WO2011052799A1 - Compositions and methods for treating inflammatory disorders - Google Patents

Compositions and methods for treating inflammatory disorders Download PDF

Info

Publication number
WO2011052799A1
WO2011052799A1 PCT/JP2010/069653 JP2010069653W WO2011052799A1 WO 2011052799 A1 WO2011052799 A1 WO 2011052799A1 JP 2010069653 W JP2010069653 W JP 2010069653W WO 2011052799 A1 WO2011052799 A1 WO 2011052799A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
fkn
binding fragment
seq
amino acid
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/JP2010/069653
Other languages
English (en)
French (fr)
Inventor
Miyuki Nishimura
Yoshimasa Sakamoto
Tetsu Kawano
Toshio Imai
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Eisai R&D Management Co Ltd
Original Assignee
Eisai R&D Management Co Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=43922220&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2011052799(A1) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority to US13/504,742 priority Critical patent/US8932592B2/en
Priority to UAA201206559A priority patent/UA105073C2/uk
Priority to AU2010312408A priority patent/AU2010312408B2/en
Priority to NZ599779A priority patent/NZ599779A/en
Priority to LTEP10826929.1T priority patent/LT2493930T/lt
Priority to RU2012122203/10A priority patent/RU2569109C2/ru
Priority to DK10826929.1T priority patent/DK2493930T3/en
Priority to SM20180637T priority patent/SMT201800637T1/it
Priority to CA2778895A priority patent/CA2778895C/en
Priority to PL10826929T priority patent/PL2493930T3/pl
Priority to EP10826929.1A priority patent/EP2493930B1/en
Priority to CN201080049138.0A priority patent/CN102597003B/zh
Priority to BR112012010266A priority patent/BR112012010266A2/pt
Priority to SI201031803T priority patent/SI2493930T1/sl
Priority to ES10826929T priority patent/ES2698389T3/es
Priority to KR1020167014386A priority patent/KR102099596B1/ko
Priority to RS20181424A priority patent/RS58142B1/sr
Priority to MX2012005052A priority patent/MX2012005052A/es
Priority to PH1/2012/500828A priority patent/PH12012500828A1/en
Priority to JP2012520621A priority patent/JP5631991B2/ja
Priority to HRP20181973TT priority patent/HRP20181973T1/hr
Application filed by Eisai R&D Management Co Ltd filed Critical Eisai R&D Management Co Ltd
Publication of WO2011052799A1 publication Critical patent/WO2011052799A1/en
Priority to ZA2012/03002A priority patent/ZA201203002B/en
Priority to IL219470A priority patent/IL219470A/en
Anticipated expiration legal-status Critical
Priority to CY20181101274T priority patent/CY1121167T1/el
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/24Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/04Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/16Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/02Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/04Centrally acting analgesics, e.g. opioids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/46Hybrid immunoglobulins
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding

Definitions

  • the present invention features compositions and methods related to antibodies that bind fractalkine.
  • Fractalkine is a transmembrane chemokine that is expressed on the surface of activated endothelial cells and binds to the CX3CR1 receptor.
  • the binding of membrane-bound FKN to membrane-bound CX3CR1 mediates strong cell-cell adhesion without the involvement of selectins or integrins.
  • Secreted FKN which is shed from membrane-bound FKN, also binds to CX3CR1 and induces the activation of integrin and cell chemotaxis.
  • FKN FKN-induced on the surface of endothelial cells
  • cytokines proinflammatory cytokines.
  • the elevated expression of FKN and the accumulation of CX3CR1 + cytotoxic effector lymphocytes and macrophages have been reported in subjects with numerous disorders, including inflammatory and autoimmune disorders, including ulcerative colitis (UC), Crohn's disease (CD), rheumatoid arthritis (RA), autoimmune hepatitis (AIH), multiple sclerosis (MS), and diabetes mellitus.
  • UC ulcerative colitis
  • CD Crohn's disease
  • RA rheumatoid arthritis
  • AIH autoimmune hepatitis
  • MS multiple sclerosis
  • diabetes mellitus UC
  • Umehara et al., Arterioscler. Thromb. Vase. Biol. 24:34-40 describes the role of FKN in atherosclerosis and vascular injury.
