WO2011068965A1 - Methods and compositions for improved f-18 labeling of proteins, peptides and other molecules - Google Patents
Methods and compositions for improved f-18 labeling of proteins, peptides and other molecules Download PDFInfo
- Publication number
- WO2011068965A1 WO2011068965A1 PCT/US2010/058724 US2010058724W WO2011068965A1 WO 2011068965 A1 WO2011068965 A1 WO 2011068965A1 US 2010058724 W US2010058724 W US 2010058724W WO 2011068965 A1 WO2011068965 A1 WO 2011068965A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- imp
- peptide
- virus
- labeled
- antibody
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- KAGBCHRKKXTZOY-UHFFFAOYSA-N CC(C)(C)OC(CN1CCN(CC(OC(C)(C)C)=O)CCNCC1)=O Chemical compound CC(C)(C)OC(CN1CCN(CC(OC(C)(C)C)=O)CCNCC1)=O KAGBCHRKKXTZOY-UHFFFAOYSA-N 0.000 description 2
- CXWXKWLAPJHVOV-UHFFFAOYSA-N CC(C)(C)OC(CN1CCN(Cc2ccc(CC(O)=O)cc2)CCN(CC(OC(C)(C)C)=O)CC1)=O Chemical compound CC(C)(C)OC(CN1CCN(Cc2ccc(CC(O)=O)cc2)CCN(CC(OC(C)(C)C)=O)CC1)=O CXWXKWLAPJHVOV-UHFFFAOYSA-N 0.000 description 2
- 0 CC(C)(C)OC(CN1CCN(Cc2ccc(CC(*)=O)cc2)CCN(CC(OC(C)(C)C)=O)CC1)=O Chemical compound CC(C)(C)OC(CN1CCN(Cc2ccc(CC(*)=O)cc2)CCN(CC(OC(C)(C)C)=O)CC1)=O 0.000 description 1
- APXOMRFLJBRHNX-UHFFFAOYSA-N COC(Cc1ccc(CBr)cc1)=O Chemical compound COC(Cc1ccc(CBr)cc1)=O APXOMRFLJBRHNX-UHFFFAOYSA-N 0.000 description 1
- WCOCCXZFEJGHTC-UHFFFAOYSA-N OC(Cc1ccc(CBr)cc1)=O Chemical compound OC(Cc1ccc(CBr)cc1)=O WCOCCXZFEJGHTC-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K51/00—Preparations containing radioactive substances for use in therapy or testing in vivo
- A61K51/02—Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
- A61K51/04—Organic compounds
- A61K51/0404—Lipids, e.g. triglycerides; Polycationic carriers
- A61K51/0406—Amines, polyamines, e.g. spermine, spermidine, amino acids, (bis)guanidines
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6891—Pre-targeting systems involving an antibody for targeting specific cells
- A61K47/6897—Pre-targeting systems with two or three steps using antibody conjugates; Ligand-antiligand therapies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K51/00—Preparations containing radioactive substances for use in therapy or testing in vivo
- A61K51/02—Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
- A61K51/04—Organic compounds
- A61K51/0491—Sugars, nucleosides, nucleotides, oligonucleotides, nucleic acids, e.g. DNA, RNA, nucleic acid aptamers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K51/00—Preparations containing radioactive substances for use in therapy or testing in vivo
- A61K51/02—Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
- A61K51/04—Organic compounds
- A61K51/08—Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K51/00—Preparations containing radioactive substances for use in therapy or testing in vivo
- A61K51/02—Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
- A61K51/04—Organic compounds
- A61K51/08—Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins
- A61K51/082—Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins the peptide being a RGD-containing peptide
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K51/00—Preparations containing radioactive substances for use in therapy or testing in vivo
- A61K51/02—Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
- A61K51/04—Organic compounds
- A61K51/08—Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins
- A61K51/083—Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins the peptide being octreotide or a somatostatin-receptor-binding peptide
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K51/00—Preparations containing radioactive substances for use in therapy or testing in vivo
- A61K51/02—Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
- A61K51/04—Organic compounds
- A61K51/08—Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins
- A61K51/088—Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins conjugates with carriers being peptides, polyamino acids or proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K51/00—Preparations containing radioactive substances for use in therapy or testing in vivo
- A61K51/02—Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
- A61K51/04—Organic compounds
- A61K51/08—Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins
- A61K51/10—Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody
- A61K51/1084—Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody the antibody being a hybrid immunoglobulin
- A61K51/109—Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody the antibody being a hybrid immunoglobulin immunoglobulins having two or more different antigen-binding sites or multifunctional antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B82—NANOTECHNOLOGY
- B82Y—SPECIFIC USES OR APPLICATIONS OF NANOSTRUCTURES; MEASUREMENT OR ANALYSIS OF NANOSTRUCTURES; MANUFACTURE OR TREATMENT OF NANOSTRUCTURES
- B82Y5/00—Nanobiotechnology or nanomedicine, e.g. protein engineering or drug delivery
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
Definitions
- the present invention concerns methods of labeling peptides or other molecules with
- the F or 19 F is attached as a conjugate [complex] with aluminum or another metal via a chelating moiety, which may be covalently linked to a protein, peptide or other molecule.
- a chelating moiety which may be covalently linked to a protein, peptide or other molecule.
- 18 F- or 19 F-labeled molecules of high specific activity may be prepared in 30 minutes or less and are suitable for use in imaging techniques without the need for HPLC purification of the labeled molecule. Labeling may occur in a saline medium suitable for direct use in vivo. In alternative embodiments an organic solvent may be added to improve the efficiency of labeling.
- the labeled molecules are stable under in vivo conditions, although for certain purposes, such as kit formulations, a stabilizing agent such as ascorbic acid, trehalose, sorbitol or mannitol may be added. In other alternative alternative, a stabilizing agent such as ascorbic acid, trehalose, sorbitol or
- a chelating moiety may be preloaded with aluminum and lyophilized for storage, prior to labeling with 18 F or 19 F.
- Positron Emission Tomography has become one of the most prominent functional imaging modalities in diagnostic medicine, with very high sensitivity (fmol), high resolution (4-10 mm) and tissue accretion that can be adequately quantitated (Volkow et al., 1988, Am. J. Physiol. Imaging 3: 142).
- [ 18 F]2-deoxy-2-fluoro-D-glucose [ F]FDG) is the most widely used functional imaging agent in oncology (Fletcher et al., 2008, J. Nucl. Med. 49:480)
- there is a keen interest in developing other labeled compounds for functional imaging to complement and augment anatomic imaging methods (Torigian et al., 2007, CA Cancer J. Clin. 57:206), especially with the hybrid PET/computed tomography systems currently in use.
- Peptides or other small molecules can be labeled with the positron emitters 18 F, 64 Cu, n C, 66 Ga, 68 Ga, 76 Br, 94m Tc, 86 Y, and 124 I.
- a low ejection energy for a PET isotope is desirable to minimize the distance that the positron travels from the target site before it generates the two 51 1 keV gamma rays that are imaged by the PET camera.
- Many isotopes that emit positrons also have other emissions such as gamma rays, alpha particles or beta particles in their decay chain. It is desirable to have a PET isotope that is a pure positron emitter so that any dosimetry problems will be minimized.
- the half-life of the isotope is also important, since the half-life must be long enough to attach the isotope to a targeting molecule, analyze the product, inject it into the patient, and allow the product to localize, clear from non-target tissues and then image. If the half-life is too long the specific activity may not be high enough to obtain enough photons for a clear image and if it is too short the time needed for manufacturing, commercial distribution and biodistribution may not be sufficient. 10 F ( ⁇ ⁇ 635 keV 97%, t HO min) is one of the most widely used PET emitting isotopes because of its low positron emission energy, lack of side emissions and suitable half- life.
- F is attached to compounds by binding it to a carbon atom (Miller et al, 2008, Angew Chem Int Ed 47:8998-9033), but attachments to silicon (Shirrmacher et al., 2007, Bioconj Chem 18:2085-89; Hohne et al, 2008, Bioconj Chem 19: 1871-79) and boron (Ting et al, 2008, Fluorine Chem 129:349-58) have also been reported. Binding to carbon usually involves multistep syntheses, including multiple purification steps, which is problematic for an isotope with a 1 10-min half-life.
- An example is the labeling method of Poethko et al. (J. Nucl. Med. 2004; 45: 892- 902) in which 4-[ 18 F]fluorobenzaldehyde is first synthesized and purified (Wilson et al, J. Labeled Compounds and Radiopharm. 1990; XXVIII: 1 189-1 199) and then conjugated to the peptide. The peptide conjugate is then purified by HPLC to remove excess peptide that was used to drive the conjugation to completion.
- Other examples include labeling with succinyl [ 18 F]fluorobenzoate(SFB) (e.g., Vaidyanathan et al., 1992, Int. J. Rad. Appl. Instrum. B 19:275), other acyl compounds (Tada et al., 1989, Labeled Compd.
- the present invention concerns compositions and methods relating to 18 F- or 19 F-labeled molecules of use for PET or NMR imaging. As discussed herein, where the present application refers to 18 F the skilled artisan will realize that either
- the 18 F is bound to a metal and the 18 F-metal complex is attached to a ligand on a peptide or other molecule.
- the metals of group IIIA As described below, the metals of group IIIA
- the metal binding ligand is preferably a chelating agent, such as NOTA, NETA, DOTA, DTP A and other chelating groups discussed in more
- F for imaging purposes, so long as it contains derivatizable groups that may be modified without affecting the ligand-receptor binding interaction between the delivery molecule and the cellular or tissue target receptor.
- the Examples below primarily concern 18 F- labeled peptide moieties, many other types of delivery molecules, such as oligonucleotides, hormones, growth factors, cytokines, chemokines, angiogenic factors, anti-angiogenic factors, immunomodulators, proteins, nucleic acids, antibodies, antibody fragments, drugs, interleukins, interferons, oligosaccharides, polysaccharides, lipids, etc. may be 18 F-labeled and utilized for imaging purposes.
- Exemplary targetable construct peptides described in the Examples below, of use for pre-targeting delivery of F or other agents include but are not limited to IMP 449, IMP 460, IMP 461, IMP 467, IMP 469, IMP 470, IMP 471, IMP 479, IMP 485 and IMP 487, comprising chelating moieties that include, but are not limited to, DTP A, NOTA, benzyl- NOTA, alkyl or aryl derivatives of NOTA, NODA-GA, C-NETA, succinyl-C-NETA and bis- t-butyl-NODA.
- the exemplary F-labeled peptides may be of use as targetable constructs in a pre-targeting method, utilizing bispecific or multispecific antibodies or antibody fragments.
- the antibody or fragment will comprise one or more binding sites for a target associated with a disease or condition, such as a tumor-associated or autoimmune disease-associated antigen or an antigen produced or displayed by a pathogenic organism, such as a virus, bacterium, fungus or other microorganism.
- a second binding site will specifically bind to the targetable construct.
- antibodies or fragments thereof that bind to targetable constructs are also well known in the art, such as the 679 monoclonal antibody that binds to HSG (histamine succinyl glycine) or the 734 antibody that binds to In-DTPA (see U.S. Patent Nos. 7,429,381 ; 7,563,439; 7,666,415; and 7,534,431, the Examples section of each incorporated herein by reference).
- HSG human glycostyl glycine
- 734 antibody that binds to In-DTPA see U.S. Patent Nos. 7,429,381 ; 7,563,439; 7,666,415; and 7,534,431, the Examples section of each incorporated herein by reference.
- pretargeting methods the bispecific or multispecific antibody is administered first and allowed to bind to cell or tissue target antigens. After an appropriate amount of time for unbound antibody to clear from circulation, the e.g.
- F-labeled targetable construct is administered to the patient and binds to the antibody localized to target cells or tissues, then an image is taken for example by PET scanning.
- molecules that bind directly to receptors such as somatostatin, octreotide, bombesin, folate or a folate analog, an RGD peptide or other known receptor ligands may be labeled and used for imaging.
- Receptor targeting agents may include, for example, TA138, a non-peptide antagonist for the integrin ⁇ ⁇ ⁇ 3 receptor (Liu et al., 2003, Bioconj. Chem. 14: 1052-56).
- proteins or peptides that binds to a diseased tissue or target, such as cancer may be labeled with F by the disclosed methods and used for detection and/or imaging.
- proteins or peptides may include, but are not limited to, antibodies or antibody fragments that bind to tumor-associated antigens (TAAs). Any known TAA-binding antibody or fragment may be labeled with F by the described methods and used for imaging and/or detection of tumors, for example by PET scanning or other known techniques.
- the click chemistry involves the reaction of a targeting molecule such as an antibody or antigen-binding antibody fragment, comprising an activating moiety such as an alkyne, a nitrone or an azide group, with a chelating moiety or a carrier molecule attached to one or more chelating groups and comprising a corresponding reactive moiety, such as an azide, alkyne or nitrone.
- a targeting molecule such as an antibody or antigen-binding antibody fragment
- an activating moiety such as an alkyne, a nitrone or an azide group
- a chelating moiety or a carrier molecule attached to one or more chelating groups and comprising a corresponding reactive moiety, such as an azide, alkyne or nitrone.
- the targeting molecule comprises an alkyne
- the chelating moiety or carrier will comprise an azide, a nitrone or similar reactive moiety.
- the click chemistry reaction may occur in vitro to form
- FIG. 1 Biodistribution of 18 F-labeled agents in tumor-bearing nude mice by microPET imaging. Coronal slices of 3 nude mice bearing a small, subcutaneous LS174T tumor on each left flank after being injected with either (A) [ 18 F]FDG, (B) A1[ 18 F] IMP 449 pretargeted with the anti-CEA x anti-HSG bsMAb, (C) Alf' ] IMP 449 alone (not pretargeted with the bsMAb). Biodistribution data expressed as percent-injected dose per gram (% ID/g) are given for the tissues removed from the animals at the conclusion of the imaging session. Abbreviations: B, bone marrow; H, heart; K, kidney; T, tumor.
- FIG. 2 Dynamic imaging study of pretargeted A1[ 18 F] IMP 449 given to a nude mouse bearing a 35-mg LS174T human colorectal cancer xenograft in the upper flank.
- the top 3 panels show coronal, sagittal, and transverse sections, respectively, taken of a region of the body centering on the tumor's peripheral location at 6 different 5-min intervals over the 120-min imaging session.
- the first image on the left in each sectional view shows the positioning of the tumor at the intersection of the crosshairs, which is highlighted by arrows. The animal was partially tilted to its right side during the imaging session.
- the bottom 2 panels show additional coronal and sagittal sections that focus on a more anterior plane in the coronal section to highlight distribution in the liver and intestines, while the sagittal view crosses more centrally in the body.
- FIG. 3 In vivo tissue distribution with 18 F-labeled IMP 468 bombesin analogue.
- FIG. 5 Coronal slices of PET/CT scan of 18 F-IMP 466 and 68 Ga-IMP 466 at 2 h p.i. in mice with an s.c. AR42J tumor in the neck. Accumulation in tumor and kidneys is clearly visualized.
- FIG. 8 PET/CT images of a BALB/c nude mouse with a subcutaneous LS174T tumor (0.1 g) on the right hind leg (light arrow) and a inflammation in the left thigh muscle (dark arrow), that received 5 MBq 18 F-FDG, and one day later 6.0 nmol TF2 and 5 MBq 68 Ga-IMP 288 (0.25 nmol) with a 16 hour interval. The animal was imaged one hour after the
- the panel shows the 3D volume rendering (A), transverse sections of the tumor region (B) of the FDG-PET scan, and the 3D volume rendering (C), transverse sections of the tumor region (D) of the pretargeted immunoPET scan.
- FIG. 9 Biodistribution of 0.25 nmol A1 18 F-IMP 449 (5 MBq) 1 hour after i.v.
- FIG. 10 Static PET/CT imaging study of a BALB/c nude mouse with a
- subcutaneous LS174T tumor (0.1 g) on the right side (arrow), that received 6.0 nmol TF2 and 0.25 nmol Al F-IMP 449 (5 MBq) intravenously with a 16 hour interval.
- the animal was imaged one hour after injection of A1 18 F-IMP 449.
- the panel shows the 3D volume rendering (A) posterior view, and cross sections at the tumor region, (B) coronal, (C) sagittal.
- FIG. 11 Structure of IMP 479 (SEQ ID NO:35).
- FIG. 12 Structure of IMP 485 (SEQ ID NO:36).
- FIG. 13 Structure of IMP 487 (SEQ ID NO:37).
- FIG. 14 Synthesis of 6w-/-butyl-NODA-MPAA.
- FIG. 15 Synthesis of maleimide conjugate of NOTA.
- a “peptide” refers to any sequence of naturally occurring or non- naturally occurring amino acids of between 2 and 100 amino acid residues in length, more preferably between 2 and 10, more preferably between 2 and 6 amino acids in length.
- An “amino acid” may be an L-amino acid, a D-amino acid, an amino acid analogue, an amino acid derivative or an amino acid mimetic.
- pathogen includes, but is not limited to fungi, viruses, parasites and bacteria, including but not limited to human immunodeficiency virus (HIV), herpes virus, cytomegalovirus, rabies virus, influenza virus, hepatitis B virus, Sendai virus, feline leukemia virus, Reovirus, polio virus, human serum parvo-like virus, simian virus 40, respiratory syncytial virus, mouse mammary tumor virus, Varicella-Zoster virus, Dengue virus, rubella virus, measles virus, adenovirus, human T-cell leukemia viruses, Epstein-Barr virus, murine leukemia virus, mumps virus, vesicular stomatitis virus, Sindbis virus, lymphocytic choriomeningitis virus, wart virus, blue tongue virus, Streptococcus agalactiae, Legionella pneumophila, Streptococcus p
- a "radiolysis protection agent” refers to any molecule, compound or composition that may be added to an F-labeled complex or molecule to decrease the rate of breakdown of the 18 F-labeled complex or molecule by radiolysis. Any known radiolysis protection agent, including but not limited to ascorbic acid, may be used.
- a more recent method of binding 18 F to silicon uses isotopic exchange to displace l9 F with 18 F (Shirrmacher et al, 2007). Performed at room temperature in 10 min, this reaction produces the 18 F-prosthetic aldehyde group with high specific activity (225-680 GBq/ ⁇ ; 6,100-18,400 Ci/mmol).
- the I8 F-labeled aldehyde is subsequently conjugated to a peptide and purified by HPLC, and the purified labeled peptide is obtained within 40 min (including dry-down) with ⁇ 55% yield. This was modified subsequently to a single-step process by incorporating the silicon into the peptide before the labeling reaction (Hohne et al, 2008).
- Antibodies and peptides are coupled routinely with radiometals, typically in 15 min and in quantitative yields (Meares et al., 1984, Acc Chem Res 17:202-209; Scheinberg et al., 1982, Science 215: 151 1-13).
- radiometals typically in 15 min and in quantitative yields
- 64 Cu and 68 Ga have been bound to peptides via a chelate, and have shown reasonably good PET-imaging properties (Heppler et al., 2000, Current Med Chem 7:971-94). Since fluoride binds to most metals, we sought to determine if an F-metal complex could be bound to a chelator on a targeting molecule (Tewson, 1989, Nucl Med Biol.
- the moiety labeled with 18 F or other diagnostic and/or therapeutic agents may comprise a peptide or other targetable construct.
- Labeled peptides (or proteins) may be selected to bind directly to a targeted cell, tissue, pathogenic organism or other target for imaging, detection and/or diagnosis.
- labeled peptides may be selected to bind indirectly, for example using a bispecific antibody with one or more binding sites for a targetable construct peptide and one or more binding sites for a target antigen associated with a disease or condition.
- Bispecific antibodies may be used, for example, in a pretargeting technique wherein the antibody may be administered first to a subject.
- a targetable construct such as a labeled peptide
- the distribution of 18 F-labeled targetable constructs may be determined by PET scanning or other known techniques.
- Such targetable constructs can be of diverse structure and are selected not only for the availability of an antibody or fragment that binds with high affinity to the targetable construct, but also for rapid in vivo clearance when used within the pre-targeting method and bispecific antibodies (bsAb) or multispecific antibodies.
- Hydrophobic agents are best at eliciting strong immune responses, whereas hydrophilic agents are preferred for rapid in vivo clearance.
- hydrophilic chelating agents to offset the inherent hydrophobicity of many organic moieties.
- sub-units of the targetable construct may be chosen which have opposite solution properties, for example, peptides, which contain amino acids, some of which are hydrophobic and some of which are hydrophilic. Aside from peptides, carbohydrates may also be used.
- Peptides having as few as two amino acid residues, preferably two to ten residues, may be used and may also be coupled to other moieties, such as chelating agents.
- the linker should be a low molecular weight conjugate, preferably having a molecular weight of less than 50,000 daltons, and advantageously less than about 20,000 daltons, 10,000 daltons or 5,000 daltons.
- the targetable construct peptide will have four or more residues, such as the peptide DOTA-Phe-Lys(HSG)-Tyr-Lys(HSG)-NH 2 (SEQ ID NO: 1), wherein DOTA is 1 ,4,7,10-tetraazacyclododecane 1 ,4, 7, 10-tetraacetic acid and HSG is the histamine succinyl glycyl group.
- DOTA may be replaced by NOTA (1 ,4,7-triaza- cyclononane-l,4,7-triacetic acid), TETA (p-bromoacetamido-benzyl- tetraethylaminetetraacetic acid), NETA ([2-(4,7-biscarboxymethyl[l ,4,7]triazacyclononan-l- yl-ethyl]-2-carbonylmethyl-amino]acetic acid) or other known chelating moieties.
- NOTA 1,4,7-triaza- cyclononane-l,4,7-triacetic acid
- TETA p-bromoacetamido-benzyl- tetraethylaminetetraacetic acid
- NETA [2-(4,7-biscarboxymethyl[l ,4,7]triazacyclononan-l- yl-ethyl]-2-carbonylmethyl-amino]acetic acid) or other known
- the targetable construct may also comprise unnatural amino acids, e.g., D-amino acids, in the backbone structure to increase the stability of the peptide in vivo.
