely to have affected antibody dissociation rates, leading to lower calculated KD values. Furthermore, for all the SAP-E antibodies, the dissociation rate (kd) obtained is outside the limit of the Biacore measurement range. Nevertheless, the results indicate tight binding of the anti-SAP antibodies to human SAP immobilised by interaction of the SAP with a solid phase ligand, just as it is in amyloid deposits in vivo, which is the therapeutic target of the present invention.
  • Site-directed saturation mutagenesis was used to generate a panel of variants where the cysteine residue at position 91 (Kabat numbering) was potentially substituted with all other 19 amino acids in a single reaction by using a mutagenesis primer encoding NNK at this position (where N codes for adenosine or cytidine or guanosine or thymidine and K codes for guanisine or thymidine). From Biacore off-rate ranking carried out on antibody supernatant for the variants generated, four were selected for scale up in the HEK2936E cells and purification.
  • SAP-K humanised light chain V region variant LP 91A nucleotide sequence (codon optimised) (SEQ ID NO:73)
  • SAP-K humanised light chain V region variant LP 91A amino acid sequence (SEQ ID NO:74)
  • Example IP Complement dependence of amyloid clearance by anti-SAP antibody.
  • amyloid enhancing factor an extract of amyloidotic tissue containing amyloid fibrils
  • Casein elicits persistent acute inflammation and a sustained increase in serum amyloid A protein (SAA) production leading to AA amyloid deposition in all animals.
  • SAA serum amyloid A protein
  • mice Ten days after the 125 I-SAP tracer injection, all mice were 'loaded' with human SAP by a single intraperitoneal injection of 10 mg per mouse of isolated pure human SAP.
  • Human SAP injected into amyloidotic mice localises in the amyloid deposits and persists there with a half life of about 3-4 days whilst any human SAP not bound to amyloid is cleared from the circulation with a half life of about 3-4 hours (Hawkins et al, (1988) J. Exp. Med,, 167: 903-913 and Pepys et al, (2002) Nature, 41 7: 254- 259).
  • mice except two in each of the complement knockout groups received a single intraperitoneal injection of 1 ml of the whole IgG fraction (batch no. 2866) of monospecific sheep anti-human SAP antiserum at 50 mg/ml in solution in phosphate buffered saline (PBS), containing 7 mg/ml of actual anti-SAP antibody.
  • PBS phosphate buffered saline
  • the antiserum was produced by The Binding Site Ltd, Birmingham, UK, using human SAP (rigorously purified to 100% in the University College London Centre for Amyloidosis and Acute Phase Proteins) and proprietary immunisation procedures.
  • the scores of 1-5 represent an approximately log base 10 ranking scale from 1, corresponding to one or two tiny specks of amyloid among several sections of a particular organ, to 5, corresponding to abundant widespread deposits comprising about 10,000 times more amyloid than grade 1 (Botto et a I, (1997) Nature Med., 3: 855-859).
  • the scores of the different observers were always highly concordant although some observers also used intermediate integer.5 scores.
  • the arithmetic mean of the scores of all observers for each organ in each animal were used for statistical analysis. Results
  • Complement activation by IgG antibody requires the whole intact molecule, including the Fc region, and proceeds via the classical pathway initiated by binding of Clq. However, in some antibody-antigen systems, complement activation via the alternative pathway can be mediated by the F(ab) 2 fragment.
  • F(ab) 2 anti-SAP antibody which was produced by pepsin cleavage at pH 4.0 of the IgG fraction of the sheep polyclonal anti- human SAP antiserum (batch 2866) and purified by standard methods.
  • AA amyloidosis was induced and confirmed in wild-type C57BL/6 mice as detailed in Example 10 above.
  • groups of mice were treated with whole IgG fraction of the sheep polyclonal anti-human SAP antiserum, with buffer vehicle alone or with the F(ab) 2 fragment of the IgG fraction.
  • the dose of anti-SAP antibody activity injected was 7.28 mg per mouse receiving F(ab) 2 and 7 mg (50 mg of total IgG as usual) per mouse receiving whole IgG. All mice were killed 14 days later for estimation of amyloid load by Congo red staining.
  • mice receiving IgG anti-SAP antibody Clearance of amyloid deposits was almost complete in mice receiving IgG anti-SAP antibody compared to the massive amyloid deposits in the control mice receiving vehicle alone.
  • the mice receiving F(ab) 2 had less amyloid than untreated controls, but still substantially more than the mice treated with whole IgG anti-SAP antibody (Table 9).
  • the molar dose of F(ab) 2 anti-SAP antibody used in this study was about one third greater than that of IgG antibody, due to the smaller molecular weight of the F(ab) 2 fragment compared to whole IgG.
  • the Fc is required. This is not because of direct involvement of cellular recognition by Fc(y) receptors since the whole IgG was even less effective in complement deficient mice than was F(ab) 2 in complement sufficient mice. It is likely that the high dose of F(ab) 2 that was administered was able to activate some complement via the alternative pathway.
  • mice After induction and confirmation of AA amyloidosis in wild-type mice, using the protocol detailed in Example 10 above, all animals received a single intraperitoneal dose of 10 mg of isolated pure human SAP to load their deposits with human SAP. The test group then received 0.3 ml of liposomal clodronate intraperitoneally immediately and on days 2, 7 and 14 thereafter. One control group and the test group received a single intraperitoneal dose of 50 mg of the IgG fraction of sheep anti-human SAP antiserum on day 3 after the human SAP injection. A second control group received no anti-SAP and no other additional treatment. All mice were killed for estimation of amyloid load by Congo red staining 14 days after administration of the anti-SAP to the test and antibody control groups. Results
  • mice which received the liposomal clodronate in a regime known to completely ablate macrophage function there was no clearance of amyloid deposits (Table 10).
  • Example 13 Efficacy of mouse monoclonal anti-human SAP antibody, SAP-E, in clearing mouse systemic AA amyloid deposits.
  • SAP knockout C57BL/6 mice transgenic for human SAP were created by crossing pure line C57BL/6 animals in which the mouse SAP gene has been deleted (Botto et a I, (1997) Nature Med., 3: 855-859) with C57BL/6 mice bearing a human SAP transgene (Yamamura et a I, (1993) Mot. Reprod. Dev., 36: 248-250 and Gillmore et a I, (2004) Immunology, 112: 255- 264). These mice thus lack mouse SAP but express human SAP at concentrations significantly greater than those seen in man.
  • each mouse received a single dose of 5 mg CPHPC by intraperitoneal injection, to deplete their circulating human SAP, followed 5h later via the same route by either the standard sheep polyclonal anti-human SAP IgG fraction (batch 2866, 1 ml at 50 mg/ml total protein containing 7 mg/ml anti-human SAP antibody) or 5 mg of one of nine different isolated pure monoclonal anti-human SAP antibodies (Table 11). All mice were killed 21 days after the antibody injection and amyloid load was determined by Congo red histology of their spleens. Table 11. The presence of amyloid in spleen of mice with systemic AA amyloidosis after treatment with CPHPC and various anti-human SAP antibodies.
  • SAP-E is of the mouse lgG2a isotype which is known to activate mouse complement while all the other monoclonals except SAP-B were mouse IgGl isotype which is not complement activating.
  • SAP-B is a mouse lgG2a isotype, its binding to SAP in vitro was notably less than that of SAP-E and evidently was not sufficient in vivo to be effective.
  • Example 14 Comparative characterisation of monoclonal mouse anti-human SAP antibodies, SAP-K and SAP-E, in vitro.
  • SAP-K was selected from among the 6 different, most avidly binding, mouse lgG2a monoclonals, derived by standard techniques from immunization with purified human SAP and a conventional fusion to produce hybridomas which were cloned by routine methods. Among these lgG2a antibodies, SAP-K showed the greatest binding to immobilised human SAP. This was the case regardless of whether the human SAP had been directly immobilised on plastic surfaces by non-specific adherence or by covalent attachment, or by the specific calcium dependent binding of SAP to immobilised ligands, whether amyloid fibrils or the small molecule ligand, phosphoethanolamine.
  • SAP-K also bound well to directly immobilised SAP in the presence or absence of calcium, and if the SAP had previously been complexed with CPHPC and then covalently 'fixed' in the decameric SAP-CPHPC complex (Pepys, M.B. et al (2002) Targeted pharmacological depletion of serum amyloid P component for treatment of human amyloidosis. Nature, 417: 254-259; Kolstoe, S.E. et al (2009) Molecular dissection of Alzheimer's disease neuropathology by depletion of serum amyloid P component. Proc. Natl. Acad. Sci. USA, 106: 7619-7623). SAP-E also bound well to human SAP in all these different configurations.
  • SAP-E binds optimally when more than one SAP molecule lies closely associated with another whilst SAP-K binds avidly to single isolated SAP molecules.
  • Figure 7 shows immunoradiometric assay for binding of monoclonal mouse antibodies to human SAP captured by immobilised sheep polyclonal anti-human SAP antibody. Substantially more SAP-E than SAP-K bound at all concentrations of human SAP offered. Each point is the mean of 3 replicates.