  • Nishimura et al., Ann. NY Acad. Sci. 1 173:350-356 discusses FKN as a potential
  • Antibodies and FKN-binding fragments of antibodies are desirable therapeutic agents because of their specificity. Antibodies and FKN-binding fragments may be used to target specific cells or tissues, thereby minimizing the potential side effects of non-specific targeting. There is a need to identify and characterize therapeutic antibodies useful in the treatment of inflammatory disorders, including those that are described herein. Summary of the Invention
  • the invention features an anti-FKN antibody or FKN-binding fragment thereof, wherein the antibody or fragment thereof includes six CDRs selected from:
  • the antibody may be an intact antibody.
  • the antibody is a humanized antibody.
  • the heavy chain variable domain of the humanized antibody may include the amino acid sequence of SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 39, SEQ ID NO: 42, or SEQ ID NO: 43
  • the light chain variable domain of the humanized antibody may include the amino acid sequence of SEQ ID NO: 38, SEQ ID NO: 44, or SEQ ID NO: 45.
  • the antibody is an anti-fractalkine antibody or FKN-binding fragment thereof, wherein the antibody or fragment thereof includes a heavy chain with the amino acid sequence of SEQ ID NO: 37 and a light chain with the amino acid sequence of SEQ ID NO: 44.
  • the antibody may also be a chimeric antibody.
  • the heavy chain variable domain of the chimeric antibody includes the amino acid sequence of SEQ ID NO: 26, and the light chain variable domain of the chimeric antibody includes the amino acid sequence of SEQ ID NO: 27.
  • FKN-binding fragments of an antibody are also contemplated.
  • the FKN-binding fragment may be a Fab, Fab', F(ab')2, or Fv fragment that retains the binding specificity to FKN.
  • the constant region is of the IgG isotype (e.g., the IgG2 isotype).
  • the antibody or FKN-binding fragment includes a mutated Fc region such that the antibody has reduced ADCC and/or complement activation relative to the Fc region lacking the mutation.
  • the Fc region may be mutated at one or more of amino acid residues V234, G237, C 131 , or C219.
  • the antibody or FKN-binding fragment substantially reduces or inhibits binding of FKN to its receptor, CX3CR1, by at least 50%, 60%, 70%, 80%, 90%, or greater, or substantially inhibits neutralized hFKN in a chemotaxis assay such as the one described herein.
  • the invention also features a pharmaceutical composition that includes the antibody or FKN-binding fragment of the present invention and a pharmaceutically acceptable carrier or excipient.
  • the composition includes one or more additional therapeutic agents, such as those described below.
  • nucleic acid encoding and antibody or FKN-binding fragment described above.
  • the nucleic acid encodes all or a portion of the heavy chain of the antibody or FKN-binding fragment thereof.
  • nucleic acid encodes all or a portion of the light chain of the antibody or
  • the nucleic acid may be in a vector (e.g., an expression vector).
  • the invention also features a host cell that includes one or more vectors of the invention.
  • the host cell includes two vectors, the first vector including a nucleic acid encoding a heavy chain and the second vector including a nucleic acid encoding a light chain of an antibody or FKN-binding fragment described herein.
  • the expression of the heavy and light chain in the host cell produces an antibody or FKN- binding fragment.
  • the host cell is prokaryotic.
  • the host cell is eukaryotic.
  • Exemplary mammalian cells useful for producing antibodies and FKN-binding fragments are CHO cells and NSO cells.
  • the invention also features a method for making an anti-FKN antibody or FKN- binding fragment thereof.
  • the method includes (a) expressing a vector of the invention in a suitable host cell, and (b) recovering the antibody.
  • the antibody or FKN-binding fragment may be secreted by the host cell into culture media.
  • the antibody or FKN-binding fragment thereof is purified to remove at least 95% or greater purity of the non-antibody marterials.
  • inflammatory disorders are inflammatory bowel disease, Crohn's disease, and ulcerative colitis.
  • the method may further include administering one or more additional therapeutic agents.