- unnatural amino acids e.g., D-amino acids
- other backbone structures such as those constructed from non-natural amino acids or peptoids may be used.
- the peptides used as targetable constructs are conveniently synthesized on an automated peptide synthesizer using a solid-phase support and standard techniques of repetitive orthogonal deprotection and coupling. Free amino groups in the peptide, that are to be used later for conjugation of chelating moieties or other agents, are advantageously blocked with standard protecting groups such as a Boc group, while N-terminal residues may be acetylated to increase serum stability.
- protecting groups are well known to the skilled artisan. See Greene and Wuts Protective Groups in Organic Synthesis, 1999 (John Wiley and Sons, N.Y.).
- the peptides are prepared for later use within the bispecific antibody system, they are advantageously cleaved from the resins to generate the corresponding C- terminal amides, in order to inhibit in vivo carboxypeptidase activity.
- Exemplary methods of peptide synthesis are disclosed in the Examples below.
- the antibody will contain a first binding site for an antigen produced by or associated with a target tissue and a second binding site for a hapten on the targetable construct.
- haptens include, but are not limited to, HSG and In-DTPA.
- Antibodies raised to the HSG hapten are known (e.g. 679 antibody) and can be easily incorporated into the appropriate bispecific antibody (see, e.g., U.S. Patent Nos. 6,962,702; 7,138,103 and 7,300,644, incorporated herein by reference with respect to the Examples sections).
- haptens and antibodies that bind to them are known in the art and may be used, such as In-DTPA and the 734 antibody (e.g., U.S. Patent No.7,534,431 , the Examples section incorporated herein by reference).
- targetable constructs are peptides
- polymeric molecules such as polyethylene glycol (PEG) may be easily derivatized with chelating moieties to bind 18 F-A1.
- PEG polyethylene glycol
- carrier molecules are known in the art and may be utilized, including but not limited to polymers, nanoparticles, microspheres, liposomes and micelles.
- the carrier molecule comprise one or more chelating moieties for attachment of metal- 18 F and one or more hapten moieties to bind to a bispecific or multispecific antibody or other targeting molecule.
- an F-labeled molecule may comprise one or more hydrophilic chelate moieties, which can bind metal ions and also help to ensure rapid in vivo clearance.
- Chelators may be selected for their particular metal-binding properties, and may be readily interchanged.
- Particularly useful metal-chelate combinations include 2-benzyl-DTPA and its monomethyl and cyclohexyl analogs.
- Macrocyclic chelators such as NOTA (1 ,4,7-triaza- cyclononane-l ,4,7-triacetic acid), DOTA, TETA (p-bromoacetamido-benzyl- tetraethylaminetetraacetic acid) and NETA are also of use with a variety of metals, that may potentially be used as ligands for F conjugation.
- DTPA and DOTA-type chelators where the ligand includes hard base chelating functions such as carboxylate or amine groups, are most effective for chelating hard acid cations, especially Group Ila and Group Ilia metal cations.
- Such metal-chelate complexes can be made very stable by tailoring the ring size to the metal of interest.
- Other ring-type chelators such as macrocyclic polyethers are of interest for stably binding nuclides.
- Porphyrin chelators may be used with numerous metal complexes. More than one type of chelator may be conjugated to a carrier to bind multiple metal ions. Chelators such as those disclosed in U.S. Pat. No.
- Tscg-Cys thiosemicarbazonylglyoxylcysteine
- Tsca-Cys thiosemicarbazinyl-acetylcysteine
- chelators are advantageously used to bind soft acid cations of Tc, Re, Bi and other transition metals, lanthanides and actinides that are tightly bound to soft base ligands. It can be useful to link more than one type of chelator to a peptide. Because antibodies to a di-DTPA hapten are known (Barbet et al., U.S. Pat. Nos.
- peptide hapten with cold diDTPA chelator and another chelator for binding an 18 F complex, in a pretargeting protocol.
- a peptide is Ac-Lys(DTPA)- Tyr-Lys(DTPA)-Lys(Tscg-Cys)-NH 2 (core peptide disclosed as SEQ ID NO:2).
- Other hard acid chelators such as DOTA, TETA and the like can be substituted for the DTPA and/or Tscg-Cys groups, and MAbs specific to them can be produced using analogous techniques to those used to generate the anti-di-DTPA MAb.
- Another useful chelator may comprise a NOTA-type moiety, for example as disclosed in Chong et al. (J. Med. Chem. , 2008, 51 : 1 18-25).
- Chong et al. disclose the production and use of a bifunctional C-NETA ligand, based upon the NOTA structure, that when complexed
- chelators are not limiting and these and other examples of chelators that are known in the art and/or described in the following Examples may be used in the practice of the invention.
- two different hard acid or soft acid chelators can be incorporated into the targetable construct, e.g., with different chelate ring sizes, to bind preferentially to two different hard acid or soft acid cations, due to the differing sizes of the cations, the geometries of the chelate rings and the preferred complex ion structures of the cations.
- This will permit two different metals, one or both of which may be attached to 18 F, to be incorporated into a targetable construct for eventual capture by a pretargeted bispecific antibody.
- Targeting antibodies of use may be specific to or selective for a variety of cell surface or disease-associated antigens.
- Exemplary target antigens of use for imaging or treating various diseases or conditions may include carbonic anhydrase IX, CCCL19, CCCL21, CSAp, CD1, CDla, CD2, CD3, CD4, CD5, CD8, CD1 1 A, CD14, CD15, CD16, CD 18, CD 19, IGF-1R, CD20, CD21 , CD22, CD23, CD25, CD29, CD30, CD32b, CD33, CD37, CD38, CD40, CD40L, CD45, CD46, CD52, CD54, CD55, CD59, CD64, CD66a-e, CD67, CD70, CD74, CD79a, CD80, CD83, CD95, CD126, CD133,
- antibodies of use may target tumor-associated antigens.
- These antigenic markers may be substances produced by a tumor or may be substances which accumulate at a tumor site, on tumor cell surfaces or within tumor cells.
- tumor-associated markers are those disclosed by Herberman, "Immunodiagnosis of Cancer", in Fleisher ed., “The Clinical Biochemistry of Cancer", page 347 (American Association of Clinical Chemists, 1979) and in U.S. Pat. Nos. 4,150,149; 4,361,544; and 4,444,744, the Examples section of each of which is incorporated herein by reference.
- Reports on tumor associated antigens (TAAs) include Mizukami et al., (2005, Nature Med. 1 1 :992-97); Hatfield et al., (2005, Curr. Cancer Drug Targets 5:229-48);
- Tumor-associated markers have been categorized by Herberman, supra, in a number of categories including oncofetal antigens, placental antigens, oncogenic or tumor virus associated antigens, tissue associated antigens, organ associated antigens, ectopic hormones and normal antigens or variants thereof. Occasionally, a sub-unit of a tumor-associated marker is advantageously used to raise antibodies having higher tumor-specificity, e.g., the beta-subunit of human chorionic gonadotropin (HCG) or the gamma region of HCG.
- HCG human chorionic gonadotropin
- CEA carcinoembryonic antigen
- TACI transmembrane activator and CAML-interactor
- B-cell malignancies e.g., lymphoma
- TACI and B-cell maturation antigen BCMA
- APRIL proliferation-inducing ligand
- APRIL stimulates in vitro proliferation of primary B and T-cells and increases spleen weight due to accumulation of B-cells in vivo.
- APRIL also competes with TALL-I (also called BLyS or BAFF) for receptor binding.
- Soluble BCMA and TACI specifically prevent binding of APRIL and block APRIL-stimulated proliferation of primary B-cells.
- BCMA-Fc also inhibits production of antibodies against keyhole limpet hemocyanin and Pneumovax in mice, indicating that APRIL and/or TALL-I signaling via BCMA and/or TACI are required for generation of humoral immunity.
- APRIL-TALL-I and BCMA-TACI form a two ligand-two receptor pathway involved in stimulation of B and T-cell function.
- targeted antigens may be selected from the group consisting of CD4, CD5, CD8, CD14, CD15, CD19, CD20, CD21, CD22, CD23, CD25, CD33, CD37, CD38, CD40, CD40L, CD46, CD52, CD54, CD67, CD74, CD79a, CD80, CD126, CD138, CD154, B7, MUC1 , la, Ii, HM1.24, HLA-DR, tenascin, VEGF, P1GF, ED-B fibronectin, an oncogene (e.g., c-met or PLAGL2), an oncogene product, CD66a-d, necrosis antigens, IL-2, T101, TAG, IL-6, MIF, TRAIL-R1 (DR4) and TRAIL-R2 (DR5).
- MAbs can be isolated and purified from hybridoma cultures by a variety of well-established techniques. Such isolation techniques include affinity chromatography with Protein-A or Protein-G Sepharose, size-exclusion chromatography, and ion-exchange chromatography. See, for example, Coligan at pages 2.7.1 -2.7.12 and pages 2.9.1-2.9.3. Also, see Baines et al, "Purification of Immunoglobulin G (IgG)," in METHODS IN
- a chimeric antibody is a recombinant protein in which the variable regions of a human antibody have been replaced by the variable regions of, for example, a mouse antibody, including the complementarity-determining regions (CDRs) of the mouse antibody.
- Chimeric antibodies exhibit decreased immunogenicity and increased stability when administered to a subject.
- CDRs complementarity-determining regions
- Humanized Antibodies Techniques for producing humanized MAbs are well known in the art (see, e.g., Jones et al, Nature 321: 522 (1986), Riechmann et al, Nature 332: 323 (1988), Verhoeyen et al, Science 239: 1534 (1988), Carter et al, Proc. Nat'l Acad. Sci. USA 89: 4285 (1992), Sandhu, Crit. Rev. Biotech. 12: 437 (1992), and Singer et al, J. Immun. 150: 2844 (1993)).
- a chimeric or murine monoclonal antibody may be humanized by transferring the mouse CDRs from the heavy and light variable chains of the mouse immunoglobulin into the
- variable domains of a human antibody The mouse framework regions (FR) in the chimeric monoclonal antibody are also replaced with human FR sequences.
- additional modification might be required in order to restore the original affinity of the murine antibody. This can be accomplished by the replacement of one or more human residues in the FR regions with their murine counterparts to obtain an antibody that possesses good binding affinity to its epitope. See, for example, Tempest et al, Biotechnology 9:266 (1991) and Verhoeyen et al, Science 239: 1534 (1988).
- Preferred residues for substitution include FR residues that are located within 1, 2, or 3 Angstroms of a CDR residue side chain, that are located adjacent to a CDR sequence, or that are predicted to interact with a CDR residue.
- the phage display technique may be used to generate human antibodies (e.g., Dantas-Barbosa et al., 2005, Genet. Mol. Res. 4: 126-40).
- Human antibodies may be generated from normal humans or from humans that exhibit a particular disease state, such as cancer (Dantas-Barbosa et al., 2005).
- the advantage to constructing human antibodies from a diseased individual is that the circulating antibody repertoire may be biased towards antibodies against disease-associated antigens.
- Fab fragment antigen binding protein
- RNAs were converted to cDNAs and used to make Fab cDNA libraries using specific primers against the heavy and light chain immunoglobulin sequences (Marks et al., 1991 , J. Mol. Biol. 222:581-97).
- Library construction was performed according to Andris-Widhopf et al. (2000, In: Phage Display Laboratory Manual, Barbas et al. (eds), 1 st edition, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY pp. 9.1 to 9.22).
- Fab fragments were digested with restriction endonucleases and inserted into the bacteriophage genome to make the phage display library.
- libraries may be screened by standard phage display methods, as known in the art.
- Phage display can be performed in a variety of formats, for their review, see e.g. Johnson and Chiswell, Current Opinion in Structural Biology 3:5564-571 (1993).
- Human antibodies may also be generated by in vitro activated B-cells. See U.S. Patent Nos. 5,567,610 and 5,229,275, incorporated herein by reference in their entirety. The skilled artisan will realize that these techniques are exemplary and any known method for making and screening human antibodies or antibody fragments may be utilized.
- transgenic animals that have been genetically engineered to produce human antibodies may be used to generate antibodies against essentially any immunogenic target, using standard immunization protocols.
- Methods for obtaining human antibodies from transgenic mice are disclosed by Green et al, Nature Genet. 7: 13 (1994), Lonberg et al, Nature 3(55:856 (1994), and Taylor et al, Int. Immun. 6:519 (1994).
- a non- limiting example of such a system is the XenoMouse® (e.g. , Green et al., 1999, J. Immunol. Methods 231 : 1 1-23, incorporated herein by reference) from Abgenix (Fremont, CA).
- the mouse antibody genes have been inactivated and replaced by functional human antibody genes, while the remainder of the mouse immune system remains intact.
- the XenoMouse® was transformed with germline-configured YACs (yeast artificial chromosomes) that contained portions of the human IgH and Igkappa loci, including the majority of the variable region sequences, along with accessory genes and regulatory sequences.
- the human variable region repertoire may be used to generate antibody producing B-cells, which may be processed into hybridomas by known techniques.
- a XenoMouse® immunized with a target antigen will produce human antibodies by the normal immune response, which may be harvested and/or produced by standard techniques discussed above.
- a variety of strains of XenoMouse® are available, each of which is capable of producing a different class of antibody.
- Transgenically produced human antibodies have been shown to have therapeutic potential, while retaining the pharmacokinetic properties of normal human antibodies (Green et al., 1999).
- the skilled artisan will realize that the claimed compositions and methods are not limited to use of the XenoMouse® system but may utilize any transgenic animal that has been genetically engineered to produce human antibodies.
- the targeting molecules of use for imaging, detection and/or diagnosis may incorporate any antibody or fragment known in the art that has binding specificity for a target antigen associated with a disease state or condition.
- known antibodies include, but are not limited to, hRl (anti-IGF-lR, U.S. Patent Application Serial No. 12/772,645, filed 3/12/10) hPAM4 (anti-pancreatic cancer mucin, U.S. Patent No. 7,282,567), hA20 (anti-CD20, U.S. Patent No. 7,251 ,164), hA19 (anti-CD19, U.S. Patent No. 7,109,304), hIMMU31 (anti-AFP, U.S. Patent No.
- Candidate anti-HIV antibodies include the anti-envelope antibody described by Johansson et al. (AIDS. 2006 Oct 3;20(15): 1911-5), as well as the anti-HIV antibodies described and sold by Polymun (Vienna, Austria), also described in U.S. Patent 5,831 ,034, U.S. patent 5,911 ,989, and Vcelar et al., AIDS 2007; 21 (16):2161-2170 and Joos et al, Antimicrob. Agents Chemother. 2006; 50(5): 1773-9, all incorporated herein by reference.
- the second MAb may be selected from any anti-hapten antibody known in the art, including but not limited to h679 (U.S. Patent No. 7,429,381) and 734 (U.S. Patent Nos. 7,429,381 ; 7,563,439; 7,666,415; and 7,534,431), the Examples section of each of which is incorporated herein by reference.
- Such known antibodies are of use for detection and/or imaging of a variety of disease states or conditions (e.g., hMN-14 or TF2 (CEA-expressing carcinomas), hA20 or TF-4 (lymphoma), hPAM4 or TF-10 (pancreatic cancer), RS7 (lung, breast, ovarian, prostatic cancers), hMN-15 or hMN3 (inflammation), anti-gpl20 and/or anti-gp41 (HIV), anti-platelet and anti-thrombin (clot imaging), anti- myosin (cardiac necrosis), anti-CXCR4 (cancer and inflammatory disease)).
- hMN-14 or TF2 CEA-expressing carcinomas
- hA20 or TF-4 lymphoma
- hPAM4 or TF-10 pancreatic cancer
- RS7 lung, breast, ovarian, prostatic cancers
- hMN-15 or hMN3 inflammation
- Antibodies of use may be commercially obtained from a wide variety of known sources.
- a variety of antibody secreting hybridoma lines are available from the American Type Culture Collection (ATCC, Manassas, VA).
- ATCC American Type Culture Collection
- VA Manassas
- a large number of antibodies against various disease targets, including but not limited to tumor-associated antigens, have been deposited at the ATCC and/or have published variable region sequences and are available for use in the claimed methods and compositions. See, e.g., U.S. Patent Nos.
- antibody sequences or antibody- secreting hybridomas against almost any disease-associated antigen may be obtained by a simple search of the ATCC, NCBI and/or USPTO databases for antibodies against a selected disease-associated target of interest.
- the antigen binding domains of the cloned antibodies may be amplified, excised, ligated into an expression vector, transfected into an adapted host cell and used for protein production, using standard techniques well known in the art.
- Antibody fragments which recognize specific epitopes can be generated by known techniques.
- the antibody fragments are antigen binding portions of an antibody, such as F(ab') 2, Fab', F(ab) 2 , Fab, Fv, sFv and the like.
- F(ab') 2 fragments can be produced by pepsin digestion of the antibody molecule and Fab' fragments can be generated by reducing disulfide bridges of the F(ab') 2 fragments.
- Fab ' expression libraries can be constructed (Huse et al, 1989, Science, 246: 1274-1281) to allow rapid and easy identification of monoclonal Fab' fragments with the desired specificity.
- An antibody fragment can be prepared by proteolytic hydrolysis of the full length antibody or by expression in E. coli or another host of the DNA coding for the fragment. These methods are described, for example, by Goldenberg, U.S. Patent Nos. 4,036,945 and 4,331,647 and references contained therein, which patents are incorporated herein in their entireties by reference. Also, see Nisonoff et al, Arch Biochem. Biophys. 89: 230 (1960); Porter, Biochem. J. 73: 1 19 (1959), Edelman et al, in METHODS IN ENZYMOLOGY VOL. 1, page 422 (Academic Press 1967), and Coligan at pages 2.8.1 - 2.8.10 and 2.10.-2.10.4.
- a single chain Fv molecule comprises a VL domain and a VH domain.
- the VL and VH domains associate to form a target binding site.
- These two domains are further covalently linked by a peptide linker (L).
- L peptide linker
- An scFv library with a large repertoire can be constructed by isolating V-genes from non-immunized human donors using PCR primers corresponding to all known VH, Vkappa and V 8 o gene families. See, e.g., Vaughn et al., Nat. Biotechnol., 14: 309-314 (1996). Following amplification, the Vk apP a and Vi am bd a pools are combined to form one pool. These fragments are ligated into a phagemid vector. The scFv linker is then ligated into the phagemid upstream of the VL fragment.
- VH and linker- VL fragments are amplified and assembled on the JH region.
- the resulting V H -linker-VL fragments are ligated into a phagemid vector.
- the phagemid library can be panned for binding to the selected antigen.
- VHH Single domain antibodies
- Single domain antibodies may be obtained, for example, from camels, alpacas or llamas by standard immunization techniques.
- the VHH may have potent antigen-binding capacity and can interact with novel epitopes that are inaccessible to conventional VH-VL pairs.
- Alpaca serum IgG contains about 50% camelid heavy chain only IgG antibodies (Cabs) (Maass et al., 2007).
- Alpacas may be immunized with known antigens and VHHs can be isolated that bind to and neutralize the target antigen (Maass et al, 2007).
- PCR primers that amplify virtually all alpaca VHH coding sequences have been identified and may be used to construct alpaca VHH phage display libraries, which can be used for antibody fragment isolation by standard biopanning techniques well known in the art (Maass et al., 2007).
- VK variable light chain
- VH variable heavy chain sequences for an antibody of interest
- the V genes of a MAb from a cell that expresses a murine MAb can be cloned by PCR amplification and sequenced.
- the cloned VL and VH genes can be expressed in cell culture as a chimeric Ab as described by Orlandi et al, , (Proc. Natl Acad.
- a humanized MAb can then be designed and constructed as described by Leung et al. ⁇ Mol. Immunol , 32: 1413 (1995)).
- cDNA can be prepared from any known hybridoma line or transfected cell line producing a murine MAb by general molecular cloning techniques (Sambrook et al., Molecular Cloning, A laboratory manual, 2 nd Ed (1989)).
- the VK sequence for the MAb may be amplified using the primers V 1BACK and VK1FOR (Orlandi et al, 1989) or the extended primer set described by Leung et al. (BioTechniques, 15: 286 (1993)).
- VH sequences can be amplified using the primer pair VHIBACK/VHIFOR (Orlandi et al, 1989) or the primers annealing to the constant region of murine IgG described by Leung et al. (Hybridoma, 13:469 (1994)).
- Humanized V genes can be constructed by a combination of long oligonucleotide template syntheses and PCR amplification as described by Leung et al. ⁇ Mol. Immunol, 32: 1413 (1995)).
- PCR products for VK can be subcloned into a staging vector, such as a pBR327-based staging vector, VKpBR, that contains an Ig promoter, a signal peptide sequence and convenient restriction sites.
- PCR products for VH can be subcloned into a similar staging vector, such as the pBluescript-based VHpBS.
- Expression cassettes containing the VK and VH sequences together with the promoter and signal peptide sequences can be excised from VKpBR and VHpBS and ligated into appropriate expression vectors, such as pKh and pGlg, respectively (Leung et al., Hybridoma, 13:469 (1994)).
- the expression vectors can be co-transfected into an appropriate cell and supernatant fluids monitored for production of a chimeric, humanized or human MAb.
- the VK and VH expression cassettes can be excised and subcloned into a single expression vector, such as pdHL2, as described by Gillies et al (J Immunol. Methods 125: 191 (1989) and also shown in Losman et al., Cancer, 80:2660 (1997)).
- expression vectors may be transfected into host cells that have been pre-adapted for transfection, growth and expression in serum-free medium.
- Exemplary cell lines that may be used include the Sp EEE, Sp/ESF and Sp/ESF-X cell lines (see, e.g., U.S. Patent Nos. 7,531 ,327; 7,537,930 and 7,608,425; the Examples section of each of which is incorporated herein by reference). These exemplary cell lines are based on the Sp2/0 myeloma cell line, transfected with a mutant Bcl-EEE gene, exposed to methotrexate to amplify transfected gene sequences and pre-adapted to serum-free cell line for protein expression.