  • both SAP-E and SAP-K bound apparently equally well to native human SAP, shown by the similar immunoprecipitation of both antibodies in double immunodiffusion in agarose gel against both isolated pure human SAP and whole human serum.
  • the similar binding of these two mouse monoclonal antibodies was reflected in the similar parameters measured in the Biacore instrument (BIAcoreX, Pharmacia Biosensor AB, Uppsala, Sweden) using human SAP covalently immobilised on the chip (Table 12).
  • SAP-E bound to human SAP in western blotting from reduced SDS-PAGE.
  • SAP-E thus recognises denatured human SAP while SAP-K only recognises native human SAP and must be binding to a conformational epitope.
  • SAP-E The epitope recognised by SAP-E must therefore be in the region 140-158 which evidently comprises some denaturation resistant secondary structure since SAP-E binding is not potently inhibited by the peptides 136-147, 138-149, 140-151 and 112-119 in solution. This is consistent with the kinetic stability and resistance to denaturation of SAP (Manning, M. and Colon, W. (2004) Biochemistry, 43: 11248-11254).
  • Figure 8 shows epitope mapping for monoclonal anti-human SAP antibody, SAP-E.
  • A complete amino acid sequence of human SAP showing the points at which it is cleaved by CN Br in 70%TFA (residue 159M) and by chymotrypsin, without reduction/carbamidomethylation, in ammonium bicarbonate in the absence of calcium, (residues 140Y and 144F).
  • B SDS-PAGE analysis of SAP cleaved with CN Br.
  • Lane 6 contained isolated pure human CRP with which the SAP-5 did not react at all.
  • C SDS-PAGE analysis of SAP digested with chymotrypsin.
  • Left panel Coomassie blue stain; lane 1, untreated control SAP; lane 2, SAP after chymotrypsin digestion, showing the expected major fragments corresponding to residues 1-140 and 145-204. These were precisely confirmed by mass spectrometry.
  • Right panel Western blot with SAP-E showing intense staining of intact untreated SAP in lanes 1 (500 ng loaded) and 2 (100 ng), and also residual intact SAP in lanes 3 and 4 which contained the chymotrypsin digested SAP at different loadings.
  • the conformational epitope recognised by SAP-K was identified by CLI PS ® technology epitope mapping (Pepscan Presto BV) as the exposed peripheral loop, residues 121-131, at the circumference of the disc like pentameric native SAP molecule.
  • Figure 9 shows the location of the epitopes on human SAP recognised by SAP-K (A, highlighted in black, as determined by CLIPS ® technology) and SAP-E (B, shown in white, 140-158 as determined by binding results with the CN Br cleavage product of SAP and the fragment released by chymotrypsin digestion in the absence of calcium).
  • Example 15 Efficacy of SAP-K mouse monoclonal anti-human SAP antibody in clearing amyloid deposits in vivo in the mouse AA amyloidosis model.
  • the potency of SAP-K was compared with the action of the standard sheep polyclonal antibody in clearing established systemic AA amyloid deposits in mice.
  • mice I nduction of AA amyloidosis and treatment AA amyloidosis was induced and confirmed in wild-type C57BL/6 mice as detailed in Example 10 above.
  • groups of mice were treated with 50 mg per mouse of total IgG as the whole IgG fraction (batch 2866) of the sheep polyclonal anti-human SAP antiserum providing a dose of 7 mg of actual anti-SAP antibody, isolated purified SAP-K at a dose of 5 mg per mouse, isolated purified SAP-K at a dose of 1 mg per mouse, and, as a negative control, isolated purified monoclonal mouse lgG2a antibody specific for an unrelated human antigen and unreactive with either human SAP or any murine antigen. All mice were killed 17 days later for estimation of amyloid load by Congo red staining. Results
  • mice treated with 5 mg of SAP-K showed the same remarkable clearance of splenic and hepatic amyloid deposits as seen with the 7 mg dose of sheep polyclonal antibody. Only trace specks of amyloid remained in the spleens of the treated mice and none at all was detected in many of the livers, contrasting sharply with the extensive splenic and hepatic amyloid deposits in all animals which received the irrelevant control mouse lgG2a antibody (Table 13). At the lower doses of 1 mg, 0.5 mg and 0.1 mg (data not shown for 0.5 mg and 0.1 mg) of SAP-K per mouse, there was no significant effect.
  • Amyloid score median, range
  • monoclonal anti-human SAP antibodies for use according to the present invention can be directed at either predominantly sequence epitopes, such as antibody SAP-E, or at entirely conformational epitopes, such as SAP-K.
  • Example 16 Comparison of efficacy of SAP-E and SAP-K in clearing systemic AA amyloid deposits in mice, and estimation of plasma anti-SAP antibody concentrations- I nduction of AA amyloidosis and treatment
  • mice were treated with 3 mg and 1 mg per mouse of the two different antibodies.
  • a control group in which amyloid was also induced, received just PBS instead of antibody and two further groups were given the known effective dose of 5 mg/mouse of each antibody. All mice were bled for assay of circulating anti-SAP antibody at days 1, 5 and 15 after dosing with antibody, and all were killed on day 21 for estimation of amyloid load by Congo red staining. All sera were assayed for anti-SAP activity using a robust immunoradiometric assay standardised with purified SAP-E and SAP-K respectively, spiked at known concentrations into normal mouse serum.
  • Amyloid load was scored by four independent expert observers all blinded to the identity of each tissue examined. The scores of all observers were, as usual highly concordant and for statistical analysis, the total scores of all observers for both spleen and liver for each mouse were summed. Both antibodies were efficacious, as previously demonstrated, and there was a clear dose dependent effect but SAP-E was apparently more potent than SAP-K at the lower doses.
  • the concentrations of circulating anti-SAP antibody activity were strongly and consistently dose dependent after the single dose administered to all animals, apart from a single outlying individual in each of the lower dose groups. After the 1 mg per mouse dose, nothing above background was generally detectable even at day 1 in most mice. In contrast, after the 5 mg dose abundant antibody was still present at 15 days, and after 3 mg most mice had circulating antibody at day 5 but few after 15 days (Table 15). There was no significant difference between the patterns for SAP-E and SAP-K. Table 15. Serum concentration of anti-SAP antibody after single intraperitoneal doses.
  • Example 17 Comparison of efficacy of low dose SAP-E and SAP-K in clearing systemic AA amyloid deposits in mice- Induction of AA amyloidosis and treatment
  • the low doses including the repeated very low dose, showed significant efficacy in reducing amyloid load, especially in the liver.
  • SAP-E was again apparently more potent than SAP-K.
  • Amyloid score (median, range)
  • Example 18 Activation of complement by humanised monoclonal anti-human SAP antibodies in vitro.
  • Complement activation is essential for efficacy of amyloid clearing by anti-human SAP antibodies according to the present invention.
  • the capacity of the humanised monoclonal antibodies, SAP-E HlLl and SAP-K H3L0, to activate C3 in human and mouse serum was compared in vitro by adding different amounts of the isolated pure antibodies to either whole human serum containing a SAP concentration of 30 mg/l, or to whole mouse serum which had been spiked with isolated pure human SAP to this same concentration. In both cases the serum was fresh and complement sufficient and experimental conditions were optimal for complement activation with complement fixation test buffer (CFT) as the diluent.
  • CFT complement fixation test buffer
  • This method is of low sensitivity for mouse C3 cleavage because the different electrophoretic mobilities of mouse C3 are more difficult to distinguish reliable than is the case with human C3.
  • Mouse C3 cleavage was therefore assayed by agarose gel electrophoresis followed by immunoblotting with monospecific anti- mouse C3 antibody.
  • Figure 10 shows C3 activation by humanised monoclonal anti-human SAP antibodies in whole human serum.
  • Figure 11 shows C3 activation by low dose humanised monoclonal anti-human SAP antibodies in whole human serum.
  • Both humanised monoclonal anti-human SAP antibodies efficiently activate complement in the presence of human SAP and are thus suitable candidates for use in treatment of systemic amyloidosis, and any other disease caused by extracellular amyloid deposits in the tissues, according to the present invention.
  • IGHV1-69 human variable heavy chain germline acceptor nucleotide sequence
  • IGHV1-39 human variable heavy chain germline acceptor nucleotide sequence
  • SAP-E humanised heavy chain V region variant HO nucleotide sequence (codon optimised)
  • SAP-E humanised heavy chain V region variant HI nucleotide sequence (codon optimised)
  • SAP-E humanised heavy chain V region variant H2 nucleotide sequence (codon optimised)
  • SAP-E humanised heavy chain V region variant H3 nucleotide sequence (codon optimised)
  • SAP-E humanised heavy chain HI full mature amino acid sequence SAP-E humanised light chain LI full mature nucleotide sequence (codon optimised)
  • SAP-K humanised heavy chain V region variant HO nucleotide sequence (codon optimised)
  • SAP-K humanised heavy chain V region variant HI nucleotide sequence (codon optimised)
  • SAP-K humanised heavy chain V region variant H2 nucleotide sequence (codon optimised)
  • SAP-K humanised heavy chain V region variant H3 nucleotide sequence (codon optimised)