  • exemplary therapeutic agents are opiates, 5-aminosalicylic acid, 6-mercaptopurine, azathioprine, glucocorticoids, methotrexate, cyclosporine, and metronidazole. Other suitable therapeutic agents are described below.
  • Inflammatory disorders that may be treated by administering an effective amount of an anti-FKN antibody or FKN-binding fragment in accordance with the invention also include autoimmune hepatobiliary diseases (e.g., autoimmune hepatitis, primary biliary cirrhosis, or primary sclerosing cholangitis).
  • the method may further include administering 6-mercaptopurine, ursodeoxycholic acid, azathioprine, a glucocorticoid, a thiazide diuretic, an anti-aldosterone diuretic, cyclosporine, albumin, or spironolactone.
  • Rheumatoid arthritis may also be treated by administering an effective amount of an anti-FKN antibody or FKN-binding fragment in accordance with the invention.
  • the method may further include administering a nonsteroidal anti-inflammatory drug (NSAID), methotrexate, leflunomide, bucillamine, 5- aminosalicylic acid, a glucocorticoid, hydrochloroquine, vitamin D, calcium, or alendronate.
  • NSAID nonsteroidal anti-inflammatory drug
  • Systemic lupus erythematosus may also be treated by administering an effective amount of an anti-FKN antibody or FKN-binding fragment, either alone or in combination with one or more additional therapeutic agents.
  • additional therapeutic agents are those that are associated with the central nervous system or lupus nephritis.
  • glucocorticoids cyclophosphamide, methotrexate, cyclosporine, and tacrolimus.
  • Multiple sclerosis and neuromyelitis optica may also be treated by administering an effective amount of an anti-FKN antibody or FKN-binding fragment. Treatment may further include administering one or more additional therapeutic agents, such as a glucocorticoid, interferon- ⁇ , or Copaxone ® .
  • Demyelinating polyradiculopathy e.g., Guillain-Barre syndrome or chronic inflammatory demyelinating polyradiculopathy
  • Demyelinating polyradiculopathy may also be treated by administering an effective amount of an anti-FKN antibody or FKN-binding fragment.
  • cotherapy is also contemplated, and treatment may further include administering one or more additional therapeutic agents, such as a glucocorticoid or an intravenous immunoglobulin.
  • Administering an effective amount of an anti-FKN antibody or FKN-binding fragment may also be useful for the treatment of neuropathic pain, either alone or in combination with an additional therapeutic agent.
  • additional agents for the treatment of neuropathic pain are lamotrigine, topiramate, oxcarbazepine, levetiracetam, fentanyl, tramadol, capsaicin, cloridine, an NSAID, amitriptyline, pregabalin, lidocaine, duloxetine, and carbamazepine.
  • Alzheimer's disease may also be treated by administering an effective amount of an anti-FKN antibody or FKN-binding fragment.
  • the method may further include administering one or more additional therapeutic agents, such as tacrine hydrochloride, donepezil hydrochloride, rivastigmine tartrate, galantamine hydrobromide, memantine hydrochloride, paroxetine, risperidone, quetiapine, or perospirone.
  • additional therapeutic agents such as tacrine hydrochloride, donepezil hydrochloride, rivastigmine tartrate, galantamine hydrobromide, memantine hydrochloride, paroxetine, risperidone, quetiapine, or perospirone.
  • Visceral pain associated with cancer may also be treated by administering an effective amount of an anti-FKN antibody or FKN-binding fragment, either alone or in combination with one or more additional therapeutic agents, such as morphine, an
  • Atherosclerosis may also be treated by administering an effective amount of an anti-FKN antibody or FKN-binding fragment.
  • the method may further include administering one or more additional therapeutic agents, such as prostacyclin, aspirin, clopidogrel, ticlopidine, limaprost, prostaglandin El, an HMG CoA reductase inhibitor, bezafibrate, lidocaine, mexiletine, a diuretic, digitalis, dopamine, a ⁇ -adrenergic receptor agonist, isosorbide dinitrate, nitroglycerin, a natriuretic peptide, warfarin, heparin, tissue plasminogen activator, urokinase, or procainamide.