- Certain embodiments concern pretargeting methods with bispecific antibodies and hapten-bearing targetable constructs. Numerous methods to produce bispecific or
- Bispecific antibodies can be produced by the quadroma method, which involves the fusion of two different antibodies
- bispecific antibodies each producing a monoclonal antibody recognizing a different antigenic site (Milstein and Cuello, Nature, 1983; 305:537-540).
- Another method for producing bispecific antibodies uses heterobifunctional cross- linkers to chemically tether two different monoclonal antibodies (Staerz, et al. Nature. 1985; 314:628-631 ; Perez, et al. Nature. 1985; 316:354-356).
- Bispecific antibodies can also be produced by reduction of each of two parental monoclonal antibodies to the respective half molecules, which are then mixed and allowed to reoxidize to obtain the hybrid structure (Staerz and Bevan. Proc Natl Acad Sci U S A. 1986; 83: 1453-1457).
- Other methods include improving the efficiency of generating hybrid hybridomas by gene transfer of distinct selectable markers via retrovirus-derived shuttle vectors into respective parental hybridomas, which are fused subsequently (DeMonte, et al. Proc Natl Acad Sci U S A. 1990, 87:2941- 2945); or transfection of a hybridoma cell line with expression plasmids containing the heavy and light chain genes of a different antibody.
- Cognate VH and VL domains can be joined with a peptide linker of appropriate composition and length (usually consisting of more than 12 amino acid residues) to form a single-chain Fv (scFv), as discussed above. Reduction of the peptide linker length to less than 12 amino acid residues prevents pairing of VH and VL domains on the same chain and forces pairing of VH and VL domains with complementary domains on other chains, resulting in the formation of functional multimers. Polypeptide chains of VH and VL domains that are joined with linkers between 3 and 12 amino acid residues form predominantly dimers (termed diabodies).
- trimers with linkers between 0 and 2 amino acid residues, trimers (termed triabody) and tetramers (termed tetrabody) are favored, but the exact patterns of oligomerization appear to depend on the composition as well as the orientation of V-domains (Vn-linker-V L or VL- linker-V H ), in addition to the linker length.
- the DNL technique allows the assembly of monospecific, bispecific or multispecific antibodies, either as naked antibody moieties or in combination with a wide range of other effector molecules such as immunomodulators, enzymes, chemotherapeutic agents, chemokines, cytokines, diagnostic agents, therapeutic agents, radionuclides, imaging agents, anti-angiogenic agents, growth factors, oligonucleotides, hormones, peptides, toxins, pro-apoptotic agents, or a combination thereof. Any of the techniques known in the art for making bispecific or multispecific antibodies may be utilized in the practice of the presently claimed methods.
- bispecific or multispecific antibodies or other constructs may be produced using the dock-and-lock technology (see, e.g., U.S. Patent Nos. 7,550,143; 7,521,056; 7,534,866; 7,527,787 and 7,666,400, the Examples section of each incorporated herein by reference).
- the DNL method exploits specific protein/protein interactions that occur between the regulatory (R) subunits of cAMP-dependent protein kinase (PKA) and the anchoring domain (AD) of A-kinase anchoring proteins (AKAPs) (Baillie et al, FEBS Letters. 2005; 579: 3264. Wong and Scott, Nat. Rev. Mol. Cell Biol.
- PKA which plays a central role in one of the best studied signal transduction pathways triggered by the binding of the second messenger cAMP to the R subunits
- the structure of the holoenzyme consists of two catalytic subunits held in an inactive form by the R subunits (Taylor, J. Biol. Chem. 1989;264:8443). Isozymes of PKA are found with two types of R subunits (RI and RII), and each type has a and ⁇ isoforms (Scott, Pharmacol. Ther.
- R subunits have been isolated only as stable dimers and the dimerization domain has been shown to consist of the first 44 amino-terminal residues (Newlon et al., Nat. Struct. Biol. 1999; 6:222). Binding of cAMP to the R subunits leads to the release of active catalytic subunits for a broad spectrum of serine/threonine kinase activities, which are oriented toward selected substrates through the compartmentalization of PKA via its docking with AKAPs (Scott et al, J. Biol. Chem. 1990;265;21561)
- AKAP microtubule-associated protein-2
- the amino acid sequences of the AD are quite varied among individual AKAPs, with the binding affinities reported for RII dimers ranging from 2 to 90 nM (Alto et al, Proc. Natl. Acad. Sci. USA. 2003;100:4445). AKAPs will only bind to dimeric R subunits. For human Rlla, the AD binds to a hydrophobic surface formed by the 23 amino-terminal residues (Colledge and Scott, Trends Cell Biol. 1999; 6:216). Thus, the dimerization domain and AKAP binding domain of human RJIa are both located within the same N-terminal 44 amino acid sequence (Newlon et al, Nat. Struct. Biol. 1999;6:222; Newlon et al, EMBO J. 2001 ;20: 1651), which is termed the DDD herein.
- Entity B is constructed by linking an AD sequence to a precursor of B, resulting in a second component hereafter referred to as b.
- the dimeric motif of DDD contained in a 2 will create a docking site for binding to the AD sequence contained in b, thus facilitating a ready association of a 2 and b to form a binary, trimeric complex composed of a 2 b.
- This binding event is made irreversible with a subsequent reaction to covalently secure the two entities via disulfide bridges, which occurs very efficiently based on the principle of effective local concentration because the initial binding interactions should bring the reactive thiol groups placed onto both the DDD and AD into proximity (Chmura et al., Proc. Natl. Acad. Sci. USA. 2001 ;98:8480) to ligate site-specifically.
- linkers, adaptor modules and precursors a wide variety of DNL constructs of different stoichiometry may be produced and used, including but not limited to dimeric, trimeric, tetrameric, pentameric and hexameric DNL constructs (see, e.g., U.S. Nos. 7,550,143;
- fusion proteins A variety of methods are known for making fusion proteins, including nucleic acid synthesis, hybridization and/or amplification to produce a synthetic double-stranded nucleic acid encoding a fusion protein of interest.
- double-stranded nucleic acids may be inserted into expression vectors for fusion protein production by standard molecular biology techniques (see, e.g. Sambrook et al., Molecular Cloning, A laboratory manual, 2 nd Ed, 1989).
- the AD and/or DDD moiety may be attached to either the N- terminal or C-terminal end of an effector protein or peptide.
- site of attachment of an AD or DDD moiety to an effector moiety may vary, depending on the chemical nature of the effector moiety and the part(s) of the effector moiety involved in its physiological activity.
- Site-specific attachment of a variety of effector moieties may be performed using techniques known in the art, such as the use of bivalent cross-linking reagents and/or other chemical conjugation techniques.
- Bispecific or multispecific antibodies may be utilized in pre-targeting techniques.
- Pre-targeting is a multistep process originally developed to resolve the slow blood clearance of directly targeting antibodies, which contributes to undesirable toxicity to normal tissues such as bone marrow.
- a radionuclide or other diagnostic or therapeutic agent is attached to a small delivery molecule (targetable construct) that is cleared within minutes from the blood.
- a pre-targeting bispecific or multispecific antibody, which has binding sites for the targetable construct as well as a target antigen, is administered first, free antibody is allowed to clear from circulation and then the targetable construct is administered.
- a pre-targeting method of treating or diagnosing a disease or disorder in a subject may be provided by: (1) administering to the subject a bispecific antibody or antibody fragment; (2) optionally administering to the subject a clearing composition, and allowing the composition to clear the antibody from circulation; and (3) administering to the subject the targetable construct, containing one or more chelated or chemically bound therapeutic or diagnostic agents.
- any of the antibodies, antibody fragments or antibody fusion proteins described herein may be conjugated to a chelating moiety or other carrier molecule to form an immunoconjugate.
- Methods for covalent conjugation of chelating moieties and other functional groups are known in the art and any such known method may be utilized.
- a chelating moiety or carrier can be attached at the hinge region of a reduced antibody component via disulfide bond formation.
- such agents can be attached using a heterobifunctional cross-linker, such as vV-succinyl 3-(2- pyridyldithio)propionate (SPDP). Yu et al, Int. J. Cancer 56: 244 (1994). General techniques for such conjugation are well-known in the art. See, for example, Wong, CHEMISTRY OF PROTEIN CONJUGATION AND CROSS-LINKING (CRC Press 1991); Upeslacis et al.
- the chelating moiety or carrier can be conjugated via a carbohydrate moiety in the Fc region of the antibody.
- Methods for conjugating peptides to antibody components via an antibody carbohydrate moiety are well-known to those of skill in the art. See, for example, Shih et al, Int. J. Cancer 41: 832 (1988); Shih et al, Int. J. Cancer 46: 1 101 (1990); and Shih et al, U.S. Patent No. 5,057,313, the Examples section of which is incorporated herein by reference.
- the general method involves reacting an antibody component having an oxidized carbohydrate portion with a carrier polymer that has at least one free amine function.
- the Fc region may be absent if the antibody used as the antibody component of the immunoconjugate is an antibody fragment. However, it is possible to introduce a
- carbohydrate moiety into the light chain variable region of a full length antibody or antibody fragment. See, for example, Leung et al, J Immunol. 154: 5919 (1995); U.S. Patent Nos. 5,443,953 and 6,254,868, the Examples section of which is incorporated herein by reference.
- the engineered carbohydrate moiety is used to attach the functional group to the antibody fragment.
- Chelates may be directly linked to antibodies or peptides, for example as disclosed in U.S. Patent 4,824,659, incorporated herein in its entirety by reference.
- the azide alkyne Huisgen cycloaddition reaction uses a copper catalyst in the presence of a reducing agent to catalyze the reaction of a terminal alkyne group attached to a first molecule.
- a second molecule comprising an azide moiety
- the azide reacts with the activated alkyne to form a 1 ,4-disubstituted 1,2,3-triazole.
- the copper catalyzed reaction occurs at room temperature and is sufficiently specific that purification of the reaction product is often not required.
- a copper-free click reaction has been proposed for covalent modification of biomolecules.
- the copper- free reaction uses ring strain in place of the copper catalyst to promote a [3 + 2] azide-alkyne cycloaddition reaction (Id.)
- cyclooctyne is a 8-carbon ring structure comprising an internal alkyne bond.
- the closed ring structure induces a substantial bond angle deformation of the acetylene, which is highly reactive with azide groups to form a triazole.
- cyclooctyne derivatives may be used for copper- free click reactions (Id.)
- bispecific antibodies and targetable constructs may be used for imaging normal or diseased tissue and organs (see, e.g. U.S. Pat. Nos. 6,126,916;
- a bispecific antibody (bsAb) and an F-labeled targetable construct may be conducted by administering the bsAb antibody at some time prior to administration of the targetable construct.
- the doses and timing of the reagents can be readily devised by a skilled artisan, and are dependent on the specific nature of the reagents employed. If a bsAb-F(ab') 2 derivative is given first, then a waiting time of 24-72 hr (alternatively 48-96 hours) before administration of the targetable construct would be appropriate. If an IgG-Fab' bsAb conjugate is the primary targeting vector, then a longer waiting period before administration of the targetable construct would be indicated, in the range of 3-10 days. After sufficient time has passed for the bsAb to target to the diseased tissue, the 18 F-labeled targetable construct is administered. Subsequent to administration of the targetable construct, imaging can be performed.
- Multivalent target binding proteins which have at least three different target binding sites as described in patent application ,Ser. No. 60/220,782.
- Multivalent target binding proteins have been made by cross-linking several Fab- like fragments via chemical linkers. See U.S. Pat. Nos. 5,262,524; 5,091,542 and Landsdorp et al. Euro. J. Immunol. 16: 679-83 (1986).
- Multivalent target binding proteins also have been made by covalently linking several single chain Fv molecules (scFv) to form a single polypeptide. See U.S. Pat. No. 5,892,020.
- a multivalent target binding protein which is basically an aggregate of scFv molecules has been disclosed in U.S. Pat. Nos. 6,025,165 and 5,837,242.
- a trivalent target binding protein comprising three scFv molecules has been described in Krott et al. Protein Engineering 10(4): 423-433 (1997).
- a clearing agent may be used which is given between doses of the bispecific antibody (bsAb) and the targetable construct.
- a clearing agent of novel mechanistic action may be used, namely a glycosylated anti-idiotypic Fab' fragment targeted against the disease targeting arm(s) of the bsAb.
- anti-CEA (MN-14 Ab) x anti-peptide bsAb is given and allowed to accrete in disease targets to its maximum extent.
- an anti-idiotypic Ab to MN-14 termed WI2 is given, preferably as a glycosylated Fab' fragment.
- the clearing agent binds to the bsAb in a monovalent manner, while its appended glycosyl residues direct the entire complex to the liver, where rapid metabolism takes place. Then the I8 F-labeled targetable construct is given to the subject.
- the WI2 Ab to the MN-14 arm of the bsAb has a high affinity and the clearance mechanism differs from other disclosed mechanisms (see Goodwin et al., ibid), as it does not involve cross-linking, because the WI2-Fab' is a monovalent moiety.
- alternative methods and compositions for clearing agents are known and any such known clearing agents may be used.
- the 18 F-labeled molecules may be formulated to obtain compositions that include one or more pharmaceutically suitable excipients, one or more additional ingredients, or some combination of these. These can be accomplished by known methods to prepare
- compositions whereby the active ingredients (i.e., the 18 F-labeled molecules) are combined in a mixture with one or more pharmaceutically suitable excipients.
- active ingredients i.e., the 18 F-labeled molecules
- pharmaceutically suitable excipients Sterile phosphate-buffered saline is one example of a pharmaceutically suitable excipient.
- suitable excipients are well known to those in the art. See, e.g., Ansel et al.,
- compositions described herein are parenteral injection.
- Injection may be intravenous, intraarterial, intralymphatic, intrathecal, or intracavitary (i.e., parenterally).
- parenteral administration the compositions will be formulated in a unit dosage injectable form such as a solution, suspension or emulsion, in association with a pharmaceutically acceptable excipient.
- excipients are inherently nontoxic and nontherapeutic. Examples of such excipients are saline, Ringer's solution, dextrose solution and Hank's solution.
- Nonaqueous excipients such as fixed oils and ethyl oleate may also be used.
- a preferred excipient is 5% dextrose in saline.
- the excipient may contain minor amounts of additives such as substances that enhance isotonicity and chemical stability, including buffers and preservatives.
- Other methods of administration, including oral administration, are also contemplated.
- Formulated compositions comprising F-labeled molecules can be used for intravenous administration via, for example, bolus injection or continuous infusion.
- compositions for injection can be presented in unit dosage form, e.g., in ampoules or in multi-dose containers, with an added preservative.
- Compositions can also take such forms as suspensions, solutions or emulsions in oily or aqueous vehicles, and can contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
- the compositions can be in powder form for constitution with a suitable vehicle, e.g., sterile pyrogen-free water, before use.
- compositions may be administered in solution.
- the pH of the solution should be in the range of pH 5 to 9.5, preferably pH 6.5 to 7.5.
- the formulation thereof should be in a solution having a suitable pharmaceutically acceptable buffer such as phosphate, TRIS (hydroxymethyl) aminomethane-HCl or citrate and the like. Buffer concentrations should be in the range of 1 to 100 mM.
- the formulated solution may also contain a salt, such as sodium chloride or potassium chloride in a concentration of 50 to 150 mM.
- An effective amount of a stabilizing agent such as glycerol, albumin, a globulin, a detergent, a gelatin, a protamine or a salt of protamine may also be included.
- the compositions may be any suitable pharmaceutically acceptable buffer such as phosphate, TRIS (hydroxymethyl) aminomethane-HCl or citrate and the like. Buffer concentrations should be in the range of 1 to 100 mM.
- the formulated solution may also contain
- the administration may be by continuous infusion or by single or multiple boluses.
- bispecific antibodies are administered, for example in a pretargeting technique, the dosage of an administered antibody for humans will vary depending upon such factors as the patient's age, weight, height, sex, general medical condition and previous medical history.
- a dosage of bispecific antibody that is in the range of from about 1 mg to 200 mg as a single intravenous infusion, although a lower or higher dosage also may be administered as circumstances dictate.
- Examples of dosages of bispecific antibodies that may be administered to a human subject for imaging purposes are 1 to 200 mg, more preferably 1 to 70 mg, most preferably 1 to 20 mg, although higher or lower doses may be used.
- the dosage of 18 F label to administer will vary depending upon such factors as the patient's age, weight, height, sex, general medical condition and previous medical history.
- a saturating dose of the F-labeled molecules is administered to a patient.
- the dosage may be measured by millicuries. A typical range for 18 F imaging studies would be five to 10 mCi.
- Various embodiments of the claimed methods and/or compositions may concern one or more 18 F-labeled peptides to be administered to a subject. Administration may occur by any route known in the art, including but not limited to oral, nasal, buccal, inhalational, rectal, vaginal, topical, orthotopic, intradermal, subcutaneous, intramuscular, intraperitoneal, intraarterial, intrathecal or intravenous injection. Where, for example, 18 F-labeled peptides are administered in a pretargeting protocol, the peptides would preferably be administered i.v.
- Unmodified peptides administered orally to a subject can be degraded in the digestive tract and depending on sequence and structure may exhibit poor absorption across the intestinal lining.
- methods for chemically modifying peptides to render them less susceptible to degradation by endogenous proteases or more absorbable through the alimentary tract are well known (see, for example, Blondelle et al., 1995, Biophys. J. 69:604- 1 1 ; Ecker and Crooke, 1995, Biotechnology 13:351-69; Goodman and Ro, 1995, BURGER'S MEDICINAL CHEMISTRY AND DRUG DISCOVERY, VOL. I, ed.
- Peptide mimetics may exhibit enhanced stability and/or absorption in vivo compared to their peptide analogs.
- peptides may be administered by oral delivery using N-terminal and/or C-terminal capping to prevent exopeptidase activity.
- the C-terminus may be capped using amide peptides and the N-terminus may be capped by acetylation of the peptide.
- Peptides may also be cyclized to block exopeptidases, for example by formation of cyclic amides, disulfides, ethers, sulfides and the like.
- Peptide stabilization may also occur by substitution of D-amino acids for naturally occurring L-amino acids, particularly at locations where endopeptidases are known to act.
- peptide binding and cleavage sequences are known in the art and methods for making and using peptides incorporating D-amino acids have been described (e.g. , U.S. Patent Application Publication No. 20050025709, McBride et al., filed June 14, 2004, the Examples section of which is incorporated herein by reference).
- peptides and/or proteins may be orally administered by co-formulation with proteinase- and/or peptidase-inhibitors.
- the peptides are administered in an enteric-coated solid dosage form with excipients that modulate intestinal proteolytic activity and enhance peptide transport across the intestinal wall. Relative bioavailability of intact peptides using this technique ranged from 1% to 10% of the administered dosage.
- Insulin has been successfully administered in dogs using enteric-coated microcapsules with sodium cholate and a protease inhibitor (Ziv et al., 1994, J. Bone Miner. Res. 18 (Suppl. 2):792-94.
- Oral administration of peptides has been performed using acylcarnitine as a permeation enhancer and an enteric coating (Eudragit L30D-55, Rohm Pharma Polymers, see Mehta, 2004).
- Excipients of use for orally administered peptides may generally include one or more inhibitors of intestinal
- proteases/peptidases along with detergents or other agents to improve solubility or absorption of the peptide, which may be packaged within an enteric-coated capsule or tablet (Mehta, 2004).
- Organic acids may be included in the capsule to acidify the intestine and inhibit intestinal protease activity once the capsule dissolves in the intestine (Mehta, 2004).
- Another alternative for oral delivery of peptides would include conjugation to polyethylene glycol (PEG)-based amphiphilic oligomers, increasing absorption and resistance to enzymatic degradation (Soltero and Ekwuribe, 2001, Pharm. Technol. 6: 110).
- 18 F-labeled molecules may be of use in imaging normal or diseased tissue and organs, for example using the methods described in U.S. Pat. Nos.
- Methods of diagnostic imaging with labeled peptides or MAbs are well-known.
- ligands or antibodies are labeled with a gamma-emitting radioisotope and introduced into a patient.
- a gamma camera is used to detect the location and distribution of gamma-emitting radioisotopes.
- PET isotopes positron-emitting radionuclides
- an energy of 51 1 keV such as 18 F, 68 Ga, ⁇ Cu, and l.
- radionuclides may be imaged by well-known PET scanning techniques.
- the I8 F-labeled peptides, proteins and/or antibodies are of use for imaging of cancer.
- cancers include, but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia or lymphoid malignancies. More particular examples of such cancers are noted below and include: squamous cell cancer (e.g.
- lung cancer including small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung and squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastric or stomach cancer including gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, rectal cancer, colorectal cancer, endometrial cancer or uterine carcinoma, salivary gland carcinoma, kidney or renal cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, anal carcinoma, penile carcinoma, as well as head and neck cancer.
- lung cancer including small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung and squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastric or stomach cancer including gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer
- cancer includes primary malignant cells or tumors (e.g., those whose cells have not migrated to sites in the subject's body other than the site of the original malignancy or tumor) and secondary malignant cells or tumors (e.g., those arising from metastasis, the migration of malignant cells or tumor cells to secondary sites that are different from the site of the original tumor).
- primary malignant cells or tumors e.g., those whose cells have not migrated to sites in the subject's body other than the site of the original malignancy or tumor
- secondary malignant cells or tumors e.g., those arising from metastasis, the migration of malignant cells or tumor cells to secondary sites that are different from the site of the original tumor.