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Immunology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Epidemiology (AREA)
  • Diabetes (AREA)
  • Neurology (AREA)
  • Neurosurgery (AREA)
  • Biomedical Technology (AREA)
  • Toxicology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Mycology (AREA)
  • Microbiology (AREA)
  • Psychiatry (AREA)
  • Hospice & Palliative Care (AREA)
  • Hematology (AREA)
  • Endocrinology (AREA)
  • Emergency Medicine (AREA)
  • Obesity (AREA)
  • Biotechnology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
PCT/EP2011/053038 2010-03-03 2011-03-01 Antigen binding proteins specific for serum amyloid p component Ceased WO2011107480A1 (en)

Priority Applications (30)

Application Number Priority Date Filing Date Title
UAA201210015A UA108227C2 (xx) 2010-03-03 2011-01-03 Антигензв'язуючий білок
MA35252A MA34135B1 (fr) 2010-03-03 2011-03-01 Protéines de liaison à un antigène spécifiques pour un composant p de substance amyloïde sérique
NZ601763A NZ601763A (en) 2010-03-03 2011-03-01 Antigen binding proteins specific for serum amyloid p component
EP11705617.6A EP2542261B1 (en) 2010-03-03 2011-03-01 Antigen binding proteins specific for serum amyloid p component
MEP-2016-161A ME02491B (me) 2010-03-03 2011-03-01 Proteini koji vezuju antigene specifični za serumsku amiloidnu p komponentu
PL15178026T PL3025729T3 (pl) 2010-03-03 2011-03-01 Białka wiążące antygen specyficzne wobec składnika surowiczego amyloidu p
SI201130964A SI2542261T1 (sl) 2010-03-03 2011-03-01 Antigen vezavni proteini, specifični za serumsko amiloidno P komponento
CA2789557A CA2789557A1 (en) 2010-03-03 2011-03-01 Antigen binding proteins specific for serum amyloid p component
EP15178026.9A EP3025729B1 (en) 2010-03-03 2011-03-01 Antigen binding proteins specific for serum amyloid p component
RS20160741A RS55133B1 (sr) 2010-03-03 2011-03-01 Antigen vezujući proteini specifični za p komponentu amiloida seruma
CN201180017717.1A CN102858371B (zh) 2010-03-03 2011-03-01 对血清淀粉样蛋白p组分特异性的抗原结合蛋白
LTEP11705617.6T LT2542261T (lt) 2010-03-03 2011-03-01 Antigeną surišantys baltymai, specifiniai serumo amiloido p komponentui
KR1020127025884A KR101817265B1 (ko) 2010-03-03 2011-03-01 혈청 아밀로이드 p 성분에 특이적인 항원 결합 단백질
PH1/2012/501743A PH12012501743A1 (en) 2010-03-03 2011-03-01 Antigen binding proteins specific for serum amyloid p component
EA201290671A EA026375B1 (ru) 2010-03-03 2011-03-01 Антигенсвязывающие белки, специфические в отношении сывороточного амилоидного компонента р
ES11705617.6T ES2593454T3 (es) 2010-03-03 2011-03-01 Proteínas de unión a antigeno específicas para componente amiloide sérico p
JP2012555403A JP5922592B2 (ja) 2010-03-03 2011-03-01 血清アミロイドp成分に特異的な抗原結合タンパク質
AU2011223048A AU2011223048C1 (en) 2010-03-03 2011-03-01 Antigen binding proteins specific for serum amyloid P component
HRP20161096TT HRP20161096T1 (hr) 2010-03-03 2011-03-01 Antigenski vežući proteini specifični za komponentu p serumskog amiloida
BR112012021926-0A BR112012021926A2 (pt) 2010-03-03 2011-03-01 proteína de ligação de antígeno, molécula de ácido nucleico, vetor de expressão, célula hospedeira recombinante, métodos para a produção de uma proteína de ligação de antígeno e para tratar um indivíduo afligido e prevenir uma doença, composição farmacêutica, composto de esgotamento de sap
DK11705617.6T DK2542261T3 (en) 2010-03-03 2011-03-01 ANTI-BINDING PROTEINS SPECIFIC TO SERUM AMYLOID-P COMPONENT
MX2012010129A MX340350B (es) 2010-03-03 2011-03-01 Proteinas de union a antigeno especificas para el componente p amiloide serico.
HK13101057.3A HK1173959B (en) 2010-03-03 2011-03-01 Antigen binding proteins specific for serum amyloid p component
SG2012060216A SG183316A1 (en) 2010-03-03 2011-03-01 Antigen binding proteins specific for serum amyloid p component
IL221418A IL221418A (en) 2010-03-03 2012-08-12 Antigen-binding proteins specific for the amyloid serum component p
ZA2012/06529A ZA201206529B (en) 2010-03-03 2012-08-30 Antigen priteins specific for serum amyloid p component
CY20161100950T CY1118046T1 (el) 2010-03-03 2016-09-23 Πρωτεϊνες δεσμευσης με αντιγονο ειδικες για το συστατικο ρ αμυλοειδους ορου
SM201600337T SMT201600337B (it) 2010-03-03 2016-09-26 Proteine leganti antigene specifiche per componente di amiloide p del siero
IL251031A IL251031A (en) 2010-03-03 2017-03-08 Specific antigen-binding proteins for the amyloid serum component p
CY181101126T CY1120803T1 (el) 2010-03-03 2018-10-31 Πρωτεϊνες δεσμευσης με αντιγονο ειδικες για το συστατικο ρ αμυλοειδους ορου