  • additional therapeutic agents such as prostacyclin, aspirin, clopidogrel, ticlopidine, limaprost, prostaglandin El, an HMG CoA reductase inhibitor, bezafi
  • Vasculopathies may also be treated by administering an effective amount of an anti-FKN antibody or FKN-binding fragment in accordance with the invention.
  • the method may further include administering one or more additional therapeutic agents selected from glucocorticoids, cyclophosphamide, pegaptanib, ranibizumab, NSAIDs, colchicine, chlorambucil, thalidomide, and verteporfin.
  • Nephropathies e.g., lupus nephritis, glomerulonephritis, or diabetic nephropathy
  • Glucocorticoids sulfonylurea, cyclophosphamide, glinides, cyclosporine, tacrolimus, mycophenolate mofetil, mizoribine, diuretics, insulin, biguanide, a-glucosidase inhibitors, angiotensin receptor blockers, thiazolidinedione, angiotensin converting enzyme (ACE) inhibitors, calcium channel blockers, or ⁇ -adrenergic receptor inhibitors may be included in the treatment methods, adrenergic receptor inhibitors may be included in the treatment methods.
  • ACE angiotensin converting enzyme
  • the invention also relates to the use of an anti-FKN antibody or FKN-binding fragment in accordance with the invention in the treatment of any of the inflammatory disorders described herein.
  • the invention also relates to the use of an anti-FKN antibody or FKN-binding fragment in accordance with the invention in the preparation of a medicament for the treatment of any of the inflammatory disorders described herein.
  • the invention also features a method of inhibiting the recruitment of leukocytes to an inflammation site in a subject by administering an effective amount of an anti-FKN antibody or FKN-binding fragment to a subject in need of such treatment, whereby the recruitment of leukocytes to an inflammation site is inhibited.
  • Ex vivo strategies involve transfecting or transducing cells obtained from the subject with a polynucleotide encoding an antibody or antibody fragment. The transfected or transduced cells are then returned to the subject.
  • the cells can be any of a wide range of types including, without limitation, hemopoietic cells (e.g., bone marrow cells, macrophages, monocytes, dendritic cells, T cells, or B cells), fibroblasts, epithelial cells, endothelial cells, keratinocytes, or muscle cells.
  • hemopoietic cells e.g., bone marrow cells, macrophages, monocytes, dendritic cells, T cells, or B cells
  • fibroblasts e.g., epithelial cells, endothelial cells, keratinocytes, or muscle cells.
  • antibody includes intact monoclonal and polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments that exhibit the desired biological activity (e.g., the ability to bind FKN and modulate the interaction between FKN and CX3CR1 ).
  • “Intact antibodies” are heterotetrameric glycoproteins of about 150,000 Daltons, composed of two identical light (L) chains and two identical heavy (H) chains. Each light chain is linked to a heavy chain by one covalent disulfide bond, while the number of disulfide linkages varies among the heavy chains of different immunoglobulin isotypes.
  • Each heavy and light chain also has regularly spaced intrachain disulfide bridges.
  • Each heavy chain has at one end a variable domain (VH) followed by a number of constant domains.
  • Each light chain has a variable domain at one end (VL) and a constant domain at its other end.
  • the constant domain of the light chain is aligned with the first constant domain of the heavy chain, and the light chain variable domain is aligned with the variable domain of the heavy chain. Particular amino acid residues are believed to form an interface between the light chain and heavy chain variable domains.
  • immunoglobulins There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), e.g., IgGi, IgG 2 , IgG 3 , IgG 4 , IgA ls and IgA 2 .
  • An antibody may be part of a larger fusion molecule, formed by covalent or non-covalent association of the antibody with one or more other proteins or peptides.
  • An antibody may also be part of an immunoconjugate, wherein the antibody is conjugated to a second molecule (e.g., a toxin, radioisotope, or label.)
  • the term "monoclonal antibody,” as used herein, refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies are identical except for possible mutations that may be present in minor amounts.
  • “Humanized” forms of non-human antibodies are antibodies or fragments thereof that contain a framework region (FR) having substantially the amino acid sequence of a human immunoglobulin and a complementarity determining region (CDR) having substantially the amino acid sequence of a non-human immunoglobulin (i.e., the "import" sequence).