- cancers or malignancies include, but are not limited to: Acute Childhood Lymphoblastic Leukemia, Acute Lymphoblastic Leukemia, Acute Lymphocytic Leukemia, Acute Myeloid Leukemia, Adrenocortical Carcinoma, Adult (Primary)
- Neoplasm/Multiple Myeloma Primary Central Nervous System Lymphoma, Primary Liver Cancer, Prostate Cancer, Rectal Cancer, Renal Cell Cancer, Renal Pelvis and Ureter Cancer, Retinoblastoma, Rhabdomyosarcoma, Salivary Gland Cancer, Sarcoidosis Sarcomas, Sezary Syndrome, Skin Cancer, Small Cell Lung Cancer, Small Intestine Cancer, Soft Tissue Sarcoma, Squamous Neck Cancer, Stomach Cancer, Supratentorial Primitive
- Neuroectodermal and Pineal Tumors T-Cell Lymphoma, Testicular Cancer, Thymoma, Thyroid Cancer, Transitional Cell Cancer of the Renal Pelvis and Ureter, Transitional Renal Pelvis and Ureter Cancer, Trophoblastic Tumors, Ureter and Renal Pelvis Cell Cancer, Urethral Cancer, Uterine Cancer, Uterine Sarcoma, Vaginal Cancer, Visual Pathway and Hypothalamic Glioma, Vulvar Cancer, Waldenstrom's Macroglobulinemia, Wilms' Tumor, and any other hyperproliferative disease, besides neoplasia, located in an organ system listed above.
- compositions described and claimed herein may be used to detect or diagnose malignant or premalignant conditions. Such uses are indicated in conditions known or suspected of preceding progression to neoplasia or cancer, in particular, where nonneoplastic cell growth consisting of hyperplasia, metaplasia, or most particularly, dysplasia has occurred (for review of such abnormal growth conditions, see Robbins and Angell, Basic Pathology, 2d Ed., W. B. Saunders Co., Philadelphia, pp. 68-79 (1976)).
- Dysplasia is frequently a forerunner of cancer, and is found mainly in the epithelia. It is the most disorderly form of non-neoplastic cell growth, involving a loss in individual cell uniformity and in the architectural orientation of cells. Dysplasia characteristically occurs where there exists chronic irritation or inflammation.
- Dysplastic disorders which can be detected include, but are not limited to, anhidrotic ectodermal dysplasia, anterofacial dysplasia, asphyxiating thoracic dysplasia, atriodigital dysplasia, bronchopulmonary dysplasia, cerebral dysplasia, cervical dysplasia, chondroectodermal dysplasia, cleidocranial dysplasia, congenital ectodermal dysplasia, craniodiaphysial dysplasia, craniocarpotarsal dysplasia, craniometaphysial dysplasia, dentin dysplasia, diaphysial dysplasia, ectodermal dysplasia, enamel dysplasia, encephalo-ophthalmic dysplasia, dysplasia epiphysialis hemimelia, dysplasia epiphysialis multiplex, dysplasia epiphysialis punctata, epi
- pseudoachondroplastic spondyloepiphysial dysplasia retinal dysplasia, septo-optic dysplasia, spondyloepiphysial dysplasia, and ventriculoradial dysplasia.
- Additional pre-neoplastic disorders which can be detected include, but are not limited to, benign dysproliferative disorders (e.g., benign tumors, fibrocystic conditions, tissue hypertrophy, intestinal polyps, colon polyps, and esophageal dysplasia), leukoplakia, keratoses, Bowen's disease, Farmer's Skin, solar cheilitis, and solar keratosis.
- benign dysproliferative disorders e.g., benign tumors, fibrocystic conditions, tissue hypertrophy, intestinal polyps, colon polyps, and esophageal dysplasia
- leukoplakia keratoses
- Bowen's disease keratoses
- Farmer's Skin Farmer's Skin
- solar cheilitis solar cheilitis
- Additional hyperproliferative diseases, disorders, and/or conditions include, but are not limited to, progression, and/or metastases of malignancies and related disorders such as leukemia (including acute leukemias (e.g., acute lymphocytic leukemia, acute myelocytic leukemia (including myeloblastic, promyelocytic, myelomonocytic, monocytic, and erythroleukemia)) and chronic leukemias (e.g., chronic myelocytic (granulocytic) leukemia and chronic lymphocytic leukemia)), polycythemia vera, lymphomas (e.g., Hodgkin's disease and non-Hodgkin's disease), multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, and solid tumors including, but not limited to, sarcomas and carcinomas such as fibrosarcoma, myxosarcoma, lipos
- lymphangioendotheliosarcoma synovioma, mesothelioma, Ewing's tumor, leiomyosarcoma, rhabdomyosarcoma, colon carcinoma, pancreatic cancer, breast cancer, ovarian cancer, prostate cancer, squamous cell carcinoma, basal cell carcinoma, adenocarcinoma, sweat gland carcinoma, sebaceous gland carcinoma, papillary carcinoma, papillary adenocarcinomas, cystadenocarcinoma, medullary carcinoma, bronchogenic carcinoma, renal cell carcinoma, hepatoma, bile duct carcinoma, choriocarcinoma, seminoma, embryonal carcinoma, Wilm's tumor, cervical cancer, testicular tumor, lung carcinoma, small cell lung carcinoma, bladder carcinoma, epithelial carcinoma, glioma, astrocytoma, meduUoblastoma, craniopharyngioma, ependymoma, pinealoma,
- compositions and methods include cardiovascular diseases, such as fibrin clots,
- Antibodies to fibrin e.g., scFv(59D8); T2Gl s; MH1 are known and in clinical trials as imaging agents for disclosing said clots and pulmonary emboli, while anti-granulocyte antibodies, such as MN-3, MN-15, anti-NCA95, and anti-CD 15 antibodies, can target myocardial infarcts and myocardial ischemia.
- fibrin e.g., scFv(59D8); T2Gl s; MH1
- anti-granulocyte antibodies such as MN-3, MN-15, anti-NCA95, and anti-CD 15 antibodies
- Anti-macrophage, anti-low-density lipoprotein (LDL) and anti-CD74 (e.g., hLLl) antibodies can be used to target atherosclerotic plaques.
- Abciximab (anti-glycoprotein Ilb/IIIa) has been approved for adjuvant use for prevention of restenosis in percutaneous coronary interventions and the treatment of unstable angina (Waldmann et al., 2000, Hematol 1 :394-408).
- Anti-CD3 antibodies have been reported to reduce development and progression of atherosclerosis (Steffens et al., 2006, Circulation 1 14: 1977-84).
- Treatment with blocking MIF antibody has been reported to induce regression of established atherosclerotic lesions (Sanchez-Madrid and Sessa, 2010, Cardiovasc Res 86: 171-73).
- Antibodies against oxidized LDL also induced a regression of established atherosclerosis in a mouse model (Ginsberg, 2007, J Am Coll Cardiol 52:2319-21).
- Anti- ICAM-1 antibody was shown to reduce ischemic cell damage after cerebral artery occlusion in rats (Zhang et al., 1994, Neurology 44: 1747-51).
- OKT anti-T-cell monoclonal antibodies available from Ortho Pharmaceutical Company which bind to normal T-lymphocytes; the monoclonal antibodies produced by the hybridomas having the ATCC accession numbers HB44, HB55, HB12, HB78 and HB2; G7E11, W8E7, NKP15 and G022 (Becton Dickinson); NEN9.4 (New England Nuclear); and FMC11 (Sera Labs).
- a description of antibodies against fibrin and platelet antigens is contained in Knight, Semin. Nucl. Med., 20:52-67 (1990).
- a pharmaceutical composition of the present invention may be used to treat a subject having a metabolic disease, such amyloidosis, or a neurodegenerative disease, such as Alzheimer's disease, amyotrophic lateral sclerosis (ALS), Parkinson's disease, Huntington's disease, olivopontocerebellar atrophy, multiple system atrophy, progressive supranuclear palsy, diffuse lewy body disease, corticodentatonigral degeneration, progressive familial myoclonic epilepsy, strionigral degeneration, torsion dystonia, familial tremor, Gilles de la Tourette syndrome or Hallervorden-Spatz disease.
- a metabolic disease such as amyloidosis, or a neurodegenerative disease, such as Alzheimer's disease, amyotrophic lateral sclerosis (ALS), Parkinson's disease, Huntington's disease, olivopontocerebellar atrophy, multiple system atrophy, progressive supranuclear palsy, diffuse lewy body disease,
- Anti-CD3 antibodies have been proposed for therapy of type 1 diabetes (Cernea et al., 2010, Diabetes Metab Rev 26:602-05).
- a pharmaceutical composition of the present invention may be used to treat a subject having an immune- dysregulatory disorder, such as graft- versus-host disease or organ transplant rejection.
- any such condition for which an F-labeled molecule, such as a protein or peptide, may be prepared and utilized by the methods described herein, may be imaged, diagnosed and/or detected as described herein.
- kits containing components suitable for imaging, diagnosing and/or detecting diseased tissue in a patient using labeled compounds.
- Exemplary kits may contain an antibody, fragment or fusion protein, such as a bispecific antibody of use in pretargeting methods as described herein.
- Other components may include a targetable construct for use with such bispecific antibodies.
- the targetable construct is pre-conjugated to a chelating group that may be used to attach an Al F complex or a complex of 18 F with a different metal.
- a targetable construct may be attached to one or more different diagnostic agents, such as Ga.
- composition containing components for administration is not formulated for delivery via the alimentary canal, such as by oral delivery
- a device capable of delivering the kit components through some other route may be included.
- the kit components may be packaged together or separated into two or more containers.
- the containers may be vials that contain sterile, lyophilized formulations of a composition that are suitable for reconstitution.
- a kit may also contain one or more buffers suitable for reconstitution and/or dilution of other reagents.
- Other containers that may be used include, but are not limited to, a pouch, tray, box, tube, or the like. Kit components may be packaged and maintained sterilely within the containers.
- Another component that can be included is instructions to a person using a kit for its use.
- Acetate buffer solution - Acetic acid 1.509 g was diluted in ⁇ 160 mL water and the pH was adjusted by the addition of 1 M NaOH then diluted to 250 mL to make a 0.1 M solution at pH 4.03.
- Aluminum acetate buffer solution - A solution of aluminum was prepared by dissolving 0.1028 g of A1C1 3 hexahydrate in 42.6 mL DI water. A 4 mL aliquot of the aluminum solution was mixed with 16 mL of a 0.1 M NaOAc solution at pH 4 to provide a 2 mM Al stock solution.
- IMP 272 acetate buffer solution - Peptide, 0.001 1 g, 7.28 x 10 "7 mol IMP 272 was dissolved in 364 ⁇ , of the 0.1 M pH 4 acetate buffer solution to obtain a 2 mM stock solution of the peptide.
- IMP 272 was labeled with indium (24%), gallium (36%), zirconium (15%), lutetium (37 %) and yttrium (2 %) (not shown).
- F metal labeling technique is not limited to an aluminum ligand, but can also utilize other metals as well.
- different metal ligands different chelating moieties may be utilized to optimize binding of an F-18-metal conjugate.
- the peptide, IMP 448 D-Ala-D-Lys(HSG)-D-Tyr-D-Lys(HSG)-NH 2 was made on Sieber Amide resin by adding the following amino acids to the resin in the order shown: Aloc-D-Lys(Fmoc)-OH, Trt-HSG-OH, the Aloe was cleaved, Fmoc-D- Tyr(But)-OH, Aloc-D-Lys(Fmoc)-OH, Trt-HSG-OH, the Aloe was cleaved, Fmoc-D-Ala- OH with final Fmoc cleavage to make the desired peptide. The peptide was then cleaved from the resin and purified by HPLC to produce IMP 448, which was then coupled to ITC-benzyl NOTA.
- IMP 448 (0.0757g, 7.5 x 10 '5 mol) was mixed with 0.0509 g (9.09 x 10 "5 mol) ITC benzyl NOTA and dissolved in 1 mL water. Potassium carbonate anhydrous (0.2171 g) was then slowly added to the stirred peptide/NOTA solution. The reaction solution was pH 10.6 after the addition of all the carbonate. The reaction was allowed to stir at room temperature overnight. The reaction was carefully quenched with 1 M HC1 after 14 hr and purified by HPLC to obtain 48 mg of IMP 449.
- IMP 449 (0.002 g, 1.37 x 10 "6 mol) was dissolved in 686 ⁇ . (2 mM peptide solution) 0.1 M NaOAc pH 4.02. Three microliters of a 2 mM solution of Al in a pH 4 acetate buffer was mixed with 15 ⁇ , 1.3 mCi of F. The solution was then mixed with 20 ⁇ . of the 2 mM IMP 449 solution and heated at 105 °C for 15 min.
- Reverse Phase HPLC analysis showed 35 % (3 ⁇ 4 ⁇ 10 min) of the activity was attached to the peptide and 65 % of the activity was eluted at the void volume of the column (3.1 min, not shown) indicating that the majority of activity was not associated with the peptide.
- the crude labeled mixture (5 ⁇ ) was mixed with pooled human serum and incubated at 37 °C. An aliquot was removed after 15 min and analyzed by HPLC. The HPLC showed 9.8 % of the activity was still attached to the peptide (down from 35 %). Another aliquot was removed after 1 hr and analyzed by HPLC. The HPLC showed 7.6 % of the activity was still attached to the peptide (down from 35 %), which was essentially the same as the 15 min trace (data not shown).
- the DNL technique may be used to make dimers, trimers, tetramers, hexamers, etc. comprising virtually any antibodies or fragments thereof or other effector moieties.
- IgG antibodies, Fab fragments or other proteins or peptides may be produced as fusion proteins containing either a DDD (dimerization and docking domain) or AD (anchoring domain) sequence.
- Bispecific antibodies may be formed by combining a Fab-DDD fusion protein of a first antibody with a Fab-AD fusion protein of a second antibody.
- constructs may be made that combine IgG- AD fusion proteins with Fab-DDD fusion proteins.
- an antibody or fragment containing a binding site for an antigen associated with a target tissue to be imaged may be combined with a second antibody or fragment that binds a hapten on a targetable construct, such as IMP 449, to which a metal- 18 F can be attached.
- the bispecific antibody (DNL construct) is administered to a subject, circulating antibody is allowed to clear from the blood and localize to target tissue, and the 18 F-labeled targetable construct is added and binds to the localized antibody for imaging.
- independent transgenic cell lines may be developed for each Fab or IgG fusion protein.
- the modules can be purified if desired or maintained in the cell culture supernatant fluid.
- any DDD 2 -fusion protein module can be combined with any corresponding AD-fusion protein module to generate a bispecific DNL construct.
- different AD or DDD sequences may be utilized. The following DDD sequences are based on the DDD moiety of PKA Rlla, while the AD sequences are based on the AD moiety of the optimized synthetic AKAP-ZS * sequence (Alto et al, Proc. Natl. Acad. Sci. USA. 2003; 100:4445).
- DDD1 SHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA (SEQ ID NO:6)
- DDD2 CGHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA (SEQ ID NO:7)
- AD1 QIEYLAKQIVDNAIQQA (SEQ ID NO:8)
- AD2 CGQIEYLAKQIVDNAIQQAGC (SEQ ID NO:9)
- the plasmid vector pdHL2 has been used to produce a number of antibodies and antibody-based constructs. See Gillies et al., J Immunol Methods (1989), 125: 191-202;
- the di-cistronic mammalian expression vector directs the synthesis of the heavy and light chains of IgG.
- the vector sequences are mostly identical for many different IgG-pdHL2 constructs, with the only differences existing in the variable domain (VH and VL) sequences.
- VH and VL variable domain sequences.
- these IgG expression vectors can be converted into Fab-DDD or Fab- AD expression vectors.
- Fab-DDD expression vectors To generate Fab-DDD expression vectors, the coding sequences for the hinge, CH2 and CH3 domains of the heavy chain are replaced with a sequence encoding the first 4 residues of the hinge, a 14 residue Gly-Ser linker and the first 44 residues of human Rlla (referred to as DDD1).
- AD1 AKAP- S 1
- Two shuttle vectors were designed to facilitate the conversion of IgG-pdHL2 vectors to either Fab-DDD 1 or Fab-AD 1 expression vectors, as described below.
- the CHI domain was amplified by PCR using the pdHL2 plasmid vector as a template.
- the left PCR primer consisted of the upstream (5') end of the CHI domain and a Sacll restriction endonuclease site, which is 5' of the CHI coding sequence.
- the right primer consisted of the sequence coding for the first 4 residues of the hinge followed by four glycines and a serine, with the final two codons (GS) comprising a Bam HI restriction site.
- the 410 bp PCR amplimer was cloned into the pGemT PCR cloning vector (Promega, Inc.) and clones were screened for inserts in the T7 (5') orientation.
- a duplex oligonucleotide was synthesized by to code for the amino acid sequence of DDD1 preceded by 1 1 residues of a linker peptide, with the first two codons comprising a BamHI restriction site. A stop codon and an Eagl restriction site are appended to the 3'end.
- the encoded polypeptide sequence is shown below, with the DDD1 sequence underlined.
- GSGGGGSGGGGSHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA SEQ ID NO: 10.
- oligonucleotides designated RIIAl-44 top and RIIAl-44 bottom, that overlap by 30 base pairs on their 3' ends, were synthesized (Sigma Genosys) and combined to comprise the central 154 base pairs of the 174 bp DDD1 sequence.
- the oligonucleotides were annealed and subjected to a primer extension reaction with Taq polymerase. Following primer extension, the duplex was amplified by PCR. The amplimer was cloned into pGemT and screened for inserts in the T7 (5') orientation.
- a duplex oligonucleotide was synthesized to code for the amino acid sequence of AD1 preceded by 1 1 residues of the linker peptide with the first two codons comprising a BamHI restriction site. A stop codon and an Eagl restriction site are appended to the 3 'end. The encoded polypeptide sequence is shown below, with the sequence of AD1 underlined.
- AKAP-IS Top and AKAP-IS Bottom Two complimentary overlapping oligonucleotides encoding the above peptide sequence, designated AKAP-IS Top and AKAP-IS Bottom, were synthesized and annealed. The duplex was amplified by PCR. The amplimer was cloned into the pGemT vector and screened for inserts in the T7 (5') orientation.
- a 190 bp fragment encoding the DDDl sequence was excised from pGemT with BamHI and Notl restriction enzymes and then ligated into the same sites in CHl-pGemT to generate the shuttle vector CHl-DDDl-pGemT.
- a 1 10 bp fragment containing the ADl sequence was excised from pGemT with BamHI and Notl and then ligated into the same sites in CHl-pGemT to generate the shuttle vector CH 1 -AD 1 -pGemT.
- CHI -DDDl or CHI -ADl can be incorporated into any IgG construct in the pdHL2 vector.
- the entire heavy chain constant domain is replaced with one of the above constructs by removing the Sacll/Eagl restriction fragment (CH1-CH3) from pdHL2 and replacing it with the Sacll/Eagl fragment of CHI -DDDl or CHI -ADl , which is excised from the respective pGemT shuttle vector.
- h679-Fd-ADl-pdHL2 is an expression vector for production of h679 Fab with AD1 coupled to the carboxyl terminal end of the CHI domain of the Fd via a flexible Gly/Ser peptide spacer composed of 14 amino acid residues.
- a pdHL2 -based vector containing the variable domains of h679 was converted to h679-Fd-ADl-pdHL2 by replacement of the SacII/EagI fragment with the CH1-AD1 fragment, which was excised from the CH1-AD1- SV3 shuttle vector with SacII and Eagl.
- C-DDDl-Fd-hMN-14-pdHL2 is an expression vector for production of a stable dimer that comprises two copies of a fusion protein C-DDDl-Fab-hMN-14, in which DDD1 is linked to hMN-14 Fab at the carboxyl terminus of CHI via a flexible peptide spacer.
- the plasmid vector hMN14(I)-pdHL2 which has been used to produce hMN-14 IgG, was converted to C-DDDl-Fd-hMN-14-pdHL2 by digestion with SacII and Eagl restriction endonucleases to remove the CH1-CH3 domains and insertion of the CH1-DDD1 fragment, which was excised from the CH1-DDD1-SV3 shuttle vector with SacII and Eagl.
- AD- and DDD-fusion proteins comprising a Fab fragment of any of such antibodies may be combined, in an approximate ratio of two DDD-fusion proteins per one AD-fusion protein, to generate a trimeric DNL construct comprising two Fab fragments of a first antibody and one Fab fragment of a second antibody.
- C-DDD2-Fd-hMN-14-pdHL2 is an expression vector for production of C-DDD2-Fab- hMN-14, which possesses a dimerization and docking domain sequence of DDD2 appended to the carboxyl terminus of the Fd of hMN-14 via a 14 amino acid residue Gly/Ser peptide linker.
- the fusion protein secreted is composed of two identical copies of hMN-14 Fab held together by non-covalent interaction of the DDD2 domains.
- oligonucleotides which comprise the coding sequence for part of the linker peptide and residues 1-13 of DDD2, were made synthetically.
- the oligonucleotides were annealed and phosphorylated with T4 PNK, resulting in overhangs on the 5' and 3' ends that are compatible for ligation with DNA digested with the restriction endonucleases BamHI and Pstl, respectively.
- the duplex DNA was ligated with the shuttle vector CHl-DDDl-pGemT, which was prepared by digestion with BamHI and Pstl, to generate the shuttle vector CH1-DDD2- pGemT.
- a 507 bp fragment was excised from CHl-DDD2-pGemT with SacII and Eagl and ligated with the IgG expression vector hMN14(I)-pdHL2, which was prepared by digestion with SacII and Eagl.
- the final expression construct was designated C-DDD2-Fd-hMN-14- pdHL2. Similar techniques have been utilized to generated DDD2-fusion proteins of the Fab fragments of a number of different humanized antibodies.
- h679-Fab-AD2 was designed to pair as B to C-DDD2-Fab-hMN- 14 as A.
- h679-Fd- AD2-pdHL2 is an expression vector for the production of h679-Fab-AD2, which possesses an anchor domain sequence of AD2 appended to the carboxyl terminal end of the CHI domain via a 14 amino acid residue Gly/Ser peptide linker.
- AD2 has one cysteine residue preceding and another one following the anchor domain sequence of AD1.
- the expression vector was engineered as follows. Two overlapping, complimentary oligonucleotides (AD2 Top and AD2 Bottom), which comprise the coding sequence for AD2 and part of the linker sequence, were made synthetically. The oligonucleotides were annealed and phosphorylated with T4 PNK, resulting in overhangs on the 5' and 3' ends that are compatible for ligation with DNA digested with the restriction endonucleases BamHI and Spel, respectively.