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US30995710P 2010-03-03 2010-03-03
US61/309,957 2010-03-03

Related Child Applications (1)

Application Number Title Priority Date Filing Date
EP15178026.9A Previously-Filed-Application EP3025729B1 (en) 2010-03-03 2011-03-01 Antigen binding proteins specific for serum amyloid p component

Publications (1)

Publication Number Publication Date
WO2011107480A1 true WO2011107480A1 (en) 2011-09-09

Family

ID=43881068

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2011/053038 Ceased WO2011107480A1 (en) 2010-03-03 2011-03-01 Antigen binding proteins specific for serum amyloid p component

Country Status (39)

Country Link
EP (2) EP3025729B1 (enExample)
JP (2) JP5922592B2 (enExample)
KR (1) KR101817265B1 (enExample)
CN (1) CN102858371B (enExample)
AR (1) AR080432A1 (enExample)
AU (1) AU2011223048C1 (enExample)
BR (1) BR112012021926A2 (enExample)
CA (1) CA2789557A1 (enExample)
CL (1) CL2012002418A1 (enExample)
CO (1) CO6602134A2 (enExample)
CR (1) CR20120491A (enExample)
CY (2) CY1118046T1 (enExample)
DK (2) DK2542261T3 (enExample)
DO (1) DOP2012000232A (enExample)
EA (1) EA026375B1 (enExample)
ES (2) ES2593454T3 (enExample)
HR (2) HRP20161096T1 (enExample)
HU (1) HUE028960T2 (enExample)
IL (2) IL221418A (enExample)
JO (1) JO3188B1 (enExample)
LT (2) LT2542261T (enExample)
MA (1) MA34135B1 (enExample)
ME (1) ME02491B (enExample)
MX (1) MX340350B (enExample)
MY (1) MY159255A (enExample)
NZ (1) NZ601763A (enExample)
PE (1) PE20130040A1 (enExample)
PH (1) PH12012501743A1 (enExample)
PL (2) PL2542261T3 (enExample)
PT (2) PT3025729T (enExample)
RS (2) RS55133B1 (enExample)
SG (2) SG183316A1 (enExample)
SI (2) SI2542261T1 (enExample)
SM (2) SMT201800633T1 (enExample)
TW (1) TWI558409B (enExample)
UA (1) UA108227C2 (enExample)
UY (1) UY33258A (enExample)
WO (1) WO2011107480A1 (enExample)
ZA (1) ZA201206529B (enExample)

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20160081983A1 (en) * 2014-04-29 2016-03-24 Glaxosmithkline Intellectual Property Development Limited Prodrug of 1,1'-(1,6-dioxo-1,6-hexanediyl)bis-d-proline
EP2506876B1 (en) * 2009-12-02 2016-10-12 Imaginab, Inc. J591 minibodies and cys-diabodies for targeting human prostate specific membrane antigen (psma) and methods for their use
US9701668B2 (en) 2014-04-29 2017-07-11 Glaxosmithkline Intellectual Property Development Limited Prodrug of 1,1′-(1,6-dioxo-1,6-hexanediyl)bis-D-proline
CN107880126A (zh) * 2012-12-21 2018-04-06 西雅图基因公司 抗ntb‑a抗体及相关组合物和方法
WO2019185502A1 (en) 2018-03-26 2019-10-03 Glaxosmithkline Intellectual Property Development Limited Antibodies comprising methionine sulfoxide at the ch2-ch3 interface
US11254744B2 (en) 2015-08-07 2022-02-22 Imaginab, Inc. Antigen binding constructs to target molecules
US11266745B2 (en) 2017-02-08 2022-03-08 Imaginab, Inc. Extension sequences for diabodies

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN103239713A (zh) * 2013-05-28 2013-08-14 东南大学 一种糖尿病肾病微炎症小鼠模型的建立方法
CN116925216B (zh) * 2022-04-11 2024-09-24 东莞市朋志生物科技有限公司 抗血清淀粉样蛋白a抗体、检测血清淀粉样蛋白a的试剂和试剂盒