  • framework region residues of the human immunoglobulin are replaced by corresponding non-human residues. Further modifications of the humanized antibody may be made to refine antibody performance.
  • CDR complementarity determining region
  • framework region or "FR” is meant the sequences of amino acids located on either side of the three CDRs of the immunoglobulin light and heavy chains.
  • the FRs and CDRs of a humanized antibody need not correspond precisely to the parental sequences, e.g., the import CDR or the consensus FR may be mutagenized by substitution, insertion, or deletion of at least one residue so that the CDR or FR residue at that site does not correspond to either the consensus or the import sequence. Such mutations, however, will generally not be extensive. Usually, at least 75%, 80%, 85%, 90%, 95%, or 99% of the humanized antibody residues will correspond to the residues of the parental sequences.
  • an amount sufficient or “effective amount” is meant the amount of a therapeutic antibody or pharmaceutical composition thereof required to treat or ameliorate a disorder, such as an inflammatory disorder, in a clinically relevant manner.
  • a sufficient amount of a therapeutic anti- FKN antibody, FKN-binding fragment or pharmaceutical composition thereof used to practice the present invention for therapeutic treatment of, e.g., an inflammatory disorder varies depending upon the manner of administration, age, and general health of the patient.
  • Binding affinity generally refers to the strength of the sum total of noncovalent interactions between a single binding site of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen). Binding affinity can be represented by the dissociation constant (Kd). Affinity can be measured by methods known in the art, including radiolabeled FKN-binding assays (RIA) or by surface plasmon resonance assays (e.g., BIACORE ® ).
  • RIA radiolabeled FKN-binding assays
  • BIACORE ® surface plasmon resonance assay
  • Chimeric or “chimerized” antibodies refer to antibodies in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (Morrison et al., Proc. Natl. Acad.. Set U.S.A. 81:6851-6855, 1984).
  • epitope or "antigenic determinant” is meant a sequence of amino acids which, either as a result of linear structure or three-dimensional conformation, forms the binding site for an antibody.
  • a conformational epitope which may include discontinuous sections of an antigen's amino acid sequence, interacts with an antibody as a result of the tertiary structure of the epitope.
  • a linear epitope is an epitope that is recognized by antibodies based on its primary structure.
  • the epitope of fractalkine that forms the minimal interface with Fab includes, e.g., E66-Q69, W81- Q87, H70-F73, and H88-D90.
  • express and produce are used synonymously herein, and refer to the biosynthesis of a gene product. These terms encompass the transcription of a gene into RNA. These terms also encompass translation of RNA into one or more polypeptides, and further encompass all naturally occurring post-transcriptional and post-translational modifications.
  • the expression/production of an antibody can be within the cytoplasm of the cell, and/or into the extracellular milieu such as the growth medium of a cell culture.
  • FKN FK
  • neutralactin a polypeptide that is homologous to the polypeptide defined by SEQ ID NO: 1 ( Figure 1) and that has FKN biological activity (e.g., binds to the CX3CR1 receptor; chemoattracts T cells and monocytes; or promotes adhesion of leukocytes to activated endothelial cells).
  • FKN biological activity e.g., binds to the CX3CR1 receptor; chemoattracts T cells and monocytes; or promotes adhesion of leukocytes to activated endothelial cells.
  • the biological activity of a FKN polypeptide may be assayed using any standard method.
  • FKN also includes any FKN family member or isoform. See, e.g., U.S.
  • FKN-binding fragment includes a portion of an intact antibody, comprising the FKN-binding region thereof and capable of binding FKN.
  • FKN-binding fragments can be Fab, Fab', F(ab') 2 , or Fv fragments; diabodies; triabodies; tetrabodies;
  • miniantibodies Affibody molecules; minibodies; linear antibodies; single-chain antibody molecules; or multispecific antibodies formed from antibody fragments.
  • homologous is meant any gene or protein sequence that bears at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 99% or more homology to a known gene or protein sequence over the length of the comparison sequence.
  • a “homologous” protein can also have at least one biological activity of the comparison protein.
  • the length of comparison sequences will generally be at least 15, 20, 25, 35 or more amino acids.