- duplex DNA was ligated into the shuttle vector CHl-ADl-pGemT, which was prepared by digestion with BamHI and Spel, to generate the shuttle vector CH1-AD2- pGemT.
- a 429 base pair fragment containing CHI and AD2 coding sequences was excised from the shuttle vector with SacII and Eagl restriction enzymes and ligated into h679-pdHL2 vector that prepared by digestion with those same enzymes.
- the final expression vector is h679-Fd-AD2-pdHL2.
- a trimeric DNL construct designated TF2 was obtained by reacting C-DDD2-Fab- hMN-14 with h679-Fab-AD2.
- a pilot batch of TF2 was generated with >90% yield as follows.
- Protein L-purified C-DDD2-Fab-hMN- 14 200 mg was mixed with h679-Fab-AD2 (60 mg) at a 1.4: 1 molar ratio.
- the total protein concentration was 1.5 mg/ml in PBS containing 1 mM EDTA.
- Subsequent steps involved TCEP reduction, HIC chromatography, DMSO oxidation, and IMP 291 affinity chromatography. Before the addition of TCEP, SE- HPLC did not show any evidence of a b formation.
- TF2 was purified to near homogeneity by IMP 291 affinity chromatography (not shown).
- IMP 291 is a synthetic peptide containing the HSG hapten to which the 679 Fab binds (Rossi et al., 2005, Clin Cancer Res 1 1 :7122s-29s).
- SE-HPLC analysis of the IMP 291 unbound fraction demonstrated the removal of a 4 , a 2 and free kappa chains from the product (not shown).
- Non-reducing SDS-PAGE analysis demonstrated that the majority of TF2 exists as a large, covalent structure with a relative mobility near that of IgG (not shown). The additional bands suggest that disulfide formation is incomplete under the experimental conditions (not shown). Reducing SDS-PAGE shows that any additional bands apparent in the non-reducing gel are product-related (not shown), as only bands representing the constituent polypeptides of TF2 are evident.
- MALDI-TOF mass spectrometry revealed a single peak of 156,434 Da, which is within 99.5% of the calculated mass (157,319 Da) of TF2.
- TF2 The functionality of TF2 was determined by BIACORE assay.
- TF2, C-DDDl-hMN- 14+h679-ADl (used as a control sample of noncovalent a 2 b complex), or C-DDD2-hMN- 14+h679-AD2 (used as a control sample of unreduced a 2 and b components) were diluted to 1 ⁇ g/ml (total protein) and passed over a sensorchip immobilized with HSG.
- the response for TF2 was approximately two-fold that of the two control samples, indicating that only the h679-Fab-AD component in the control samples would bind to and remain on the sensorchip.
- TF10 DNL construct comprising two copies of a C-DDD2-Fab-hPAM4 and one copy of C-AD2-Fab-679.
- the TF10 bispecific ([hPAM4] 2 x h679) antibody was produced using the method disclosed for production of the (anti CEA) 2 x anti HSG bsAb TF2, as described above.
- the TF10 construct bears two humanized PAM4 Fabs and one humanized 679 Fab.
- tissue culture supernatant fluids were combined, resulting in a two-fold molar excess of hPAM4-DDD2.
- the reaction mixture was incubated at room temperature for 24 hours under mild reducing conditions using 1 mM reduced glutathione. Following reduction, the DNL reaction was completed by mild oxidation using 2 mM oxidized glutathione.
- TF10 was isolated by affinity chromatography using IMP 291-affigel resin, which binds with high specificity to the h679 Fab.
- the AD and DDD sequences incorporated into the cytokine-MAb DNL complex comprise the amino acid sequences of AD1 or AD2 and DDD1 or DDD2, as discussed above.
- sequence variants of AD and/or DDD moieties may be utilized in construction of the DNL complexes.
- the Rlla DDD sequence is the basis of DDD1 and DDD2 disclosed above.
- the four human PKA DDD sequences are shown below.
- the DDD sequence represents residues 1-44 of Rlla, 1-44 of RIip, 12-61 of RIa and 13-66 of Rip. (Note that the sequence of DDD 1 is modified slightly from the human PKA Rlla DDD moiety.)
- Alto et al. (2003) performed a bioinformatic analysis of the AD sequence of various AKAP proteins to design an RII selective AD sequence called AKAP-IS (SEQ ID NO:8), with a binding constant for DDD of 0.4 nM.
- the AKAP-IS sequence was designed as a peptide antagonist of AKAP binding to PKA. Residues in the AKAP-IS sequence where substitutions tended to decrease binding to DDD are underlined in SEQ ID NO:8.
- sequence variants of the AD sequence one would desirably avoid changing any of the underlined residues, while conservative amino acid substitutions might be made for residues that are less critical for DDD binding.
- the SuperAKAP-IS sequence may be substituted for the AKAP-IS AD moiety sequence to prepare DNL constructs.
- Other alternative sequences that might be substituted for the AKAP-IS AD sequence are shown in SEQ ID NO: 17- 19. Substitutions relative to the AKAP-IS sequence are underlined. It is anticipated that, as with the AD2 sequence shown in SEQ ID NO: 9, the AD moiety may also include the additional N-terminal residues cysteine and glycine and C-terminal residues glycine and cysteine.
- Ht31 SEQ ID NO:20
- RIAD SEQ ID NO:21
- PV-38 SEQ ID NO:22
- Carr et al. examined the degree of sequence homology between different AKAP-binding DDD sequences from human and non-human proteins and identified residues in the DDD sequences that appeared to be the most highly conserved among different DDD moieties. These are indicated below by underlining with reference to the human PKA Rlla DDD sequence of SEQ ID NO:6. Residues that were particularly conserved are further indicated by italics. The residues overlap with, but are not identical to those suggested by Kinderman et al. (2006) to be important for binding to AKAP proteins.
- 18 F-labeled IMP 449 was prepared as follows. The 18 F, 54.7 mCi in ⁇ 0.5 mL was mixed with 3 ⁇ 2 mM Al in 0.1 M NaOAc pH 4 buffer. After 3 min 10 ⁇ of 0.05 M IMP 449 in 0.5 M pH 4 NaOAc buffer was added and the reaction was heated in a 96 °C heating block for 15 min. The crude labeled peptide was then purified by HPLC on a C 18 column. The HPLC purified peptide sample was further processed by diluting the fractions of interest two fold in water and placing the solution in the barrel of a 1 cc WATERS® HLB column.
- the cartridge was eluted with 3 x 1 mL water to remove acetonitrile and TFA followed by 400 ⁇ 1 : 1 EtOH/H 2 0 to elute the 18 F-labeled peptide.
- the purified [A1 18 F] IMP 449 eluted as a single peak on an analytical HPLC C 18 column (not shown).
- Taconic nude mice bearing the four slow-growing sc CaPanl xenografts were used for in vivo studies. Three of the mice were injected with TF10 (162 g) followed with [APF] IMP 449 18 h later.
- TF10 is a humanized bispecific antibody of use for tumor imaging studies, with divalent binding to the PAM-4 defined tumor antigen and monovalent binding to HSG (see, e.g., Gold et al., 2007, J. Clin. Oncol. 25(18S):4564).
- One mouse was injected with peptide alone. All of the mice were necropsied at 1 h post peptide injection. Tissues were counted immediately. Comparison of mean distributions showed substantially higher levels of F-labeled peptide localized in the tumor than in any normal tissues in the presence of tumor-targeting bispecific antibody.
- Tissue uptake was similar in animals given the [A1 18 F] IMP 449 alone or in a pretargeting setting (Table 2).
- Uptake in the human pancreatic cancer xenograft, CaPanl, at 1 h was increased 5-fold in the pretargeted animals as compared to the peptide alone (4.6 ⁇ 0.9% ID/g vs. 0.89% ID/g).
- Exceptional tumor/nontumor ratios were achieved at this time (e.g., tumor/blood and liver ratios were 23.4 ⁇ 2.0 and 23.5 ⁇ 2.8, respectively).
- [0184] [A1 18 F] IMP 449 Labeling was performed as described above except the F was purified on a QMA cartridge before labeling as described by Kim et. al. (Applied Radiation and Isotopes 61, 2004, 1241-46). The column was eluted with 1 mL 0.4 M KHC0 3 in 200 ⁇ fractions. The pH of the 18 F solution was adjusted with 10 xh of glacial acetic acid and 18 F from the peak fraction was mixed with 3 of 2 mM Al in 0.1 M pH 4 NaOAc buffer. The sample was then mixed with 10 of 0.05 M IMP 449 in 0.5 M NaOAc buffer at pH 4 and the reaction solution was heated at 94 °C for 15 min.
- the [A1 18 F] IMP 449 was purified by RP-HPLC. The fraction containing the product was put through an HLB column to exchange the buffer. The product was eluted with 400 xh 1 : 1 EtOH:H 2 0. Since the yield was low, the specific activity was low and more peptide was injected into mice, resulting in a
- Kidney 5 2.191 0.125 2.313 2.141 2.154 2.319 2.027
- Body Wt. 5 24.69 1.20 23.05 26.36 24.45 24.48 25.1 1
- Al F-labeled peptides exemplified by IMP 449
- IMP 449 are sufficiently stable under in vivo conditions to be utilized in known imaging protocols, such as PET scanning.
- the claimed methods result in preparation of 18 F-labeled targeting peptides that are ready for injection within 1 hour of preparation time, well within the decay time of F to allow suitable imaging procedures to be performed.
- the described and claimed methods result in minimal exposure of the operator to radioisotope exposure, compared with known methods of preparing 18 F-labeled compounds for imaging studies.
- TF2 binds divalently to carcinoembryonic antigen (CEA) and monovalently to the synthetic hapten, HSG (histamine- succinyl-glycine).
- CEA carcinoembryonic antigen
- NCr nu-m female nude mice Six-week-old NCr nu-m female nude mice were implanted s.c. with the human colonic cancer cell line, LS174T (ATCC, Manassas, VA). When tumors were visibly established, pretargeted animals were injected intravenously with 162 ⁇ g ( ⁇ 1 nmole/0.1 mL) TF2 or TF10 (control non-targeting tri-Fab bsMAb), and then 16-18 h later, ⁇ 0.1 nmol of [A1 18 F] IMP 449 (84 ⁇ , 3.1 1 MBq/0.1 mL) was injected intravenously.
- LS174T human colonic cancer cell line
- mice bearing small LS174T subcutaneous tumors received either the pretargeted [A1 18 F] IMP 449, [A1 18 F] IMP 449 alone (not pretargeted), both at 135 ⁇ (5 MBq; 0.1 nmol), or [ 18 F]FDG (135 ⁇ , 5 MBq).
- the animals were anesthetized with a mixture of 0 2 / ⁇ 2 0 and isoflurane (2%) and kept warm during the scan, performed on an I VEON® animal PET scanner (Siemens Preclinical Solutions, Knoxville, TN).
- Tumor/nontumor ratios were 146 ⁇ 63, 59 ⁇ 24, 38 ⁇ 15, and 2.0 ⁇ 1.0 for the blood, liver, lung, and kidneys, respectively, with other tumor/tissue ratios > 100: 1 at this time.
- both 18 F alone and [A1 18 F] alone had higher uptake in the tumor than the chelated [A1 18 F] IMP 449, yielding tumor/blood ratios of 6.7 ⁇ 2.7 and 1 1.0 ⁇ 4.6 vs. 5.1 ⁇ 1.5, respectively, tumor uptake and tumor/blood ratios were significantly increased with pretargeting (all P values O.001).
- hapten-peptide used in pretargeted imaging can be rapidly labeled (60 min total preparation time) with 18 F by simply forming an aluminum- fluoride complex that can then be bound by a suitable chelate and incorporated into the hapten-peptide.
- This can be made more general by simply coupling the [A1 I8 F] -chelate to any molecule that can be attached to the chelating moiety and be subsequently purified.
- the percentage incorporation of label and specific activity of the labeled compound are sufficient that purification of the labeled molecule is not necessary.
- PET imaging using metal F chelated to a wide variety of targeting molecules PET imaging using metal F chelated to a wide variety of targeting molecules.
- IMP 460 NODA-Ga-D-Ala-D-Lys(HSG)-D-Tyr-D-Lys(HSG)-NH 2 was chemically synthesized.
- the NODA-Ga ligand was purchased from CHEMATECH® and attached on the peptide synthesizer like the other amino acids.
- the peptide was synthesized on Sieber amide resin with the amino acids and other agents added in the following order Aloc-D-Lys(Fmoc)-OH, Trt-HSG-OH, Aloe removal, Fmoc-D-Tyr(But)-OH, Aloc-D-Lys(Fmoc)-OH, Trt-HSG-OH, Aloe removal, Fmoc-D-Ala-OH, and NODA- GA(tBu) 3 .
- the peptide was then cleaved and purified by HPLC to afford the product.
- HRMS C61H92N18018.
- IMP 460 (0.0020 g) was dissolved in 732 ⁇ , pH 4, 0.1 M NaOAc.
- the 18 F was purified as described above, neutralized with glacial acetic acid and mixed with the Al solution.
- the peptide solution, 20 ⁇ , was then added and the solution was heated at 99 °C for 25 min.
- the crude product was then purified on a WATERS® HLB column.
- the [A1 18 F] labeled peptide was in the 1 : 1 EtOH/H 2 0 column eluent.
- the reverse phase HPLC trace in 0.1 % TFA buffers showed a clean single HPLC peak at the expected location for the labeled peptide (not shown).
- Example 12 Synthesis and Labeling of IMP 461 and IMP 462 NOTA-Conjugated Peptides
- N02AtBu (0.501 g 1.4 x 10 "3 mol) was dissolved in 5 mL anhydrous acetonitrile.
- Benzyl-2-bromoacetate (0.222 mL, 1.4 x 10 "3 mol) was added to the solution followed by 0.387 g of anhydrous K 2 C0 3 .
- the reaction was allowed to stir at room temperature overnight.
- the reaction mixture was filtered and concentrated to obtain 0.605 g (86 % yield) of the benzyl ester conjugate.
- the crude product was then dissolved in 50 mL of isopropanol, mixed with 0.2 g of 10 % Pd/C (under Ar) and placed under 50 psi H 2 for 3 days.
- the product was then filtered and concentrated under vacuum to obtain 0.462 g of the desired product ESMS MH " 415.
- the peptide was synthesized on Sieber amide resin with the amino acids and other agents added in the following order Aloc-D-Lys(Fmoc)-OH, Trt-HSG-OH, Aloe removal, Fmoc-D-Tyr(But)-OH, Aloc-D-Lys(Fmoc)-OH, Trt-HSG-OH, Aloe removal, Fmoc-D-Ala- OH, and Bis-t-butylNOTA-OH.
- the peptide was synthesized on Sieber amide resin with the amino acids and other agents added in the following order Aloc-D-Lys(Fmoc)-OH, Trt-HSG-OH, Aloe removal, Fmoc-D-Tyr(But)-OH, Aloc-D-Lys(Fmoc)-OH, Trt-HSG-OH, Aloe removal, Fmoc-D- Asp(But)-OH, and Bis-t-butylNOTA-OH.
- the peptides were dissolved in pH 4.13, 0.5 M NaOAc to make a 0.05 M peptide solution, which was stored in the freezer until needed.
- the F-18 was received in 2 mL of water and trapped on a SEP-PAK® Light, WATERS® ACCELLTM Plus QMA Cartridge.
- the 18 F was eluted from the column with 200 ⁇ aliquots of 0.4 M KHC0 3 .
- the bicarbonate was neutralized to ⁇ pH 4 by the addition of 10 of glacial acetic acid to the vials before the addition of the activity.
- a 100 aliquot of the purified 18 F solution was removed and mixed with 3 ⁇ , 2 mM Al in pH 4, 0.1 M NaOAc.
- the peptide, 10 ⁇ . (0.05 M) was added and the solution was heated at ⁇ 100 °C for 15 min.
- the crude reaction mixture was diluted with 700 ⁇ , DI water and placed on an HLB column and after washing the 18 F was eluted with 2 x 100 ⁇ . of 1 : 1 EtOH/H 2 0 to obtain the purified 18 F-labeled peptide.
- Tetra tert-butyl C-NETA-succinyl was produced.
- the tert-Butyl ⁇ 4-[2-(Bis-( 1 ⁇ 2rt- butyoxycarbonyl)methyl-3-(4-nitrophenyl)propyl]-7-terr-butyoxycarbonyl[l,4,7]triazanonan- 1-yl ⁇ was prepared as described in Chong et al. (J. Med. Chem. 2008, 51 : 1 18-125).
- the peptide, IMP 467 C-NETA-succinyl-D-Lys(HSG)-D-Tyr-D-Lys(HSG)-NH 2 was made on Sieber Amide resin by adding the following amino acids to the resin in the order shown: Aloc-D-Lys(Fmoc)-OH, Trt-HSG-OH, the Aloe was cleaved Fmoc-D-Tyr(But)-OH, Aloc-D-Lys(Fmoc)-OH, Trt-HSG-OH, the Aloe was cleaved, tert- Butyl ⁇ 4- [Bis-(tert-butoxycarbonylmethyl)amino)-3 -(4-succinylamidophenyl)propyl] -l-tert- butoxycarbonylmethyl[l,4,7]triazanonan-l-yl ⁇ acetate.
- a 2 mM solution of IMP 467 was prepared in pH 4, 0.1 M NaOAc.
- the 18 F, 139 mCi was eluted through a WATERS® ACCELLTM Plus SEP-PAK® Light QMA cartridge and the 18 F was eluted with 1 mL of 0.4 M KHC0 3 .
- the labeled IMP 467 was purified by HLB RP-HPLC.
- the RP-HPLC showed two peaks eluting (not shown), which are believed to be diastereomers of Al F IMP 467. Supporting this hypothesis, there appeared to be some interconversion between the two HLB peaks when IMP 467 was incubated at 37°C (not shown).
- pretargeting techniques as discussed below, since the A1 18 F -chelator complex is not part of the hapten site for antibody binding, the presence of diastereomers does not appear to affect targeting of the 18 F-labeled peptide to diseased tissues.
- the l8 F-labeling yield of IMP 467 was -70% when only 40 nmol ( ⁇ 13-fold less than IMP 449) was used with 1.3 GBq (35 mCi) of 18 F, indicating this ligand has improved binding properties for the A1 18 F complex.
- yields were substantially improved (average 65-75% yield), while using fewer moles of IMP 467 (40 nmol), relative to IMP 449 (520 nmol, 44% yield).
- the F-labeled IMP 467 peptide prepared in the same manner as described above, was diluted for injection into LS174T tumor bearing nude mice. APT-IMP 467 was prepared and injected in nude mice that were necropsied 1.5 h later. Table 6 shows the biodistribution of 18 F-labeled IMP 467 using a TF2 pretargeting protocol. The peptide alone cleared quickly from the blood and body, similar to IMP 449 (not shown). The low uptake in the bone compared to 18 F or A1 18 F illustrates the stability of the A1 18 F chelate and its suitability for pretargeting (not shown).
- Kidney 6 0.160 0.027 3.098 0.647 0.484 0.076 1.1 0.3
- the optimal pH for labeling was between 4.3 and 5.5. Yield ranged from 54% at pH 2.88; 70-77% at pH 3.99; 70% at pH 5; 41% at pH 6 to 3% at pH 7.3.
- the process could be expedited by eluting the 18 F " from the anion exchange column with nitrate or chloride ion instead of carbonate ion, which eliminates the need for adjusting the eluent to pH 4 with glacial acetic acid before mixing with the A1C1 3 .
- the IMP 461 and IMP 462 ligands have two carboxyl groups available to bind the aluminum whereas the NOTA ligand in IMP 467 had four carboxyl groups.
- the serum stability study showed that the complexes with IMP 467 were stable in serum under conditions replicating in vivo use. Further, the in vivo biodistribution studies with labeled
- IMP 467 show that the F-Al labeled peptide is stable under actual in vivo conditions.
- Peptides can be labeled with 18 F rapidly (30 min) and in high yield by forming A1 18 F complexes that can be bound to a NOTA ligand on a peptide and at a specific activity of at least 17 GBq/ ⁇ , without requiring HPLC purification.
- the A1 18 F NOTA-peptides are stable in serum and in vivo. Modifications of the NOTA ligand can lead to improvements in yield and specific activity, while still maintaining the desired in vivo stability of the A1 18 F- NOTA complex, and being attached to a hydrophilic linker aids in the renal clearance of the peptide. Further, this method avoids the dry-down step commonly used to label peptides with 18 F. As shown in the following Examples, this new 18 F-labeling method is applicable to labeling of a broad spectrum of targeting peptides.
- Radiochemical-grade F " needs to be purified and concentrated before use.
- SPE purification procedures to process the 18 F " prior to its use.
- Most of the radiolabeling procedures were performed using 18 F " prepared by a conventional process.
- the 18 F " in 2 mL of water was loaded onto a SEP-PA ® Light, Waters AccellTM QMA Plus Cartridge that was pre-washed with 10 mL of 0.4M KHC0 3; followed by 10 mL water. After loading the 18 F " onto the cartridge, it was washed with 5 mL water to remove any dissolved metal and radiometal impurities.
- the isotope was then eluted with ⁇ 1 mL of 0.4M KHCO 3 in several fractions to isolate the fraction with the highest concentration of activity.
- the eluted fractions were neutralized with 5 of glacial acetic acid per 100 ⁇ , of solution to adjust the eluent to pH 4-5.
- the QMA cartridge was washed with 10 mL pH 8.4, 0.5 M NaOAc followed by 10 mL DI 3 ⁇ 40.
- 18 F " was loaded onto the column as described above and eluted with 1 mL, pH 6, 0.05 M KN0 3 in 200- ⁇ fractions with 60-70% of the activity in one of the fractions. No pH adjustment of this solution was needed.
- the QMA cartridge was washed with 10 mL pH 8.4, 0.5 M NaOAc followed by 10 mL DI H 2 0.