Citations (37)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0054951A1 (en) 1980-12-24 1982-06-30 Chugai Seiyaku Kabushiki Kaisha Dibenz(b,f)(1,4)oxazepine derivatives, process for preparing the same, and pharmaceutical compositions comprising the same
US4676980A (en) 1985-09-23 1987-06-30 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Target specific cross-linked heteroantibodies
EP0239400A2 (en) 1986-03-27 1987-09-30 Medical Research Council Recombinant antibodies and methods for their production
EP0244234A2 (en) 1986-04-30 1987-11-04 Alko Group Ltd. Transformation of trichoderma
EP0307434A1 (en) 1987-03-18 1989-03-22 Medical Res Council CHANGED ANTIBODIES.
WO1990013646A1 (fr) 1989-04-28 1990-11-15 Transgene S.A. Application de nouveaux fragments d'adn en tant que sequence codant pour un peptide signal pour la secretion de proteines matures par des levures recombinantes, cassettes d'expression, levures transformees et procede de preparation de proteines correspondant
WO1993006213A1 (en) 1991-09-23 1993-04-01 Medical Research Council Production of chimeric antibodies - a combinatorial approach
WO1993008829A1 (en) 1991-11-04 1993-05-13 The Regents Of The University Of California Compositions that mediate killing of hiv-infected cells
WO1994004690A1 (en) 1992-08-17 1994-03-03 Genentech, Inc. Bispecific immunoadhesins
EP0612251A1 (en) 1991-10-28 1994-08-31 The Wellcome Foundation Limited Stabilised antibodies
EP0629240A1 (en) 1992-02-19 1994-12-21 Scotgen Limited Altered antibodies, products and processes relating thereto
WO1994029348A2 (en) 1993-06-03 1994-12-22 Therapeutic Antibodies Inc. Production of antibody fragments
WO1995005394A1 (en) * 1993-08-17 1995-02-23 Royal Postgraduate Medical School Therapeutic and diagnostic agents for amyloidosis
US5429746A (en) 1994-02-22 1995-07-04 Smith Kline Beecham Corporation Antibody purification
WO1997011086A1 (en) 1995-09-22 1997-03-27 The General Hospital Corporation High level expression of proteins
US5739277A (en) 1995-04-14 1998-04-14 Genentech Inc. Altered polypeptides with increased half-life
WO1998034640A2 (en) 1997-02-07 1998-08-13 Merck & Co., Inc. Synthetic hiv gag genes
US5807715A (en) 1984-08-27 1998-09-15 The Board Of Trustees Of The Leland Stanford Junior University Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin
EP0915088A1 (en) 1997-10-31 1999-05-12 F. Hoffmann-La Roche Ag D-Proline derivatives
WO1999048523A2 (en) 1998-03-26 1999-09-30 Glaxo Group Limited Antagonists of the inflammatory mediator oncostatin m (osm)
WO2000029004A1 (en) 1998-11-18 2000-05-25 Peptor Ltd. Small functional units of antibody heavy chain variable regions
US6172197B1 (en) 1991-07-10 2001-01-09 Medical Research Council Methods for producing members of specific binding pairs
US6248516B1 (en) 1988-11-11 2001-06-19 Medical Research Council Single domain ligands, receptors comprising said ligands methods for their production, and use of said ligands and receptors
US6291158B1 (en) 1989-05-16 2001-09-18 Scripps Research Institute Method for tapping the immunological repertoire
EP1229125A1 (en) 1999-10-19 2002-08-07 Kyowa Hakko Kogyo Co., Ltd. Process for producing polypeptide
WO2003011878A2 (en) 2001-08-03 2003-02-13 Glycart Biotechnology Ag Antibody glycosylation variants having increased antibody-dependent cellular cytotoxicity
WO2003051836A1 (en) 2001-12-14 2003-06-26 F. Hoffmann-La Roche Ag Prodrugs to d-prolines
WO2004006955A1 (en) 2001-07-12 2004-01-22 Jefferson Foote Super humanized antibodies
WO2004009823A1 (en) 2002-07-18 2004-01-29 Lonza Biologics Plc. Method of expressing recombinant protein in cho cells
WO2004029207A2 (en) 2002-09-27 2004-04-08 Xencor Inc. Optimized fc variants and methods for their generation
US6737056B1 (en) 1999-01-15 2004-05-18 Genentech, Inc. Polypeptide variants with altered effector function
WO2004059318A2 (en) 2002-12-23 2004-07-15 William Marsh Rice University Methods of detecting the inhibition of fibrocyte formation and methods and compositions for enhancing fibrocyte formation
WO2004063351A2 (en) 2003-01-09 2004-07-29 Macrogenics, Inc. IDENTIFICATION AND ENGINEERING OF ANTIBODIES WITH VARIANT Fc REGIONS AND METHODS OF USING SAME
WO2004099173A1 (en) 2003-05-12 2004-11-18 Theracarb Inc. Multivalent inhibitors of serum amyloid p component
WO2006014679A1 (en) 2004-07-21 2006-02-09 Glycofi, Inc. Immunoglobulins comprising predominantly a glcnac2man3glcnac2 glycoform
WO2009000926A1 (en) 2007-06-27 2008-12-31 Pentraxin Therapeutics Limited Combinations of sap depleting agents and anti-sap antibodies
WO2009155962A1 (en) * 2008-06-27 2009-12-30 Pentraxin Therapeutics Limited Use

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DD266710A3 (de) 1983-06-06 1989-04-12 Ve Forschungszentrum Biotechnologie Verfahren zur biotechnischen Herstellung van alkalischer Phosphatase
US4879231A (en) 1984-10-30 1989-11-07 Phillips Petroleum Company Transformation of yeasts of the genus pichia
EP0402226A1 (en) 1989-06-06 1990-12-12 Institut National De La Recherche Agronomique Transformation vectors for yeast yarrowia

Patent Citations (38)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0054951A1 (en) 1980-12-24 1982-06-30 Chugai Seiyaku Kabushiki Kaisha Dibenz(b,f)(1,4)oxazepine derivatives, process for preparing the same, and pharmaceutical compositions comprising the same
US5807715A (en) 1984-08-27 1998-09-15 The Board Of Trustees Of The Leland Stanford Junior University Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin
US4676980A (en) 1985-09-23 1987-06-30 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Target specific cross-linked heteroantibodies
EP0239400A2 (en) 1986-03-27 1987-09-30 Medical Research Council Recombinant antibodies and methods for their production
EP0244234A2 (en) 1986-04-30 1987-11-04 Alko Group Ltd. Transformation of trichoderma
EP0307434A1 (en) 1987-03-18 1989-03-22 Medical Res Council CHANGED ANTIBODIES.
US6248516B1 (en) 1988-11-11 2001-06-19 Medical Research Council Single domain ligands, receptors comprising said ligands methods for their production, and use of said ligands and receptors
WO1990013646A1 (fr) 1989-04-28 1990-11-15 Transgene S.A. Application de nouveaux fragments d'adn en tant que sequence codant pour un peptide signal pour la secretion de proteines matures par des levures recombinantes, cassettes d'expression, levures transformees et procede de preparation de proteines correspondant
US6291158B1 (en) 1989-05-16 2001-09-18 Scripps Research Institute Method for tapping the immunological repertoire
US6172197B1 (en) 1991-07-10 2001-01-09 Medical Research Council Methods for producing members of specific binding pairs
WO1993006213A1 (en) 1991-09-23 1993-04-01 Medical Research Council Production of chimeric antibodies - a combinatorial approach
EP0612251A1 (en) 1991-10-28 1994-08-31 The Wellcome Foundation Limited Stabilised antibodies
WO1993008829A1 (en) 1991-11-04 1993-05-13 The Regents Of The University Of California Compositions that mediate killing of hiv-infected cells
EP0629240A1 (en) 1992-02-19 1994-12-21 Scotgen Limited Altered antibodies, products and processes relating thereto
WO1994004690A1 (en) 1992-08-17 1994-03-03 Genentech, Inc. Bispecific immunoadhesins
WO1994029348A2 (en) 1993-06-03 1994-12-22 Therapeutic Antibodies Inc. Production of antibody fragments
WO1995005394A1 (en) * 1993-08-17 1995-02-23 Royal Postgraduate Medical School Therapeutic and diagnostic agents for amyloidosis
US5429746A (en) 1994-02-22 1995-07-04 Smith Kline Beecham Corporation Antibody purification
US5739277A (en) 1995-04-14 1998-04-14 Genentech Inc. Altered polypeptides with increased half-life
WO1997011086A1 (en) 1995-09-22 1997-03-27 The General Hospital Corporation High level expression of proteins
WO1998034640A2 (en) 1997-02-07 1998-08-13 Merck & Co., Inc. Synthetic hiv gag genes
EP0915088A1 (en) 1997-10-31 1999-05-12 F. Hoffmann-La Roche Ag D-Proline derivatives
WO1999048523A2 (en) 1998-03-26 1999-09-30 Glaxo Group Limited Antagonists of the inflammatory mediator oncostatin m (osm)
WO2000029004A1 (en) 1998-11-18 2000-05-25 Peptor Ltd. Small functional units of antibody heavy chain variable regions
US6737056B1 (en) 1999-01-15 2004-05-18 Genentech, Inc. Polypeptide variants with altered effector function
EP1229125A1 (en) 1999-10-19 2002-08-07 Kyowa Hakko Kogyo Co., Ltd. Process for producing polypeptide
WO2004006955A1 (en) 2001-07-12 2004-01-22 Jefferson Foote Super humanized antibodies
WO2003011878A2 (en) 2001-08-03 2003-02-13 Glycart Biotechnology Ag Antibody glycosylation variants having increased antibody-dependent cellular cytotoxicity
WO2003051836A1 (en) 2001-12-14 2003-06-26 F. Hoffmann-La Roche Ag Prodrugs to d-prolines
WO2004009823A1 (en) 2002-07-18 2004-01-29 Lonza Biologics Plc. Method of expressing recombinant protein in cho cells
WO2004029207A2 (en) 2002-09-27 2004-04-08 Xencor Inc. Optimized fc variants and methods for their generation
WO2004059318A2 (en) 2002-12-23 2004-07-15 William Marsh Rice University Methods of detecting the inhibition of fibrocyte formation and methods and compositions for enhancing fibrocyte formation
WO2004063351A2 (en) 2003-01-09 2004-07-29 Macrogenics, Inc. IDENTIFICATION AND ENGINEERING OF ANTIBODIES WITH VARIANT Fc REGIONS AND METHODS OF USING SAME
WO2004099173A1 (en) 2003-05-12 2004-11-18 Theracarb Inc. Multivalent inhibitors of serum amyloid p component
WO2006014679A1 (en) 2004-07-21 2006-02-09 Glycofi, Inc. Immunoglobulins comprising predominantly a glcnac2man3glcnac2 glycoform
WO2009000926A1 (en) 2007-06-27 2008-12-31 Pentraxin Therapeutics Limited Combinations of sap depleting agents and anti-sap antibodies
US20090191196A1 (en) 2007-06-27 2009-07-30 Pepys Mark B Use
WO2009155962A1 (en) * 2008-06-27 2009-12-30 Pentraxin Therapeutics Limited Use