  • nucleic acids the length of comparison sequences will generally be at least 50, 60, 75, 100, 125 or more nucleotides.
  • Homology can also refer to a
  • homology refers to a similarity sufficient to elicit the production of antibodies that can specifically recognize the protein at issue.
  • Human antibody means that the antibody is either solely from human origin or any antibody in which the variable and constant domain sequences are human sequences or sequences of human antibodies.
  • the term encompasses antibodies with sequences derived from (i.e., that utilize) human genes, but which have been changed, e.g., to decrease possible immunogenicity, increase affinity, eliminate cysteines that may cause undesirable folding, etc.
  • the term encompasses such antibodies produced recombinantly in non-human cells, which may impart glycosylation not typical of human cells.
  • Hybridoma refers to the product of a cell-fusion between a cultured neoplastic lymphocyte and a primed B- or T-lymphocyte, which expresses the specific immune potential of the parent cell.
  • an "inflammatory disorder” as used herein refers to any disease, disorder, or condition in which the immune system is abnormally activated.
  • the inflammatory disorder may be, e.g., ulcerative colitis, Crohn's disease, inflammatory bowel disease, rheumatoid arthritis, myositis, multiple sclerosis, neuromyelitis optica, atherosclerosis, psoriasis, systemic lupus erythematosus (e.g., lupus of the central nervous system or lupus nephritis), nephritis, glomerulonephritis, autoimmune hepatobiliary disease (e.g., autoimmune hepatitis, primary biliary cirrhosis, or primary sclerosing cholangitis), graft- versus-host disease, atopic dermatitis, asthma, neurodegenerative disease (e.g., Alzheimer's disease), demyelinating polyradiculopathy (
  • the disease, disorder, or condition is a disease of the upper or lower respiratory tract, for example, lymphomatous tracheobronchitis; allergic hypersensitivity or a hypersecretion condition, such as chronic bronchitis and cystic fibrosis; pulmonary fibrosis of various etiologies (e.g., idiopathic pulmonary fibrosis); chronic obstructive pulmonary disease (COPD); sarcoidosis; allergic and non-allergic rhinitis; allergic or non-allergic urticaria; a skin-related disease characterized by deregulated inflammation, tissue remodeling, angiogenesis, and neoplasm; a disease of the gastrointestinal tract, such as Hirschsprung's disease, diarrhea, malabsorption conditions, and inflammatory conditions; a disorder of the central and peripheral nervous system, such as depression, anxiety states, Parkinson's disease, migraine and other forms of cranial pain, strokes, and emesis; a disease of the immune system, such as in the splenic and
  • inflammatory disorders are acne vulgaris; acute
  • sarcoidosis scleroderma
  • septic shock syndrome shoulder tendinitis or bursitis
  • transplant-rejection-related syndromes tuberculosis; type-1 diabetes; vasculitis; Vogt- Koyanagi-Harada (VKH) disease; and Wegener's granulomatosis.
  • Isolated or purified means altered “by the hand of man” from the natural state. If a molecule or composition occurs in nature, it has been “isolated” or “purified” if it has been changed or removed from its original environment, or both. For example, a polynucleotide or a polypeptide naturally present in a living plant or animal is not “isolated” or “purified,” but the same polynucleotide or polypeptide separated from the coexisting materials of its natural state is “isolated” or “purified” as the term is employed herein.
  • operably linked means that the regulatory sequences necessary for expression of the coding sequence are placed in a nucleic acid molecule in the appropriate positions relative to the coding sequence so as to enable expression of the coding sequence.
  • a promoter is operably linked with a coding sequence when the promoter is capable of controlling the transcription or expression of that coding sequence.
  • Coding sequences can be operably linked to promoters or regulatory sequences in a sense or antisense orientation.
  • “operably linked” is sometimes applied to the arrangement of other transcription control elements (e.g., enhancers) in an expression vector.
  • “Polynucleotide,” synonymously referred to as “nucleic acid molecule,” refers to any polyribonucleotide or polydeoxyribonucleotide, which may be unmodified RNA or DNA or modified RNA or DNA.