- the 18 F " was loaded onto the column as described above and eluted with 1 mL, pH 5-7, 0.154 M commercial normal saline in 200- ⁇ fractions with 80% of the activity in one of the fractions. No pH adjustment of this solution was needed.
- the peptide, IMP 470 was made on Sieber Amide resin by adding the following amino acids to the resin in the order shown: Aloc-D-Lys(Fmoc)-OH, Trt-HSG-OH, the Aloe was cleaved, Fmoc-D-Tyr(But)-OH, Aloc-D-Lys(Fmoc)-OH, Trt-HSG-OH.
- the free amine obtained after the removal of Aloe was reacted with succinic anhydride, to generate a carboxylic acid group at the N-terminus, which is activated using DIC in DMF and subsequently coupled with tert-butyl protected Z-NETA.
- the peptide was then cleaved from the resin and purified by RP-HPLC to yield 16.4 mg of IMP 470.
- HSG containing peptide (IMP 465, NOTA-D-Ala-D-Lys(HSG)-D-Tyr-D- Lys(HSG)-NH 2 ) (SEQ ID NO:31) linked to macrocyclic NOTA complexed with aluminum, was successfully labeled with F-18. F incorporation using 40 nmol of IMP 465 was 13.20%.
- An intermediate peptide, IMP 461 was made as described above. Then 25.7 mg of IMP 461 was dissolved in 2 mL DI water to which was added 10.2 mg AICI3.6H 2 O and the resultant solution heated to 100 °C for 1 h. The crude reaction mixture was purified by RP-HPLC to yield 19.6 mg of IMP 465.
- the percent yield of F-labeled peptide could be improved by varying the amount of peptide added.
- the percent yield observed for IMP 465 was 0.27% at 10 nmol peptide, 1.8% at 20 nmol of peptide and 49% at 40 nmol of peptide.
- IMP 467 showed higher yield than IMP 461 when peptide was pre-incubated with aluminum before exposure to F. IMP 467 was incubated with aluminum at room
- the 18 F labeled targeting moieties are not limited to antibodies or antibody fragments, but rather can include any molecule that binds specifically or selectively to a cellular target that is associated with or diagnostic of a disease state or other condition that may be imaged by 18 F PET.
- Bombesin is a 14 amino acid peptide that is homologous to neuromedin B and gastrin releasing peptide, as well as a tumor marker for cancers such as lung and gastric cancer and neuroblastoma.
- IMP 468 (NOTA-NH-(CH 2 ) 7 CO-Gln-Trp-Val-Trp-Ala-Val-Gly- His-Leu-Met-NH 2 ; SEQ ID NO:32) was synthesized as a bombesin analogue and labeled with F to target the gastrin-releasing peptide receptor.
- the peptide was synthesized by Fmoc based solid phase peptide synthesis on Sieber amide resin, using a variation of a synthetic scheme reported in the literature (Prasanphanich et al., 2007, PNAS USA 104: 12463-467). The synthesis was different in that a bis-t-butyl NOTA ligand was add to the peptide during peptide synthesis on the resin.
- IMP 468 (0.0139 g, 1.02 x 10 "5 mol) was dissolved in 203 of 0.5 M pH 4.13 NaOAc buffer.
- the peptide dissolved but formed a gel on standing so the peptide gel was diluted with 609 ⁇ iL of 0.5 M pH 4.13 NaOAc buffer and 406 i of ethanol to produce an 8.35 x 10 "3 M solution of the peptide.
- the 18 F was purified on a QMA cartridge and eluted with 0.4 M KHC0 3 in 200 ih fractions, neutralized with 10 iL of glacial acetic acid.
- the purified 18 F, 40 ⁇ L, 1.13 mCi was mixed with 3 iL of 2 mM A1C1 3 in pH 4, 0.1 M NaOAc buffer.
- IMP 468 (59.2 ⁇ , 4.94 x 10 "7 mol) was added to the A1 18 F solution and placed in a 108 °C heating block for 15 min.
- the crude product was purified on an HLB column, eluted with 2 x 200 ⁇ of 1 : 1 EtOH/H 2 0 to obtain the purified 18 F-labeled peptide in 34% yield.
- Example 19 Imaging of Tumors Using 18 F Labeled Bombesin
- a NOTA-conjugated bombesin derivative (IMP 468) was prepared as described above. We began testing its ability to block radiolabeled bombesin from binding to PC-3 cells as was done by Prasanphanich et al. (PNAS 704: 12462-12467, 2007). Our initial experiment was to determine if IMP 468 could specifically block bombesin from binding to PC-3 cells. We used IMP 333 as a non-specific control.
- a group of six tumor-bearing mice were injected with [A1 18 F] IMP 468 (167 ⁇ , ⁇ 9 xlO "10 mol) and necropsied 1.5 h later.
- Another group of six mice were injected iv with 100 g (6.2xl0 "8 mol) of bombesin 18 min before administering [A1 18 F] IMP 468.
- the second group was also necropsied 1.5 h post injection.
- the data shows specific targeting of the tumor with [Al F] IMP 468 (FIG. 3). Tumor uptake of the peptide is reduced when bombesin was given 18 min before the [A1 18 F ] IMP 468 (FIG. 3).
- Biodistribution data indicates in vivo stability of [A1 18 F] IMP 468 for at least 1.5 h (not shown).
- Larger tumors showed higher uptake of [A1 18 F] IMP 468, possibly due to higher receptor expression in larger tumors (not shown).
- the biodistribution data showed [A1 18 F] IMP 468 tumor targeting that was in the same range as reported for the same peptide labeled with 68 Ga by Prasanphanich et al. (not shown).
- the results demonstrate that the 18 F peptide labeling method can be used in vivo to target receptors that are upregulated in tumors, using targeting molecules besides antibodies.
- the IMP 468 targeting took advantage of a naturally occurring ligand-receptor interaction.
- Somatostatin is another non-antibody targeting peptide that is of use for imaging the distribution of somatostatin receptor protein.
- I-labeled octreotide a somatostatin analog
- somatostatin receptor expressing tumors e.g., Kvols et al., 1993, Radiology 187: 129-33; Leitha et al., 1993, J Nucl Med 34: 1397-1402.
- 123 I has not been of extensive use for imaging because of its expense, short physical half-life and the difficulty of preparing the radiolabeled compounds.
- the 18 F-labeling methods described herein are preferred for imaging of somatostatin receptor expressing tumors.
- a NOTA-conjugated derivative of the somatostatin analog octreotide (IMP 466) was made by standard Fmoc based solid phase peptide synthesis to produce a linear peptide.
- the C-terminal Throl residue is threoninol.
- the peptide was cyclized by treatment with DMSO overnight.
- the peptide, 0.0073 g, 5.59 x 10 "6 mol was dissolved in 1 1 1.9 of 0.5 M pH 4 NaOAc buffer to make a 0.05 M solution of IMP 466.
- the solution formed a gel over time so it was diluted to 0.0125 M by the addition of more 0.5 M NaOAc buffer.
- 18 F was purified and concentrated with a QMA cartridge to provide 200 ⁇ , of 18 F in 0.4 M KHCO 3 .
- the bicarbonate solution was neutralized with 10 ⁇ , ⁇ glacial acetic acid.
- Example 21 Imaging of Neuroendocrine Tumors with an 18 F- and 68 Ga-Labeled IMP 466
- radiolabeled peptide was purified on RP-HPLC.
- the 18 F-IMP 466-containing fractions were collected and diluted two-fold with H 2 0 and purified on a 1-cc Oasis HLB cartridge (Waters, Milford, MA) to remove acetonitrile and TFA.
- the fraction was applied on the cartridge and the cartridge was washed with 3 mL H 2 0.
- the radiolabeled peptide was then eluted with 2 x 200 ⁇ 50% ethanol.
- the peptide was diluted with 0.9% NaCl. A maximum specific activity of 45,000 GBq/mmol was obtained.
- 68 Ga labeling - IMP 466 was labeled with 68 GaCl 3 eluted from a Ti0 2 -based 1 ,110 MBq 68 Ge/ 68 Ga generator (Cyclotron Co. Ltd., Obninsk, Russia) using 0.1 M ultrapure HC1 (J.T. Baker, Deventer, The Netherlands).
- IMP 466 was dissolved in 1.0 M HEPES buffer, pH 7.0.
- Four volumes of 68 Ga eluate (120-240 MBq) were added and the mixture was heated at 95°C for 20 min. Then 50 mM EDTA was added to a final concentration of 5 mM to complex the non-incorporated Ga .
- the Ga-labeled IMP 466 was purified on an Oasis HLB cartridge and eluted with 50% ethanol.
- DMEM Dulbecco's Modified Eagle's Medium
- ICjo determination The apparent 50% inhibitory concentration (IC 50 ) for binding the somatostatin receptors on AR42J cells was determined in a competitive binding assay using 19 F-IMP 466, 69 Ga-IMP 466 or 1 I5 In-DTPA-octreotide to compete for the binding of n i In- DTPA-octreotide.
- F-IMP 466 was formed by mixing an aluminium fluoride (A1F) solution (0.02 M A1C1 3 in 0.5 M NaAc, pH 4, with 0.1 M NaF in 0.5 M NaAc, pH 4) with IMP 466 and heating at 100° C for 15 min.
- A1F aluminium fluoride
- the reaction mixture was purified by RP-HPLC on a C- 18 column as described above.
- Ga-IMP 466 was prepared by dissolving gallium nitrate (2.3xl 0 "8 mol) in 30 ⁇ L ⁇ mixed with 20 ⁇ , IMP 466 (1 mg/mL) in 10 mM NaAc, pH 5.5, and heated at 90° C for 15 min. Samples of the mixture were used without further purification.
- U 5 In-DTPA-octreotide was made by mixing indium chloride (l l O -5 mol) with ⁇ 0 ⁇ , DTPA-octreotide (1 mg/mL) in 50 mM NaAc, pH 5.5, and incubated at room temperature (RT) for 15 min. This sample was used without further purification.
- m In-DTPA-octreotide (OCTREOSCAN ® ) was radiolabeled according to the manufacturer's protocol.
- AR42J cells were grown to confluency in 12-well plates and washed twice with binding buffer (DMEM with 0.5% bovine serum albumin). After 10 min incubation at RT in binding buffer, I9 F-IMP 466, 69 Ga-IMP 466 or 115 In-DTPA-octreotide was added at a final concentration ranging from 0.1-1000 nM, together with a trace amount (10,000 cpm) of l u In- DTPA-octreotide (radiochemical purity >95%). After incubation at RT for 3 h, the cells were washed twice with ice-cold PBS. Cells were scraped and cell-associated radioactivity was determined.
- binding buffer DMEM with 0.5% bovine serum albumin
- PET/CT imaging - Mice with s.c. AR42J tumors were injected intravenously with 10 MBq A1 18 F-IMP 466 or 68 Ga-IMP 466.
- 10 MBq A1 18 F-IMP 466 or 68 Ga-IMP 466 One and two hours after the injection of peptide, mice were scanned on an Inveon animal PET/CT scanner (Siemens Preclinical Solutions,
- radiolabeling yield was 49%, 44% and 46%, respectively.
- sodium citrate In the presence of sodium citrate, no labeling was observed ( ⁇ 1%).
- the specific activity of the preparations was 10,000 GBq/mmol, whereas in MES and HEPES buffer a specific activity of 20,500 and 16,500 GBq/mmol was obtained, respectively.
- radiolabeling yield increased with increasing amounts of peptide. At 38 nmol, radiolabeling yield ranged from 4-8%, at 153 nmol, the yield had increased to 42-49% and at the highest concentration the radiolabeling yield was 48-52%.
- Ga-labeled IMP 466 the octanol-water partition coefficients were determined.
- the log Poctanoi/water value for the A1 18 F-IMP 466 was -2.44 ⁇ 0.12 and that of 68 Ga-IMP 466 was -3.79 ⁇ 0.07, indicating that the 18 F-labeled IMP 466 was slightly less hydrophilic.
- Biodistribution studies The biodistribution of both A1 18 F-IMP 466 and 68 Ga-IMP 466 was studied in nude BALB/c mice with s.c. AR42J tumors at 2 h p.i. (FIG. 4). A1 18 F was included as a control. Tumor targeting of the 18 F-IMP 466 was high with 28.3 ⁇ 5.7 %ID/g accumulated at 2 h p.i. Uptake in the presence of an excess of unlabeled IMP 466 was 8.6 ⁇ 0.7 %ID/g, indicating that tumor uptake was receptor-mediated.
- A1 I8 F-IMP 466 was compared to that of 68 Ga-IMP 466 (FIG. 4).
- Tumor uptake of 68 Ga-IMP 466 (29.2 ⁇ 0.5 %ID/g, 2 h pi) was similar to that of A1 18 F- IMP 466 (pO.001).
- Lung uptake of 68 Ga-IMP 466 was two-fold higher than that of 18 F-IMP 466 (4.0 ⁇ 0.9 %ID/g vs. 1.9 ⁇ 0.4%ID/g, respectively).
- kidney retention of 68 Ga- IMP 466 was slightly higher than that of A1 18 F-IMP 466 (16.2 ⁇ 2.86 %ID/g vs. 9.96 ⁇ 1.27 %ID/g, respectively.
- FIG. 5 Fused PET and CT scans are shown in FIG. 5. PET scans corroborated the biodistribution data. Both A1 18 F-IMP 466 and 68 Ga-IMP 466 showed high uptake in the tumor and retention in the kidneys. The activity in the kidneys was mainly localized in the renal cortex. Again, the Al F proved to be stably chelated by the NOTA chelator, since no bone uptake was observed.
- FIG. 5 clearly shows that the distribution of an F-labeled analog of somatostatin (octreotide) mimics that of a Ga-labeled somatostatin analog.
- PET imaging with 68 Ga-labeled octreotide is reported to be superior to SPECT analysis with l l ! In- labeled octreotide and to be highly sensitive for detection of even small meningiomas (Henze et al., 2001 , J Nucl Med 42: 1053-56). Because of the higher energy of Ga compared with 18 F, it is expected that 18 F based PET imaging would show even better spatial resolution than 68 Ga based PET imaging. This is illustrated in FIG. 5 by comparing the kidney images obtained with 18 F-labeled IMP 466 (FIG. 5, left) vs. 68 Ga-labeled IMP 466 (FIG. 5, right).
- the PET images obtained with 68 Ga show more diffuse margins and lower resolution than the images obtained with 18 F.
- Example 22 Comparison of 68 Ga and 18 F PET Imaging Using Pretargeting
- mice with s.c. CEA-expressing LS 174T tumors received TF2 (6.0 nmol; 0.94 mg) and 5 MBq 68 Ga-labeled IMP 288 (0.25 nmol) or 18 F-labeled IMP 449 (0.25 nmol) intravenously, with an interval of 16 hours between the injection of the bispecific antibody and the radiolabeled peptide.
- TF2 6.0 nmol; 0.94 mg
- 5 MBq 68 Ga-labeled IMP 288 (0.25 nmol
- 18 F-labeled IMP 449 (0.25 nmol
- TF2 is a trivalent bispecific antibody comprising an HSG-binding Fab fragment from the h679 antibody and two CEA-binding Fab fragments from the hMN-14 antibody.
- the DOTA-conjugated, HSG-containing peptide IMP 288 was synthesized by peptide synthesis as described above.
- the IMP 449 peptide, synthesized as described above, contains a l ,4,7-triazacyclononane-l ,4,7-triacetic acid (NOT A) chelating moiety to facilitate labeling with 18 F.
- NOT A l ,4,7-triazacyclononane-l ,4,7-triacetic acid
- TF2 was labeled with 125 I (Perkin Elmer, Waltham, MA) by the iodogen method (Fraker and Speck, 1978, Biochem Biophys Res Comm 80:849-57), to a specific activity of 58 MBq/nmol.
- IMP 288 - IMP 288 was labeled with 1 1 'in (Covidien, Petten, The Netherlands) for biodistribution studies at a specific activity of 32 MBq/nmol under strict metal-free conditions.
- IMP 288 was labeled with Ga eluted from a TiO-based 1,110 MBq 68 Ge/ 68 Ga generator (Cyclotron Co. Ltd., Obninsk Russia) using 0.1 M ultrapure HC1. Five 1 ml fractions were collected and the second fraction was used for labeling the peptide.
- One volume of 1.0 M HEPES buffer, pH 7.0 was added to 3.4 nmol IMP 288.
- the 00 Ga-labeled IMP 288 peptide was purified on a 1-mL Oasis HLB-cartridge (Waters, Milford, MA). After washing the cartridge with water, the peptide was eluted with 25% ethanol. The procedure to label IMP 288 with Ga was performed within 45 minutes, with the preparations being ready for in vivo use.
- mice Animal experiments - Experiments were performed in male nude BALB/c mice (6-8 weeks old), weighing 20-25 grams. Mice received a subcutaneous injection with 0.2 mL of a suspension of 1 x 10 6 LS 174T-cells, a CEA -expressing human colon carcinoma cell line (American Type Culture Collection, Rockville, MD, USA). Studies were initiated when the tumors reached a size of about 0.1-0.3 g (10-14 days after tumor inoculation).
- PET images were acquired with an Inveon animal PET/CT scanner (Siemens).
- PET emission scans were acquired for 15 minutes, preceded by CT scans for anatomical reference (spatial resolution 1 13 ⁇ , 80 kV, 500 ⁇ , exposure time 300 msec).
- Ga-IMP 288 in the tumor (10.7 ⁇ 3.6 % ID/g), with very low uptake in the normal tissues (e.g., tumor/blood 69.9 ⁇ 32.3), in a CEA-negative tumor (0.35 ⁇ 0.35 % ID/g), and inflamed muscle (0.72 ⁇ 0.20 % ID/g).
- Tumors that were not pretargeted with TF2 also had low Ga- IMP 288 uptake (0.20 ⁇ 0.03 % ID/g).
- TF2 cleared rapidly from the blood and the normal tissues. Eighteen hours after injection the blood concentration was less than 0.45 % ID/g at all TF2 doses tested. Targeting of TF2 in the tumor was 3.5% ID/g at 2 h p.i. and independent of TF2 dose (data not shown). At all TF2 doses i n In-IMP 288 accumulated effectively in the tumor (not shown). At higher TF2 doses enhanced uptake of i n In-IMP 288 in the tumor was observed: at 1.0 nmol TF2 dose maximum targeting of IMP 288 was reached (26.2 ⁇ 3.8% ID/g).
- a higher peptide dose is required, because a minimum activity of 5-10 MBq 68 Ga needs to be injected per mouse if PET imaging is performed 1 h after injection.
- the specific activity of the Ga-IMP 288 preparations was 50-125 MBq/nmol at the time of injection. Therefore, for PET imaging at least 0.1-0.25 nmol of IMP 288 had to be administered.
- the same TF2:IMP 288 molar ratios were tested at 0.1 nmol IMP 288 dose.
- LS174T tumors were pretargeted by injecting 1.0, 2.5, 5.0 or 10.0 nmol TF2 (160, 400, 800 or 1600 ⁇ g).
- n i In-IMP 288 uptake in the tumor was not affected by the TF2 doses (15% ID/g at all doses tested, data not shown).
- TF2 targeting in the tumor in terms of % ID/g decreased at higher doses (3.21 ⁇ 0.61% ID/g versus 1.16 ⁇ 0.27% ID/g at an injected dose of 1.0 nmol and 10.0 nmol, respectively) (data not shown).
- Kidney uptake was also independent of the bsMAb dose (2% ID/g). Based on these data we selected a bsMAb dose of 6.0 nmol for targeting 0.1-0.25 nmol of IMP 288 to the tumor.
- PET imaging To demonstrate the effectiveness of pretargeted immunoPET imaging with TF2 and 68 Ga-IMP 288 to image CEA-expressing tumors, subcutaneous tumors were induced in five mice. In the right flank an s.c. LS174T tumor was induced, while at the same time in the same mice 1 x 10 6 SK-RC 52 cells were inoculated in the left flank to induce a CEA-negative tumor. Fourteen days later, when tumors had a size of 0.1-0.2 g, the mice were pretargeted with 6.0 nmol 125 I-TF2 intravenously. After 16 hours the mice received 5 MBq 68 Ga-IMP 288 (0.25 nmol, specific activity of 20 MBq/nmol). A separate group of three mice received the same amount of 68 Ga-IMP 288 alone, without pretargeting with TF2. PET/CT
- Uptake of 68 Ga-IMP 288 in the inflamed muscle was very low, while uptake in the tumor in the same animal was high (0.72 ⁇ 0.20 % ID/g versus 8.73 ⁇ 1.60 % ID/g, p ⁇ 0.05, FIG. 7). Uptake in the inflamed muscle was in the same range as uptake in the lungs, liver and spleen (0.50 ⁇ 0.14 % ID/g, 0.72 ⁇ 0.07 % ID/g, 0.44 ⁇ 0.10 % ID/g, respectively).
- Tumor-to-blood ratio of 68 Ga-IMP 288 in these mice was 69.9 ⁇ 32.3; inflamed muscle-to- blood ratio was 5.9 ⁇ 2.9; tumor-to-inflamed muscle ratio was 12.5 ⁇ 2.1.
- 18 F-FDG accreted efficiently in the tumor (7.42 ⁇ 0.20% ID/g, tumor-to-blood ratio 6.24 ⁇ 1.5, Figure 4).
- 18 F-FDG also substantially accumulated in the inflamed muscle (4.07 ⁇ 1.13 % ID/g), with inflamed muscle-to-blood ratio of 3.4 ⁇ 0.5, and tumor-to-inflamed muscle ratio of 1.97 ⁇ 0.71.
- the pretargeted immunoPET imaging method was tested using the Al I8 F-labeled IMP 449.
- Five mice received 6.0 nmol TF2, followed 16 h later by 5 MBq A1 18 F-IMP 449 (0.25 nmol).
- Three additional mice received 5 MBq Al F-IMP 449 without prior administration of TF2, while two control mice were injected with [A1 18 F] (3 MBq).