Non-Patent Citations (119)

* Cited by examiner, † Cited by third party
Title
"Alfenito-M Advancing Protein Therapeutics", January 2007
"Remingtons Pharmaceutical Sciences", 1980, MACK PUBLISHING CO
ADAMS ET AL., CAN. RES, vol. 53, 1993, pages 4026 - 4034
ALT ET AL., FEBS LETT, vol. 454, 1999, pages 90 - 94
BAEZ ET AL., BIOPHARM, vol. 13, 2000, pages 50 - 54
BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426
BOTTO ET AL., NATURE MED., vol. 3, 1997, pages 855 - 859
BOYD ET AL., MOL. IMMUNOL., vol. 32, 1996, pages 1311 - 1318
BRODEUR: "Monoclonal Antibody Production Techniques and Applications", 1987, MARCEL DEKKER INC, pages: 51 - 63
CHOTHIA ET AL., NATURE, vol. 342, 1989, pages 877 - 883
CO ET AL., NATURE, vol. 351, 1991, pages 501 - 502
COLOMA ET AL., NATURE BIOTECHNOL., vol. 15, 1997, pages 159 - 163
CUPIT ET AL., LETT APPL MICROBIOL, vol. 29, 1999, pages 273 - 277
DAVIS ET AL., CHEM. REV., vol. 102, 2002, pages 579
DORAN, CURR. OPINION BIOTECHNOL., vol. 11, 2000, pages 199 - 204
DRAPEAU ET AL., CYTOTECHNOLOGY, vol. 15, 1994, pages 103 - 109
E. MEYERS; W. MILLER, COMPUT. APPL. BIOSCI., vol. 4, 1988, pages 11 - 17
FISHWILD, NATURE BIOTECHNOL., vol. 14, 1996, pages 845 - 851
GHETIE ET AL., ANNU. REV. IMMUNOL., vol. 18, 2000, pages 739 - 766
GILLMORE ET AL., BRIT. J. HAEMATOL., 2010
GILLMORE ET AL., IMMUNOLOGY, vol. 112, 2004, pages 255 - 264
GLOCKSHUBER ET AL., BIOCHEMISTRY, vol. 29, 1990, pages 1362 - 1367
GREEN, J. IMMUNOL. METHODS, vol. 231, 1999, pages 11 - 23
GRIFFITHS ET AL., EMBO, vol. 13, 1994, pages 3245 - 3260
HANG ET AL., ACC. CHEM. RES, vol. 34, 2001, pages 727
HAWKINS ET AL., CLIN. EXP. IMMUNOL., vol. 84, 1991, pages 308 - 316
HAWKINS ET AL., J. CLIN. INVEST., vol. 86, 1990, pages 1862 - 1 869
HAWKINS ET AL., J. CLIN. INVEST., vol. 86, 1990, pages 1862 - 1869
HAWKINS ET AL., J. EXP. MED, vol. 167, 1988, pages 903 - 913
HAWKINS ET AL., J. EXP. MED., vol. 167, 1988, pages 903 - 913
HODGSON ET AL., BIO/TECHNOLOGY, vol. 9, 1991, pages 421
HOEKEMA ET AL., MOL CELL BIOL, vol. 7, no. 8, 1987, pages 2914 - 24
HOLLIGER ET AL., PNAS, vol. 90, 1993, pages 6444 - 6448
HOLLIGER; HUDSON, NATURE BIOTECHNOLOGY, vol. 23, no. 9, 2005, pages 1126 - 1136
HU ET AL., CANCER RES., vol. 56, 1996, pages 3055 - 3061
HUSTON ET AL., INT. REV. IMMUNOL, vol. 10, 1993, pages 195 - 217
HUSTON ET AL., PNAS, vol. 85, no. 16, 1988, pages 5879 - 5883
HUTCHINSON ET AL., MOL. MED., vol. 6, 2000, pages 482 - 493
JONES ET AL., NATURE, vol. 321, 1986, pages 522 - 525
JULIAN D GILMORE ET AL: "Sustained pharmacological depletion of serum amyloid P component in patients with systemic amyloidosis", BRITISH JOURNAL OF HAEMATOLOGY, WILEY-BLACKWELL PUBLISHING LTD, GB, vol. 148, 1 January 2010 (2010-01-01), pages 760 - 767, XP007918426, ISSN: 0007-1048, [retrieved on 20100108], DOI: DOI:10.1111/J.1365-2141.2009.08036.X *
JUNGHANS, IMMUNOL. RES, vol. 16, 1997, pages 29 - 57
KABAT ET AL.: "U.S. Department of Health and Human Services", 1987, NATIONAL INSTITUTES OF HEALTH, article "Sequences of Proteins of Immunological Interest"
KABAT: "U.S. Department of Health and Human Services", 1987, NATIONAL INSTITUTES OF HEALTH, article "Sequences of Proteins of Immunological Interest"
KARL BODIN ET AL: "Antibodies to human serum amyloid P component eliminate visceral amyloid deposits", NATURE, NATURE PUBLISHING GROUP, LONDON, GB, vol. 468, 4 November 2010 (2010-11-04), pages 93 - 97, XP007918427, ISSN: 0028-0836, [retrieved on 20101020], DOI: DOI:10.1038/NATURE09494 *
KEEN ET AL., CYTOTECHNOLOGY, vol. 17, 1995, pages 153 - 163
KIPRIYANOV ET AL., CELL. BIOPHYS, vol. 26, 1995, pages 187 - 204
KIPRIYANOV ET AL., INT. J. CAN, vol. 77, 1998, pages 763 - 772
KIPRIYANOV ET AL., J. MOL. BIOL., vol. 293, 1999, pages 41 - 56
KOLSTOE, S.E. ET AL.: "Molecular dissection of Alzheimer's disease neuropathology by depletion of serum amyloid P component", PROC. NATL. ACAD. SCI. USA, vol. 106, 2009, pages 7619 - 7623, XP007918428, DOI: doi:10.1073/pnas.0902640106
KONTERMANN ET AL., J. IMMUNOL. METHODS, vol. 226, 1999, pages 179 - 188
KORTT ET AL., PROTEIN ENG, vol. 10, 1997, pages 423 - 433
KOSTELNY ET AL., J. IMMUNOL., vol. 148, 1992, pages 1547 - 1553
KOUMENIS ET AL., INT. J. PHARMACEUT., vol. 198, 2000, pages 83 - 95
KOZBOR, J. IMMUNOL, vol. 133, 1984, pages 3001
KURUCZ ET AL., J. IMMOL., vol. 154, 1995, pages 4576 - 4582
LAZAR ET AL., PNAS, vol. 103, 2006, pages 4005 - 4010
LE GALL ET AL., FEBS, vol. 453, 1999, pages 164 - 168
MA, NAT. MED., vol. 4, 1998, pages 601 - 606
MANNING, M.; COLON, W., BIOCHEMISTRY, vol. 43, 2004, pages 11248 - 11254
MARK ET AL.: "The pharmacology of Monoclonal Antibodies", vol. 113, 1994, SPRINGER-VERLAG, article "Handbook of Experimental Pharmacology", pages: 105 - 134