- the results of this experiment are summarized in FIG. 9. Uptake of Al F-IMP 449 in tumors pretargeted with TF2 was high (10.6 ⁇ 1.7 % ID/g), whereas it was very low in the non-pretargeted mice (0.45 ⁇ 0.38 %ID/g).
- A1 18 F accumulated in the bone (50.9 ⁇ 1 1.4 %ID/g), while uptake of the radiolabeled IMP 449 peptide in the bone was very low (0.54 ⁇ 0.2 % ID/g), indicating that the A1 18 F-IMP 449 was stable in vivo.
- the biodistribution of A1 18 F-IMP 449 in the TF2 pretargeted mice with s.c. LS174T tumors were highly similar to that of Ga-IMP 288.
- the PET-images of pretargeted immunoPET with A1 18 F-IMP 449 show the same intensity in the tumor as those with 68 Ga-IMP 288, but the resolution of the 18 F-images was superior to those of the 68 Ga-images (FIG. 10).
- the tumor-to-background ratio of the A1 18 F- IMP 449 signal was 66.
- Pretargeted immunoPET with TF2 in combination with 68 Ga-IMP 288 or A1 18 F-IMP 449 involves two intravenous administrations. An interval between the infusion of the bsMAb and the radiolabeled peptide of 16 h was used. After 16 h most of the TF2 had cleared from the blood (blood concentration ⁇ 1% ID/g), preventing complexation of TF2 and IMP 288 in the circulation.
- the Ga-labeled peptide could be rapidly purified on a CI 8-cartridge. Radiolabeling and purification for administration could be accomplished within 45 minutes.
- 68 Ga matches with the kinetics of the IMP 288 peptide in the pretargeting system: maximum accretion in the tumor is reached within 1 h.
- 68 Ga can be eluted twice a day form a 68 Ge/ 68 Ga generator, avoiding the need for an on-site cyclotron.
- the high energy of the positrons emitted by 68 Ga limits the spatial resolution of the acquired images to 3 mm, while the intrinsic resolution of the microPET system is as low as 1.5 mm.
- the NOTA-conjugated peptide IMP 449 was labeled with 18 F, as described above. Like labeling with 68 Ga, it is a one-step procedure. Labeling yields as high as 50% were obtained.
- the biodistribution of A1 I8 F-IMP 449 was highly similar to that of 68 Ga-labeled IMP 288, suggesting that with this labeling method 18 F is a residualizing radionuclide.
- pretargeted immunoPET could also be used to estimate radiation dose delivery to tumor and normal tissues prior to pretargeted radioimmunotherapy.
- TF2 is a humanized antibody, it has a low immunogenicity, opening the way for multiple imaging or treatment cycles.
- Folic acid is activated as described (Wang et. al. Bioconjugate Chem. 1996, 7, 56-62.) and conjugated to Boc-NH-CH 2 -CH 2 -NH2.
- the conjugate is purified by chromatography.
- the Boc group is then removed by treatment with TFA.
- the amino folate derivative is then mixed with ⁇ -SCN-Bn-NOTA (Macrocyclics) in a carbonate buffer.
- the product is then purified by HPLC.
- the folate-NOTA derivative is labeled with Al F as described in the preceding Examples and then HPLC purified.
- the 18 F-labeled folate is injected i.v. into a subject and successfully used to image the distribution of folate receptors, for example in cancer or inflammatory diseases (see, e.g., Ke et al., Advanced Drug Delivery Reviews, 56: 1 143-60, 2004).
- a patient (1.7 m body surface area) with a suspected recurrent tumor is injected with 17 mg of bispecific monoclonal antibody (bsMab).
- the bsMab is allowed to localize to the target and clear from the blood.
- the F-labeled peptide (5-10 mCi on 5.7 x 10 " mol) is injected when 99 % of the bsMab has cleared from the blood.
- PET imaging shows the presence of micrometastatic tumors.
- RGD Arg-Gly-Asp
- the F labeled RGD peptide is used for in vivo biodistribution and PET imaging as disclosed in Jeong et al. (2008).
- the [A1 I8 F] conjugate of RGD-NOTA is taken up into ischemic tissues and provides PET imaging of angiogenesis.
- a NOTA thiosemicarbazide derivative is prepared by reacting the -SCN-Bn-NOTA with hydrazine and then purifying the ligand by HPLC.
- [A1 18 F] is prepared as described in the preceding Examples and the [A1 18 F] is added to the NOTA thiosemicarbazide and heated for 15 min.
- the [A1 18 F] NOTA thiosemicarbazide complex is purified by HPLC.
- the [Al l8 F] NOTA thiosemicarbazide is conjugated to oxidized carbohydrates by known methods. The F-labeled carbohydrate is successfully used for imaging studies using PET scanning.
- the affinity of chelating moieties such as NETA and NOTA for aluminum is much higher than the affinity of aluminum for 18 F.
- the affinity of Al for I 8 F is affected by factors such as the ionic strength of the solution, since the presence of other counter-ions tends to shield the positively charged aluminum and negatively charged fluoride ions from each other and therefore to decrease the strength of ionic binding. Therefore low ionic strength medium should increase the effective binding of Al and 18 F.
- F 163 mCi
- the solution was passed through a SEP-PA ® Light, WATERS® ACCELLTM Plus QMA Cartridge. The column was then washed with 5 mL of DI water. The F was eluted with 0.4 M K 2 C0 3 in fractions as shown in Table 12.
- the radiolabeled peptide A1 I 8 F IMP 461 was then eluted with 10 mL 1 : 1 EtOH/H 2 0, 30.3 mCi, 63.5% yield, specific activity 750 Ci/mmol.
- the labeled peptide was free of unbound 18 F by HPLC. The total reaction and purification time was 20 min.
- Example 30 Preparation of 1 F Labeled Peptides [0313] Products containing 21 Al and/or 19 F are useful for certain applications like NMR imaging. An improved method for preparing [A1 19 F] labeled compounds was developed. IMP 461 was prepared as described above and labeled with 19 F. Reacting IMP 461 with AICI3 + NaF resulted in the formation of three products (not shown). However, by reacting IMP 461 with A1F 3 .6H 2 0 we obtained a higher yield of [A1 19 F] IMP 461.
- the instant Example shows that a targeting peptide of use for pretargeting detection, diagnosis and/or imaging may be prepared using the instant methods.
- IMP 479 SEQ ID NO:35
- IMP 485 SEQ ID NO:36
- IMP 487 SEQ ID NO:37
- IMP 485 was made on Sieber Amide resin by adding the following amino acids to the resin in the order shown: Aloc-D-Lys(Fmoc)-OH, Trt-HSG-OH, the Aloe was cleaved, Fmoc-D-Tyr(But)-OH, Aloc-D-Lys(Fmoc)-OH, Trt- HSG-OH, the Aloe was cleaved, (tert-Butyl) 2 NODA-MPAA (methyl phenyl acetic acid). The peptide was then cleaved from the resin and purified by RP-HPLC to yield 44.8 mg of IMP 485.
- radiolabeling of IMP 485 has been observed with up to an 88% yield and a specific activity of 2,500 Ci/mmol. At this specific activity, HPLC purification of the radiolabeled peptide is not required for in vivo PET imaging using the radiolabeled peptide.
- a kit containing 40 nmol of IMP 485 or IMP 487, 20 nmol AICI 3 , 0.1 mg ascorbic acid and 0.1 g trehalose adjusted to pH 3.9 was reconstituted with purified 18 F in 200 ⁇ , saline and heated 106 °C for 15 min.
- the reaction mixture was then diluted with 800 ⁇ . water and placed on an HLB column. After washing, the column was eluted with 2 x 200 1 : 1 EtOH/H 2 0 to obtain the purified 18 F-IMP 485 in 64.6 % isolated yield.
- the radiolabeled peptide in 50 ⁇ was mixed with 250 ⁇ , of fresh human serum in a vial and incubated at 37°C.
- 18 F-IMP 485 Radiolabeling - 18 F (218 mCi) was purified to isolate 145.9 mCi.
- the purified 18 F (135 mCi) was added to a lyophilized vial containing 40 nmol of pre-complexed Al-IMP 485.
- the reaction vial was heated at 1 10° C for 17 min.
- Water (0.8 mL) was added to the reaction mixture before HLB purification.
- the product (22 mCi) was eluted with 0.6 mL of water: ethanol (1 : 1) mixture into a vial containing lyophilized ascorbic acid.
- the product was diluted with saline.
- the 18 F-A1 IMP 485 specific activity used for injection was 550 Ci/mmol.
- Urine stability Ten mice bearing s.c. Capan-1 xenografts were injected with 18 F-A1- IMP 485 (400 ⁇ , in saline, 100 ⁇ ). Urine was collected from 3 mice at 55 min post injection. The urine samples were analyzed by reverse phase and SE HPLC. Stability of the radiolabeled IMP 485 in urine was observed.
- Kidney 6 0.149 0.013 3.328 0.556 0.499 0.119 0.1 0.0
- Kidney 6 0.154 0.013 2.265 0.287 0.345 0.028 0.0 0.0
- Kidney 7 0.140 0.018 3.193 0.730 0.444 0.098 9 4
- IMP 485 labels as well as or better than IMP 467, with equivalent stability in serum. However, IMP 485 is much easier to synthesize than IMP 467.
- Preliminary studies have shown that 18 F labeling of lyophilized IMP 485 works as well as non-lyophilized peptide (data not shown).
- the presence of alkyl or aryl groups in the linker joining the chelating moiety to the rest of the peptide was examined.
- the presence of aryl groups in the linker appears to increase the radiolabeling yield relative to the presence of alkyl groups in the linker.
- Reagents were obtained from the following sources: Acetic acid (JT Baker 6903-05 or 9522-02), Sodium hydroxide (Aldrich semiconductor grade 99.99% 30,657-6), ⁇ , ⁇ - Trehalose (JT Baker 4226-04), Aluminum chloride hexahydrate (Aldrich 99% 237078), Ascorbic acid (Aldrich 25,556-4).
- Acetate Buffer 2 mM - Acetic acid, 22.9 ⁇ _ (4.0 x 10 "4 mol) was diluted with 200 mL water and neutralized with 6 N NaOH ( ⁇ 15 ⁇ ) to adjust the solution to pH 4.22.
- the peptide, 20 ⁇ (40 nmol) was mixed with 12 ⁇ , (24 nmol) of Al, 100 ⁇ , of trehalose, 20 (0.1 mg) ascorbic acid and 900 ⁇ , of DI water in a 3 mL lyophilization vial.
- the final pH of the solution should be ⁇ pH 4.0.
- the vial was frozen, lyophilized and sealed under vacuum. In this formulation, the peptide is loaded with aluminum prior to binding 18 F.
- kits Ten and 20 nmol kits have also been made. These kits are made the same as the 40 nmol kits keeping the peptide to Al 3+ ratio of 1 peptide to 0.6 Al 3+ but formulated in 2 mL vials with a total fill of 0.5 mL.
- the crude F was received in 2 mL of DI water in a syringe.
- the syringe was placed on a syringe pump and the liquid pushed through a Waters CM cartridge followed by a QMA cartridge. Both cartridges were washed with 10 mL DI water.
- a sterile disposable three way valve between the two cartridges was switched and 1 mL commercial sterile saline was pushed through the QMA cartridge in 200 ⁇ L ⁇ fractions.
- the second fraction usually contains ⁇ 80 % of the 18 F regardless of the amount of 18 F applied (10-300 mCi loads were tested).
- the peptide was radiolabeled by adding 18 F in 200 ⁇ saline to the lyophilized peptide in a crimp sealed vial and then heating the solution to 90-105°C for 15 min.
- the peptide was purified by adding 800 mL of DI water in a 1 mL syringe to the reaction vial, removing the liquid with the 1 mL syringe and applying the liquid to a Waters HLB column (lcc, 30 mg).
- the HLB column was placed on a crimp sealed 5 mL vial and the liquid was drawn into the vial under vacuum supplied by a remote (using a sterile disposable line) 10 mL syringe.
- the reaction vial was washed with two one mL aliquots of DI water, which were also drawn through the column. The column was then washed with 1 mL more of DI water. The column was then moved to a vial containing buffered lyophilized ascorbic acid ( ⁇ pH 5.5, 15 mg). The radiolabeled product was eluted with three 200 portions of 1 : 1 EtOH/DI water. The yield was determined by measuring the activity on the HLB cartridge, in the reaction vial, in the water wash and in the product vial to get the percent yield.
- a 20 nmol kit can be reconstituted with a mixture of 200 ⁇ ⁇ F-18 in saline and 200 ⁇ i ethanol. The solution is then heated to 100-1 10°C in the crimp sealed vial for 15 min. After heating, the reaction is diluted with 3 mL water before purification on a 3 cc (60 mg) HLB extraction cartridge. The peptide can be labeled in good yield and up to 4,100 Ci/mmol specific activity using this method.
- IMP 485 (21.5 mg, 0.016 mmol) was dissolved in 1 niL of 2 mM NaOAc, pH 4.4 and treated with A1C1 3 .6H 2 0 (13.2 mg, 0.055 mmol). The pH was adjusted to 4.5-5.0 and the reaction mixture was refluxed for 15 minutes. The crude mixture was purified by preparative RP-HPLC to yield a white solid (1 1.8 mg).
- the pre-filled Al-NOTA complex (IMP 486) was also radiolabeled in excellent yield after formulating into lyophilized kits.
- the labeling yields with IMP 486 were as good as or better than IMP 485 kits (Table 19) when labeled in saline.
- This high efficiency of radiolabeling with chelator preloaded with aluminum was not observed with any of the other Al-NOTA complexes tested (data not shown).
- the equivalency of labeling in saline and in 1 : 1 ethanol/water the labeling yields was also not observed with other chelating moieties (not shown).
- A1 18 F-IMP 485 alone Mice bearing sc LS174T xenografts were injected with A1 18 F- IMP 485 (28 ⁇ , 5.2 x 10 "1 1 mol, 100 ⁇ , iv). Mice were necropsied at 1 and 3 h post injection, 6 mice per time point.
- TF2 + A1 18 F-IMP 485 Pretargeting at 20:1 bsMab to peptide ratio: Mice bearing sc LS 174T xenografts were injected with TF2 (163.2 ⁇ g, 1.03 x 10 "9 mol, iv) and allowed 16.3 h for clearance before injecting A1 18 F-IMP 485 (28 ⁇ , 5.2 x 10 "u mol, 100 ⁇ , iv). Mice were necropsied at 1 and 3 h post injection, 7 mice per time point.
- IMP485 (16.5 mg, 0.013 mmol) was dissolved in 1 mL of 2 mM NaOAc, pH 4.43, 0.5 mL ethanol and treated with A1F 3 .3H 2 0 (2.5 mg, 0.018 mmol). The pH was adjusted to 4.5- 5.0 and the reaction mixture was refluxed for 15 minutes. On cooling the pH was once again raised to 4.5-5.0 and the reaction mixture refluxed for 15 minutes. The crude was purified by preparative RP-HPLC to yield a white solid (10.3 mg).
- the peptide was synthesized on threoninol resin with the amino acids added in the following order: Fmoc-Cys(Trt)-OH, Fmoc-Thr(But)-OH, Fmoc-Lys(Boc)-OH, Fmoc-D- Trp(Boc)-OH, Fmoc-Phe-OH, Fmoc-Cys(Trt)-OH, Fmoc-D-Phe-OH and (tBu) 2 NODA- MPAA.
- the peptide was then cleaved and purified by preparative RP-HPLC.
- the peptide was cyclized by treatment of the bis-thiol peptide with DMSO.
- A1 19 FIMP490 was prepared as described above (IMP492) to produce the desired peptide after HPLC purification.
- the peptide was synthesized on Sieber amide resin with the amino acids added in the following order: Fmoc-Met-OH, Fmoc-Leu-OH, Fmoc-His(Trt)-OH, Fmoc-Gly-OH, Fmoc- Val-OH, Fmoc-Ala-OH, Fmoc-Trp(Boc)-OH, Fmoc-Gln(Trt)-OH, Fmoc-NH-(PEG) 3 -COOH and (tBu) 2 NODA-MPAA.
- the peptide was then cleaved and purified by preparative RP- HPLC.
- A1 19 FIMP493 was prepared as described above (IMP492) to produce the desired peptide after HPLC purification.
- Example 33 Other Prosthetic Group Labeling Methods Using A1 18 F or A1 19 F
- the aluminum fluoride labeling method may be performed using prosthetic group labeling methods for molecules that are sensitive to heat. Prosthetic group conjugation may be carried out at lower temperatures for heat-sensitive molecules.
- the prosthetic group NOTA is labeled with 18 F or 19 F as described above and then it is attached to the targeting molecule. In one non-limiting example, this is performed with an aldehyde NOTA that is then attached to an amino-oxy compound on a targeting molecule. Alternatively an amino-oxy maleimide is reacted with the aldehyde and then the maleimide is attached to a cysteine on a targeting molecule (Toyokuni et al., 2003, Bioconj Chem
- the AlF-chelator complexes are attached to targeting molecules through click chemistry.
- the ligands are first labeled with A1 18 F or A1 19 F as discussed above.
- the AlF-chelator is then conjugated to a targeting molecule through a click chemistry reaction.
- an alkyne NOTA is labeled according to Marik and Stucliffe (2006, Tetrahedron Lett 47:6681) and conjugated to an azide containing targeting agent.
- the F (0.01 mCi or higher) is received in 200 L of saline in a 0.5 mL syringe and the solution is mixed with 200 iL of ethanol and injected into a lyophilized kit as described above.
- the solution is heated in the crimp sealed container at 100-1 10°C for 15 min.
- the solution is diluted with 3 mL water and eluted through an HLB cartridge.
- the reaction vial and the cartridge are washed with 2 x 1 mL portions of water and then the product is eluted into a vial containing buffered ascorbic acid using 1 : 1 ethanol water in 0.5 mL fractions. Some of the ethanol may be evaporated off under a stream of inert gas.
- the solution is then diluted in saline and passed through a 0.2 ⁇ sterile filter prior to injection.
- a maleimide derivative of NOTA may be of use for low-temperature labeling of molecules.
- An exemplary method of preparing maleimide-derivatized NOTA is discussed below. Details are shown in FIG. 15.
- the crude reaction solution was pulled through the HLB cartridge into a 5 mL vial and the cartridge washed with 3 x 1 mL fractions of DI H 2 0 (49.9 ⁇ ).
- the HLB cartridge was then placed on a new 3 mL vial and eluted with 4x200 ih 1 : 1 EtOH/H 2 0 to collect the labeled peptide (0.978 mCi).
- the reaction vessel retained 7.73 ⁇ , while the cartridge retained 22.1 ⁇ Ci of activity.
- Pepsin Digestion To 90 ml of 9.8 mg/ml hMN14 IgG C/N 0206078 (Total 882 mg), added 9.0 ml of 0.1 M Citrate, pH 3.5 buffer, adjusted to pH 3.7 with 1M citric acid, added 1.2 ml of lmg/ml pepsin in 0.1 M citrate, pH 3.5 buffer (final cone, of pepsin was 12 ⁇ g/ml). The mixture was incubated at 37°C for 40 min. Digestion was monitored by SE-HPLC and the reaction was stopped by adding 10% of 3M Tris, pH 8.6
- the flow-through peak was collected and fractions 3 and 4 were pooled, concentrated and dilfiltered into 0.04 M PBS, pH 7.4. After filtration using a 0.22um filter, the final concentration was 5.5 mg/ml, 40mL, total 220 mg of protein.
- the final concentration was 2.3 mg/mL (9 mL, total 20.7 mg).