MARKS BIO/TECHNOL, vol. 10, 1992, pages 779 - 783
MARTIN; THORNTON, J MOL BIOL, vol. 263, 1996, pages 800 - 815
MCCAFFERTY, NATURE, vol. 348, 1990, pages 552 - 553
MCCARTNEY ET AL., PROTEIN ENG., vol. 8, 1995, pages 301 - 314
MENDEZ, NATURE GENETICS, vol. 15, 1997, pages 146 - 156
MILLSTEIN ET AL., NATURE, vol. 305, 1983, pages 537 - 539
MORRISON, PNAS, vol. 81, 1984, pages 6851
MORROW, GENET. ENG. NEWS, vol. 20, 2000, pages 1 - 55
MULLER ET AL., FEBS LETT, vol. 432, 1998, pages 45 - 49
MYERS ET AL., BIOCHEMISTRY, vol. 45, 2006, pages 2311 - 2321
NAKAMURA ET AL., NUCLEIC ACIDS RESEARCH, vol. 24, 1996, pages 214 - 215
NEEDLEMAN; WUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 444 - 453
NELSON ET AL., CLIN. CHIM. ACTA, vol. 200, 1991, pages 191 - 200
NOURSADEGHI ET AL., PNAS, vol. 97, 2000, pages 14584 - 14589
PACK ET AL., BIOCHEMISTRY, vol. 31, 1992, pages 1579 - 1584
PADLAN ET AL., MOL. IMMUNOL., vol. 28, 1991, pages 489 - 498
PEDERSEN ET AL., J. MOL. BIOL., vol. 235, 1994, pages 959 - 973
PENG ET AL., J. BIOTECHNOL., vol. 108, 2004, pages 185 - 192
PEPYS ET AL., AMYLOID: INT. J. EXP. CLIN. INVEST., vol. 4, 1997, pages 274 - 295
PEPYS ET AL., CLIN. EXP. IMMUNOL., vol. 38, 1979, pages 284 - 293
PEPYS ET AL., NATURE, vol. 41, no. 7, 2002, pages 254 - 259
PEPYS ET AL., NATURE, vol. 417, 2002, pages 254 - 259
PEPYS ET AL., PNAS, vol. 91, 1994, pages 5602 - 5606
PEPYS M B ET AL: "Targeted pharmacological depletion of serum amyloid P component for treatment of human amyloidosis", NATURE, NATURE PUBLISHING GROUP, LONDON, GB, vol. 417, no. 6886, 1 January 2002 (2002-01-01), pages 254 - 259, XP002219442, ISSN: 0028-0836, DOI: DOI:10.1038/417254A *
PEPYS, M.B, ANNU. REV. MED., vol. 57, 2006, pages 223 - 241
PEPYS, M.B. ET AL.: "Targeted pharmacological depletion of serum amyloid P component for treatment of human amyloidosis", NATURE, vol. 417, 2002, pages 254 - 259, XP002219442, DOI: doi:10.1038/417254a
PEPYS, M.B., ANNU. REV. MED., vol. 57, 2006, pages 223 - 241
PEPYS, M.B.; TENNENT, G.A.; DENTON, C.P. ET AL., ARTHRITIS RHEUM., vol. 56, 2007, pages 4229 - 4230
PEPYS; HAWKINS: "Amyloidosis. Oxford Textbook of Medicine", vol. 2, 2003, OXFORD UNIVERSITY PRESS, pages: 162 - 173
PEPYS; HAWKINS: "Amyloidosis. Samter's Immunologic Diseases", vol. 1, 2001, LIPPINCOTT WILLIAMS & WILLIAMS, pages: 401 - 412
POLLOCK ET AL., J. IMMUNOL. METHODS, vol. 231, 1999, pages 147 - 157
PUCHTLER, H.; SWEAT, F.; LEVINE, M., ON THE BINDING OF CONGO RED BY AMYLOID. J. HISTOCHEM. CYTOCHEM., vol. 10, 1962, pages 355 - 364
QUEEN ET AL., PNAS, vol. 86, 1989, pages 10,029 - 10,033
QUEEN ET AL., PROC. NATL ACAD SCI USA, vol. 86, 1989, pages 10029 - 10032
RAJU ET AL., BIOCHEMISTRY, vol. 40, 2001, pages 8868 - 8876
SANCHEZ ET AL., J. BIOTECHNOL., vol. 72, 1999, pages 13 - 20
SCHARFENBERG ET AL.: "Animal Cell Technology: Developments towards the 21st century", 1995, KLUWER ACADEMIC PUBLISHERS, pages: 619 - 623
SEARS ET AL., SCIENCE, vol. 291, 2001, pages 2344
SHALABY ET AL., J. EXP. MED., vol. 175, 1992, pages 217 - 225
SHIELDS ET AL., J. BIOL. CHEM, vol. 276, 2001, pages 6591 - 6604
SIMON E KOLSTOE ET AL: "Molecular dissection of Alzheimer s disease neuropathology by depletion of serum amyloid P component", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES (PNAS), NATIONAL ACADEMY OF SCIENCE, US, vol. 106, no. 18, 5 May 2009 (2009-05-05), pages 7619 - 7623, XP007918428, ISSN: 0027-8424, [retrieved on 20090416], DOI: DOI:10.1073/PNAS.0902640106 *
SMITH ET AL.: "Antibodies in human diagnosis and therapy", 1977, RAVEN PRESS
STINCHCOMB ET AL., NATURE, vol. 282, 1979, pages 38
STOGER ET AL., PLANT MOL. BIOL., vol. 42, 2000, pages 583 - 590
SURESH ET AL., METHODS IN ENZYMOLOGY, vol. 121, 1986, pages 210
TENNENT ET AL., ARTHRITIS RHEUM., vol. 56, 2007, pages 2013 - 2017
TENNENT ET AL., PNAS, vol. 92, 1995, pages 4299 - 4303
TOMIZUKA, PNAS, vol. 97, 2000, pages 722 - 727
TRAUNECKER ET AL., EMBO, vol. 10, 1991, pages 3655 - 3659
URLAUB ET AL., SOMATIC CELL MOL. GENET., vol. 12, 1986, pages 555 - 556
VAN ROOIJEN ET AL., J. LIPOSOME RESEARCH, vol. 12, 2002, pages 81 - 94
VERHOEYEN ET AL., SCIENCE, vol. 239, 1988, pages 1534 - 1536
WACKER ET AL., SCIENCE, vol. 298, 2002, pages 1790
WATERHOUSE, NUCL. ACIDS RES., vol. 21, 1993, pages 2265 - 2266
WHITLOW ET AL., METHODS COMPANION METHODS ENZYMOL, vol. 2, 1991, pages 97 - 105
WINTER, ANNU. REV. IMMUNOL, vol. 12, 1994, pages 433 - 455
YAMAMURA ET AL., MOL. REPROD. DEV., vol. 36, 1993, pages 248 - 250
ZHANG ET AL., SCIENCE, vol. 303, 2004, pages 371
ZHU ET AL., PROTEIN SCI., vol. 6, 1997, pages 781 - 788

Cited By (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2506876B1 (en) * 2009-12-02 2016-10-12 Imaginab, Inc. J591 minibodies and cys-diabodies for targeting human prostate specific membrane antigen (psma) and methods for their use
US11180570B2 (en) 2009-12-02 2021-11-23 Imaginab, Inc. J591 minibodies and cys-diabodies for targeting human prostate specific membrane antigen (PSMA) and methods for their use
CN107880126A (zh) * 2012-12-21 2018-04-06 西雅图基因公司 抗ntb‑a抗体及相关组合物和方法
CN107880126B (zh) * 2012-12-21 2021-03-30 西雅图基因公司 抗ntb-a抗体及相关组合物和方法
US20160081983A1 (en) * 2014-04-29 2016-03-24 Glaxosmithkline Intellectual Property Development Limited Prodrug of 1,1'-(1,6-dioxo-1,6-hexanediyl)bis-d-proline
US9701668B2 (en) 2014-04-29 2017-07-11 Glaxosmithkline Intellectual Property Development Limited Prodrug of 1,1′-(1,6-dioxo-1,6-hexanediyl)bis-D-proline
US9737505B2 (en) * 2014-04-29 2017-08-22 Glaxosmithkline Intellectual Property Development Limited Prodrug of 1,1′-(1,6-dioxo-1,6-hexanediyl)bis-D-proline
US9873686B2 (en) 2014-04-29 2018-01-23 Glaxosmithkline Intellectual Property Development Limited Prodrug of 1,1′-(1,6-dioxo -1,6-hexanediyl)bis-D-proline
US10597385B2 (en) 2014-04-29 2020-03-24 Glaxosmithkline Intellectual Property Development Limited Prodrug of 1,1′-(1,6-dioxo-1,6-hexanediyl)bis-D-proline
US11254744B2 (en) 2015-08-07 2022-02-22 Imaginab, Inc. Antigen binding constructs to target molecules
US11266745B2 (en) 2017-02-08 2022-03-08 Imaginab, Inc. Extension sequences for diabodies
WO2019185502A1 (en) 2018-03-26 2019-10-03 Glaxosmithkline Intellectual Property Development Limited Antibodies comprising methionine sulfoxide at the ch2-ch3 interface

Also Published As

Publication number Publication date
EA026375B1 (ru) 2017-04-28
KR20130027483A (ko) 2013-03-15
MX2012010129A (es) 2012-09-12
AU2011223048A1 (en) 2012-10-04
EP2542261A1 (en) 2013-01-09
ME02491B (me) 2017-02-20
LT3025729T (lt) 2018-12-10
IL221418A0 (en) 2012-10-31
DK2542261T3 (en) 2016-09-19
SG10201500382SA (en) 2015-03-30
TW201143789A (en) 2011-12-16
DK3025729T3 (en) 2018-11-26
SMT201800633T1 (it) 2019-01-11
CN102858371A (zh) 2013-01-02
NZ601763A (en) 2014-08-29
JO3188B1 (ar) 2018-03-08
HUE028960T2 (en) 2017-01-30
CY1120803T1 (el) 2019-12-11
UY33258A (es) 2011-09-30
AR080432A1 (es) 2012-04-11
DOP2012000232A (es) 2013-01-15
CO6602134A2 (es) 2013-01-18
BR112012021926A2 (pt) 2020-08-25
ES2699078T3 (es) 2019-02-07
PT2542261T (pt) 2016-09-27
SMT201600337B (it) 2016-11-10
JP5922592B2 (ja) 2016-05-24
JP2016154535A (ja) 2016-09-01
AU2011223048C1 (en) 2018-06-21
TWI558409B (zh) 2016-11-21
CR20120491A (es) 2013-02-20
CL2012002418A1 (es) 2013-03-08
EP2542261B1 (en) 2016-07-06
CN102858371B (zh) 2017-03-01
EP3025729B1 (en) 2018-09-12
RS57708B1 (sr) 2018-12-31
KR101817265B1 (ko) 2018-01-10
IL221418A (en) 2017-03-30
PL3025729T3 (pl) 2019-02-28
IL251031A0 (en) 2017-04-30
HK1223292A1 (en) 2017-07-28
AU2011223048B2 (en) 2013-12-19
EP3025729A1 (en) 2016-06-01
JP6236478B2 (ja) 2017-11-22
MY159255A (en) 2016-12-30
PT3025729T (pt) 2018-11-30
LT2542261T (lt) 2016-09-26
SI3025729T1 (sl) 2018-11-30
HRP20161096T1 (hr) 2016-11-04
SI2542261T1 (sl) 2016-11-30
UA108227C2 (xx) 2015-04-10
SG183316A1 (en) 2012-09-27
CA2789557A1 (en) 2011-09-09
RS55133B1 (sr) 2016-12-30
HRP20181666T1 (hr) 2018-12-14
ES2593454T3 (es) 2016-12-09
IL251031A (en) 2017-11-30
CY1118046T1 (el) 2017-05-17
PE20130040A1 (es) 2013-02-09
MA34135B1 (fr) 2013-04-03
MX340350B (es) 2016-07-06
PL2542261T3 (pl) 2016-12-30
PH12012501743A1 (en) 2012-11-12
JP2013521252A (ja) 2013-06-10
EA201290671A1 (ru) 2013-05-30
ZA201206529B (en) 2018-12-19
HK1173959A1 (zh) 2013-05-31

Similar Documents

Publication Publication Date Title
AU2011223048B2 (en) Antigen binding proteins specific for serum amyloid P component
AU2011209713B2 (en) CD127 binding proteins
US9062101B2 (en) Amyloid-beta binding proteins
US20110256132A1 (en) Myostatin binding proteins
US10221234B2 (en) Antigen binding proteins
HK1223292B (en) Antigen binding proteins specific for serum amyloid p component
HK1173959B (en) Antigen binding proteins specific for serum amyloid p component

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 201180017717.1

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 11705617

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2789557

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 221418

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 7074/DELNP/2012

Country of ref document: IN

WWE Wipo information: entry into national phase

Ref document number: 201290671

Country of ref document: EA

WWE Wipo information: entry into national phase

Ref document number: 2012002418

Country of ref document: CL

Ref document number: 2012555403

Country of ref document: JP

Ref document number: 12149377

Country of ref document: CO

Ref document number: MX/A/2012/010129

Country of ref document: MX

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 1201004444

Country of ref document: TH

Ref document number: 001385-2012

Country of ref document: PE

Ref document number: 12012501743

Country of ref document: PH

WWE Wipo information: entry into national phase

Ref document number: 2011223048

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: DZP2012000667

Country of ref document: DZ

REEP Request for entry into the european phase

Ref document number: 2011705617

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: CR2012-000491

Country of ref document: CR

Ref document number: 2011705617

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 20127025884

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: A201210015

Country of ref document: UA

ENP Entry into the national phase

Ref document number: 2011223048

Country of ref document: AU

Date of ref document: 20110301

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112012021926

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: P-2016/0741

Country of ref document: RS

WWE Wipo information: entry into national phase

Ref document number: 251031

Country of ref document: IL

ENP Entry into the national phase

Ref document number: 112012021926

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20120830