- the thiol content per antibody was determined by Elman's assay to be 2.4 SH/Fab. Lyophilization was performed using 0.45 mL (lmg protein) per vial.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Epidemiology (AREA)
- Optics & Photonics (AREA)
- Physics & Mathematics (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Immunology (AREA)
- Biophysics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Communicable Diseases (AREA)
- Oncology (AREA)
- Biotechnology (AREA)
- Genetics & Genomics (AREA)
- Heart & Thoracic Surgery (AREA)
- Cardiology (AREA)
- Vascular Medicine (AREA)
- Virology (AREA)
- Urology & Nephrology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
- Magnetic Resonance Imaging Apparatus (AREA)
Priority Applications (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU2010326004A AU2010326004B2 (en) | 2009-12-04 | 2010-12-02 | Methods and compositions for improved F-18 labeling of proteins, peptides and other molecules |
| CA2782223A CA2782223A1 (en) | 2009-12-04 | 2010-12-02 | Methods and compositions for improved f-18 labeling of proteins, peptides and other molecules |
| JP2012542186A JP5789821B2 (ja) | 2009-12-04 | 2010-12-02 | タンパク質、ペプチドおよび他の分子の改善されたf−18標識化のための方法および組成物 |
| EP10835120.6A EP2507254A4 (en) | 2009-12-04 | 2010-12-02 | METHODS AND COMPOSITIONS FOR ENHANCED F-18 MARKING OF PROTEINS, PEPTIDES AND OTHER MOLECULES |
| IN3177DEN2012 IN2012DN03177A (enExample) | 2009-12-04 | 2010-12-02 | |
| CN201080052555.0A CN102666567B (zh) | 2009-12-04 | 2010-12-02 | 用于蛋白质、肽和其它分子的改进的f-18标记的方法和组合物 |
Applications Claiming Priority (12)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US26677309P | 2009-12-04 | 2009-12-04 | |
| US61/266,773 | 2009-12-04 | ||
| US30228010P | 2010-02-08 | 2010-02-08 | |
| US61/302,280 | 2010-02-08 | ||
| US31612510P | 2010-03-22 | 2010-03-22 | |
| US61/316,125 | 2010-03-22 | ||
| US34748610P | 2010-05-24 | 2010-05-24 | |
| US61/347,486 | 2010-05-24 | ||
| US38172010P | 2010-09-10 | 2010-09-10 | |
| US61/381,720 | 2010-09-10 | ||
| US38826810P | 2010-09-30 | 2010-09-30 | |
| US61/388,268 | 2010-09-30 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2011068965A1 true WO2011068965A1 (en) | 2011-06-09 |
Family
ID=44115287
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2010/058724 Ceased WO2011068965A1 (en) | 2009-12-04 | 2010-12-02 | Methods and compositions for improved f-18 labeling of proteins, peptides and other molecules |
Country Status (8)
| Country | Link |
|---|---|
| US (3) | US8202509B2 (enExample) |
| EP (1) | EP2507254A4 (enExample) |
| JP (1) | JP5789821B2 (enExample) |
| CN (1) | CN102666567B (enExample) |
| AU (1) | AU2010326004B2 (enExample) |
| CA (1) | CA2782223A1 (enExample) |
| IN (1) | IN2012DN03177A (enExample) |
| WO (1) | WO2011068965A1 (enExample) |
Cited By (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN102675329A (zh) * | 2012-06-05 | 2012-09-19 | 浙江大学 | 一种正电子发射断层显像剂及其制备方法 |
| WO2013110615A1 (en) | 2012-01-23 | 2013-08-01 | Ge Healthcare Limited | Radiofluorination method |
| CN103370063A (zh) * | 2010-12-13 | 2013-10-23 | 免疫医疗公司 | 用于改善蛋白质、肽和其他分子的f-18标记的方法和组合物 |
| WO2014084372A1 (ja) * | 2012-11-30 | 2014-06-05 | 国立大学法人京都大学 | ポリペプチド及びイメージング方法 |
| WO2017007807A1 (en) * | 2015-07-07 | 2017-01-12 | Immunomedics, Inc. | IMPROVED METHODS OF IMAGING WITH Ga-68 LABELED MOLECULES |
| WO2017070752A1 (en) * | 2015-10-29 | 2017-05-04 | The University Of Queensland | Imaging agents |
| CN107312070A (zh) * | 2017-05-03 | 2017-11-03 | 厦门大学附属第医院 | 一种18f标记的pet多肽探针及其制备方法 |
| US11103604B2 (en) | 2013-05-03 | 2021-08-31 | Ge Healthcare Uk Limited | Metal complexes and fluorination thereof |
| US12144875B2 (en) | 2018-06-01 | 2024-11-19 | Tayu Huaxia Biotech Medical Group Co., Ltd. | Compositions and methods for imaging |
| WO2024238987A3 (en) * | 2023-05-18 | 2025-04-03 | The Regents Of The University Of California | Labeled oligosaccharides and methods of use |
Families Citing this family (37)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7563433B2 (en) * | 2007-01-11 | 2009-07-21 | Immunomedics, Inc. | Methods and compositions for F-18 labeling of proteins, peptides and other molecules |
| US20100226884A1 (en) * | 2009-01-20 | 2010-09-09 | Immunomedics, Inc. | Novel Class of Monospecific and Bispecific Humanized Antibodies that Target the Insulin-like Growth Factor Type I Receptor (IGF-1R) |
| US20160045626A1 (en) * | 2007-01-11 | 2016-02-18 | Immunomedics, Inc. | Methods and Compositions for Improved Labeling of Targeting Peptides |
| US8398956B2 (en) * | 2007-01-11 | 2013-03-19 | Immunomedics, Inc. | In vivo copper-free click chemistry for delivery of therapeutic and/or diagnostic agents |
| US8709382B2 (en) * | 2007-01-11 | 2014-04-29 | Immunomedics, Inc. | Methods and compositions for improved F-18 labeling of proteins, peptides and other molecules |
| US8545809B2 (en) * | 2007-01-11 | 2013-10-01 | Immunomedics, Inc. | Methods and compositions for improved 18F labeling of proteins, peptides and other molecules |
| US8889100B2 (en) * | 2007-01-11 | 2014-11-18 | Immunomedics, Inc. | Methods and compositions for improved F-18 labeling of proteins, peptides and other molecules |
| US9446995B2 (en) | 2012-05-21 | 2016-09-20 | Illinois Institute Of Technology | Synthesis of therapeutic and diagnostic drugs centered on regioselective and stereoselective ring opening of aziridinium ions |
| US10556873B2 (en) | 2008-02-22 | 2020-02-11 | Illinois Institute Of Technology | Bimodal ligands with macrocyclic and acyclic binding moieties, complexes and compositions thereof, and methods of using |
| US10189803B2 (en) | 2008-02-22 | 2019-01-29 | Illinois Institute Of Technology | Synthesis of therapeutic and diagnostic drugs centered on regioselective and stereoselective ring opening of aziridinium ions |
| WO2010011367A2 (en) * | 2008-02-22 | 2010-01-28 | Illinois Institute Of Technology | Bimodal ligands with macrocyclic and acyclic binding moieties, complexes and compositions thereof, and methods of using |
| IN2012DN03177A (enExample) * | 2009-12-04 | 2015-09-25 | Immunomedics Inc | |
| WO2012170602A1 (en) * | 2011-06-09 | 2012-12-13 | Ge Healthcare Limited | Distillation device and method |
| US9757458B2 (en) | 2011-12-05 | 2017-09-12 | Immunomedics, Inc. | Crosslinking of CD22 by epratuzumab triggers BCR signaling and caspase-dependent apoptosis in hematopoietic cancer cells |
| EP2854845B1 (en) * | 2012-06-01 | 2018-03-28 | IBC Pharmaceuticals, Inc. | Multimeric complexes with improved in vivo stability, pharmacokinetics and efficacy |
| WO2014025828A1 (en) * | 2012-08-06 | 2014-02-13 | The Regents Of The University Of California | Engineered antibody fragments for targeting and imaging cd8 expression in vivo |
| CN102911256B (zh) * | 2012-11-02 | 2016-06-01 | 厦门大学 | 一种放射性标记的多肽配合物及其制备方法和应用 |
| KR102353885B1 (ko) | 2013-03-13 | 2022-01-20 | 이미지냅 인코포레이티드 | Cd8에의 항원 결합 구조체들 |
| CN103267850B (zh) * | 2013-04-27 | 2015-04-15 | 深圳先进技术研究院 | 用于肿瘤病理诊断的探针及其制备方法和应用 |
| US10441669B2 (en) | 2013-10-04 | 2019-10-15 | Illinois Institute Of Technology | Multifunctional chelators, complexes, and compositions thereof, and methods of using same |
| US20160303258A1 (en) * | 2013-12-03 | 2016-10-20 | Millennium Pharmaceuticals, Inc. | Compounds and compositions for imaging gcc-expressing cells |
| US20150217006A1 (en) * | 2014-02-06 | 2015-08-06 | Immunomedics, Inc. | Al-f-18-labeled, al-f-19-labeled and ga-68-labeled gastrin-releasing peptide receptor (grpr)-antagonists for imaging of prostate cancer |
| US20160331852A1 (en) * | 2015-05-11 | 2016-11-17 | Memorial Sloan Kettering Cancer Center | Radioligands for pretargeted pet imaging and methods of their therapeutic use |
| NZ739721A (en) | 2015-08-07 | 2019-09-27 | Imaginab Inc | Antigen binding constructs to target molecules |
| TWI617319B (zh) * | 2015-09-01 | 2018-03-11 | 免疫功坊股份有限公司 | 用以治療病理性血栓的融合蛋白 |
| WO2018147960A1 (en) | 2017-02-08 | 2018-08-16 | Imaginab, Inc. | Extension sequences for diabodies |
| CN108314678B (zh) * | 2018-01-17 | 2019-11-08 | 浙江大学 | 以磷脂酰丝氨酸为靶点的分子探针及其用途 |
| WO2019185901A1 (en) | 2018-03-30 | 2019-10-03 | Centre National De La Recherche Scientifique | Pyclen-based macrocyclic ligands, chelates thereof and uses thereof |
| EP3826673A4 (en) * | 2018-07-26 | 2022-03-09 | Tayu Huaxia Biotech Medical Group Co., Ltd. | COMPOSITIONS AND METHODS FOR IMAGING |
| KR20210113202A (ko) * | 2019-01-07 | 2021-09-15 | 아스텔라스세이야쿠 가부시키가이샤 | 배위자, 스페이서, 펩티드 링커 및 생물 분자를 포함하는 복합체 |
| WO2020151572A1 (en) * | 2019-01-23 | 2020-07-30 | Tayu Huaxia Biotech Medical Group Co., Ltd. | Anti-pd-l1 diabodies and the use thereof |
| CA3148288A1 (en) * | 2019-08-21 | 2021-02-25 | Nihon Medi-Physics Co., Ltd. | Method for producing radioactive metal complex |
| WO2021096968A1 (en) * | 2019-11-13 | 2021-05-20 | Duke University | Radiohalogen prosthetic moieties and radiolabeled biomolecules |
| CN112285361B (zh) * | 2020-09-27 | 2023-12-05 | 中国人民解放军空军军医大学 | 排除抗-cd38单克隆抗体药物对抗人球蛋白检测干扰的试剂 |
| AU2022250323A1 (en) * | 2021-03-31 | 2023-11-09 | Nihon Medi-Physics Co., Ltd. | Radioactive complex of anti-egfr antibody, and radiopharmaceutical |
| CN113773365A (zh) * | 2021-09-09 | 2021-12-10 | 原子高科股份有限公司 | 生长抑素类似物及其应用 |
| EP4273142A1 (en) | 2022-05-06 | 2023-11-08 | Université de Bretagne Occidentale | Picolinate cyclam palladium chelates and uses thereof |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20050112060A1 (en) * | 2000-06-20 | 2005-05-26 | Idec Pharmaceuticals Corporation | Treatment of B-cell associated diseases such as malignancies and autoimmune diseases using a cold anti-CD20 antibody/radiolabeled anti-CD22 antibody combination |
| US20080253964A1 (en) * | 2007-01-11 | 2008-10-16 | Immunomedics, Inc. | Methods and Compositions for F-18 Labeling of Proteins, Peptides and Other Molecules |
| US20090246130A1 (en) * | 2007-01-11 | 2009-10-01 | Immunomedics, Inc. | Methods and Compositions for F-18 Labeling of Proteins, Peptides and Other Molecules |
Family Cites Families (29)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| FR2604092B1 (fr) * | 1986-09-19 | 1990-04-13 | Immunotech Sa | Immunoreactifs destines a cibler les cellules animales pour leur visualisation ou leur destruction in vivo |
| US5446147A (en) * | 1992-04-03 | 1995-08-29 | Trustees Of The University Of Pennsylvania | Fluorinated and iodinated dopamine agents |
| EP1009726B1 (en) * | 1997-09-03 | 2007-02-14 | Immunomedics, Inc. | Fluorination of proteins and peptides for f-18 positron emission tomography |
| US6071490A (en) * | 1998-05-07 | 2000-06-06 | Immunomedics, Inc. | Position emission tomography using gallium-68 chelates |
| US7387772B1 (en) * | 1999-06-22 | 2008-06-17 | Immunimedics, Inc. | Chimeric, human and humanized anti-CSAP monoclonal antibodies |
| US6962702B2 (en) * | 1998-06-22 | 2005-11-08 | Immunomedics Inc. | Production and use of novel peptide-based agents for use with bi-specific antibodies |
| US7138103B2 (en) * | 1998-06-22 | 2006-11-21 | Immunomedics, Inc. | Use of bi-specific antibodies for pre-targeting diagnosis and therapy |
| US7405320B2 (en) * | 1998-06-22 | 2008-07-29 | Immunomedics, Inc. | Therapeutic and diagnostic conjugates for use with multispecific antibodies |
| US6056939A (en) * | 1998-08-28 | 2000-05-02 | Desreux; Jean F. | Self-assembling heteropolymetallic chelates as imaging agents and radiopharmaceuticals |
| DE19846148C2 (de) * | 1998-10-01 | 2002-10-10 | Igor Popov | Verfahren zur Beurteilung der oxidativen Modifikation proteinhaltiger Stoffe mittels Messung ihrer antiradikalen Aktivität |
| US6207858B1 (en) * | 1999-03-03 | 2001-03-27 | Idec Pharmaceuticals Corporation | Regioselective synthesis of DTPA derivatives |
| EP1239887A1 (en) * | 1999-10-15 | 2002-09-18 | Mayo Foundation For Medical Education And Research | Cobalamin conjugates useful as imaging and therapeutic agents |
| US6605615B2 (en) * | 2000-03-01 | 2003-08-12 | Tularik Inc. | Hydrazones and analogs as cholesterol lowering agents |
| US7011816B2 (en) * | 2001-12-26 | 2006-03-14 | Immunomedics, Inc. | Labeling targeting agents with gallium-68 and gallium-67 |
| US7081452B2 (en) * | 2002-06-03 | 2006-07-25 | The United States Of America As Represented By The Department Of Health And Human Services | Scorpionate-like pendant macrocyclic ligands, complexes and compositions thereof, and methods of using same |
| US7993626B2 (en) * | 2007-01-11 | 2011-08-09 | Immunomedics, Inc. | Methods and compositions for F-18 labeling of proteins, peptides and other molecules |
| US7597876B2 (en) * | 2007-01-11 | 2009-10-06 | Immunomedics, Inc. | Methods and compositions for improved F-18 labeling of proteins, peptides and other molecules |
| CN1767860A (zh) * | 2003-01-31 | 2006-05-03 | 免疫医疗公司 | 施用治疗和诊断剂的方法和组合物 |
| CA2533878A1 (en) * | 2003-07-29 | 2005-09-22 | Immunomedics, Inc. | Fluorinated carbohydrate conjugates |
| CA2555597C (en) * | 2004-02-13 | 2016-06-14 | The University Of British Columbia | Radiolabeled compounds and compositions, their precursors and methods for their production |
| WO2006107617A2 (en) * | 2005-04-06 | 2006-10-12 | Ibc Pharmaceuticals, Inc. | Methods for generating stably linked complexes composed of homodimers, homotetramers or dimers of dimers and uses |
| DE102004034517A1 (de) * | 2004-07-16 | 2006-02-16 | Covion Organic Semiconductors Gmbh | Metallkomplexe |
| WO2006017619A2 (en) * | 2004-08-06 | 2006-02-16 | The Regents Of The University Of California | Receptor-binding cyclic peptides and methods of use |
| JP2009508090A (ja) * | 2005-08-31 | 2009-02-26 | イムノメディクス, インコーポレイテッド | 予め標的化されたポジトロン放出断層撮影画像化のためのf−18ペプチド |
| TWI303332B (en) * | 2006-08-04 | 2008-11-21 | Largan Precision Co Ltd | Optical lens assembly |
| US7666392B2 (en) * | 2006-09-15 | 2010-02-23 | Siemens Medical Solutions Usa, Inc. | Click chemistry-derived cyclopeptide derivatives as imaging agents for integrins |
| US8398956B2 (en) * | 2007-01-11 | 2013-03-19 | Immunomedics, Inc. | In vivo copper-free click chemistry for delivery of therapeutic and/or diagnostic agents |
| CA2675202C (en) * | 2007-01-11 | 2014-09-16 | Immunomedics, Inc. | Methods and compositions for improved f-18 labeling of proteins, peptides and other molecules |
| IN2012DN03177A (enExample) * | 2009-12-04 | 2015-09-25 | Immunomedics Inc |
-
2010
- 2010-12-02 IN IN3177DEN2012 patent/IN2012DN03177A/en unknown
- 2010-12-02 CA CA2782223A patent/CA2782223A1/en not_active Abandoned
- 2010-12-02 WO PCT/US2010/058724 patent/WO2011068965A1/en not_active Ceased
- 2010-12-02 JP JP2012542186A patent/JP5789821B2/ja active Active
- 2010-12-02 CN CN201080052555.0A patent/CN102666567B/zh active Active
- 2010-12-02 AU AU2010326004A patent/AU2010326004B2/en active Active
- 2010-12-02 EP EP10835120.6A patent/EP2507254A4/en not_active Withdrawn
- 2010-12-02 US US12/958,889 patent/US8202509B2/en active Active
-
2012
- 2012-05-17 US US13/474,260 patent/US8444956B2/en active Active
-
2013
- 2013-03-26 US US13/850,591 patent/US8617518B2/en active Active
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20050112060A1 (en) * | 2000-06-20 | 2005-05-26 | Idec Pharmaceuticals Corporation | Treatment of B-cell associated diseases such as malignancies and autoimmune diseases using a cold anti-CD20 antibody/radiolabeled anti-CD22 antibody combination |
| US20080253964A1 (en) * | 2007-01-11 | 2008-10-16 | Immunomedics, Inc. | Methods and Compositions for F-18 Labeling of Proteins, Peptides and Other Molecules |
| US20090246130A1 (en) * | 2007-01-11 | 2009-10-01 | Immunomedics, Inc. | Methods and Compositions for F-18 Labeling of Proteins, Peptides and Other Molecules |
| US20090299033A1 (en) * | 2007-01-11 | 2009-12-03 | Immunomedics, Inc. | Methods and Compositions for F-18 Labeling of Proteins, Peptides and Other Molecules |
Non-Patent Citations (1)
| Title |
|---|
| See also references of EP2507254A4 * |
Cited By (17)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN103370063A (zh) * | 2010-12-13 | 2013-10-23 | 免疫医疗公司 | 用于改善蛋白质、肽和其他分子的f-18标记的方法和组合物 |
| WO2013110615A1 (en) | 2012-01-23 | 2013-08-01 | Ge Healthcare Limited | Radiofluorination method |
| US11135322B2 (en) | 2012-01-23 | 2021-10-05 | Ge Healthcare Limited | Radiofluorination method |
| CN102675329A (zh) * | 2012-06-05 | 2012-09-19 | 浙江大学 | 一种正电子发射断层显像剂及其制备方法 |
| CN102675329B (zh) * | 2012-06-05 | 2014-12-24 | 浙江大学 | 一种正电子发射断层显像剂及其制备方法 |
| KR102069104B1 (ko) * | 2012-11-30 | 2020-01-22 | 고쿠리츠 다이가쿠 호진 교토 다이가쿠 | 폴리펩티드 및 이미징 방법 |
| EP2927239A4 (en) * | 2012-11-30 | 2016-07-13 | Univ Kyoto | POLYPEPTIDE AND ILLUSTRATIVE PROCESS |
| JPWO2014084372A1 (ja) * | 2012-11-30 | 2017-01-05 | 国立大学法人京都大学 | ポリペプチド及びイメージング方法 |
| US9950083B2 (en) | 2012-11-30 | 2018-04-24 | Kyoto University | Polypeptide and imaging method |
| KR20150102000A (ko) * | 2012-11-30 | 2015-09-04 | 고쿠리츠 다이가쿠 호진 교토 다이가쿠 | 폴리펩티드 및 이미징 방법 |
| WO2014084372A1 (ja) * | 2012-11-30 | 2014-06-05 | 国立大学法人京都大学 | ポリペプチド及びイメージング方法 |
| US11103604B2 (en) | 2013-05-03 | 2021-08-31 | Ge Healthcare Uk Limited | Metal complexes and fluorination thereof |
| WO2017007807A1 (en) * | 2015-07-07 | 2017-01-12 | Immunomedics, Inc. | IMPROVED METHODS OF IMAGING WITH Ga-68 LABELED MOLECULES |
| WO2017070752A1 (en) * | 2015-10-29 | 2017-05-04 | The University Of Queensland | Imaging agents |
| CN107312070A (zh) * | 2017-05-03 | 2017-11-03 | 厦门大学附属第医院 | 一种18f标记的pet多肽探针及其制备方法 |
| US12144875B2 (en) | 2018-06-01 | 2024-11-19 | Tayu Huaxia Biotech Medical Group Co., Ltd. | Compositions and methods for imaging |
| WO2024238987A3 (en) * | 2023-05-18 | 2025-04-03 | The Regents Of The University Of California | Labeled oligosaccharides and methods of use |
Also Published As
| Publication number | Publication date |
|---|---|
| EP2507254A4 (en) | 2013-12-04 |
| US8202509B2 (en) | 2012-06-19 |
| JP2013512918A (ja) | 2013-04-18 |
| US8617518B2 (en) | 2013-12-31 |
| CN102666567B (zh) | 2015-08-26 |
| IN2012DN03177A (enExample) | 2015-09-25 |
| EP2507254A1 (en) | 2012-10-10 |
| US20130211044A1 (en) | 2013-08-15 |
| JP5789821B2 (ja) | 2015-10-07 |
| AU2010326004A1 (en) | 2012-05-17 |
| CN102666567A (zh) | 2012-09-12 |
| US8444956B2 (en) | 2013-05-21 |
| US20110110854A1 (en) | 2011-05-12 |
| CA2782223A1 (en) | 2011-06-09 |
| US20120282178A1 (en) | 2012-11-08 |
| AU2010326004B2 (en) | 2016-04-21 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US8617518B2 (en) | Methods and compositions for improved F-18 labeling of proteins, peptides and other molecules | |
| AU2009242641B2 (en) | Improved methods and compositions for F-18 labeling of proteins, peptides and other molecules | |
| US9028800B2 (en) | Methods and compositions for improved F-18 labeling of proteins, peptides and other molecules | |
| AU2011344110B2 (en) | Methods and compositions for improved F-18 labeling of proteins, peptides and other molecules | |
| US8808665B2 (en) | In vivo copper-free click chemistry for delivery of therapeutic and/or diagnostic agents | |
| US8709382B2 (en) | Methods and compositions for improved F-18 labeling of proteins, peptides and other molecules | |
| US9115172B2 (en) | Methods and compositions for improved F-18 labeling of proteins, peptides and other molecules | |
| US8153100B2 (en) | Methods and compositions for F-18 labeling of proteins, peptides and other molecules | |
| AU2011336396B2 (en) | In vivo copper-free click chemistry for delivery of therapeutic and/or diagnostic agents |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 201080052555.0 Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 10835120 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 3177/DELNP/2012 Country of ref document: IN |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2010326004 Country of ref document: AU |
|
| ENP | Entry into the national phase |
Ref document number: 2010326004 Country of ref document: AU Date of ref document: 20101202 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2012542186 Country of ref document: JP |
|
| ENP | Entry into the national phase |
Ref document number: 2782223 Country of ref document: CA |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2010835120 Country of ref document: EP |