  • Polynucleotides include, without limitation, single- and double-stranded DNA, DNA that is a mixture of single- and double-stranded regions, single- and double-stranded RNA, and RNA that is mixture of single- and double- stranded regions, hybrid molecules comprising DNA and RNA that may be single- stranded, or, more typically, double-stranded or a mixture of single- and double-stranded regions.
  • polynucleotide refers to triple-stranded regions comprising RNA or DNA or both RNA and DNA.
  • the term polynucleotide also includes DNAs or RNAs containing one or more modified bases and DNAs or RNAs with backbones modified for stability or for other reasons.
  • Modified bases include, for example, tritylated bases and unusual bases such as inosine.
  • polynucleotide embraces chemically, enzymatically, or metabolically modified forms of polynucleotides as typically found in nature, as well as the chemical forms of DNA and RNA characteristic of viruses and cells.
  • Polynucleotide also embraces relatively short nucleic acid chains, often referred to as oligonucleotides.
  • Polypeptide refers to both short chains, commonly referred to as peptides, oligopeptides or oligomers, and to longer chains, generally referred to as proteins.
  • Polypeptides may contain amino acids other than the 20 gene-encoded amino acids.
  • Polypeptides include amino acid sequences modified either by natural processes, such as post-translational processing, or by chemical modification techniques which are well known in the art. Such modifications are well described in basic texts and in more detailed monographs, as well as in a voluminous research literature. Modifications can occur anywhere in a polypeptide, including the peptide backbone, the amino acid side- chains, and the amino or carboxyl termini. It will be appreciated that the same type of modification may be present in the same or varying degrees at several sites in a given polypeptide. Also, a given polypeptide may contain many types of modifications.
  • Polypeptides may be branched as a result of ubiquitination, and they may be cyclic, with or without branching. Cyclic, branched and branched cyclic polypeptides may result from natural posttranslational processes or may be made by synthetic methods.
  • Modifications include, e.g., acetylation, acylation, ADP-ribosylation, amidation, covalent attachment of flavin, covalent attachment of a heme moiety, covalent attachment of a nucleotide or nucleotide derivative, covalent attachment of a lipid or lipid derivative, covalent attachment of phosphotidylinositol, cross-linking, cyclization, disulfide bond formation, demethylation, formation of covalent cross-links, formation of cystine, formation of pyroglutamate, formylation, gamma-carboxylation, glycosylation, GPI anchor formation, hydroxylation, iodination, methylation, myristoylation, oxidation, proteolytic processing, phosphorylation, prenylation, racemization, selenoylation, sulfation, and transfer-RNA mediated addition of amino acids to proteins such as arginylation, and ubiquitination.
  • telomere binding By “specifically binds” is meant an antibody or fragment thereof recognizes and binds an antigen (e.g., FKN or a fragment thereof), but that does not substantially recognize and bind other molecules in a sample (e.g., a biological sample).
  • an antigen e.g., FKN or a fragment thereof
  • Specifically is meant to distinguish the low-level, non-specific stickiness that can sometimes occur between random proteins, e.g., with exposed hydrophilic domains. It is not meant to imply that the antibody will not bind to any protein other than antigen of the invention. Antibodies could cross-react (and “bind specifically") with any protein that includes the relevant epitope.
  • subject is meant any animal, e.g., a mammal (e.g., a human).
  • a subject who is being treated for, e.g., an inflammatory disorder is one who has been diagnosed by a medical or veterinary practitioner as the case may be as having such a condition. Diagnosis may be performed by any suitable means.
  • subjects of the invention may have been subjected to standard tests or may have been identified, without examination, as one at high risk due to the presence of one or more risk factors, such as age, genetics, or family history.
  • a cell has been "transformed” or “transfected” by exogenous or heterologous nucleic acids such as DNA when such DNA has been introduced inside the cell.
  • the transforming DNA may or may not be integrated (e.g., covalently linked) into the genome of the cell.
  • the transforming DNA may be maintained on an episomal element such as a plasmid.
  • a stably transformed cell, or “stable cell” is one in which the transforming DNA has become integrated into a chromosome so that it is inherited by daughter cells through chromosome replication.
  • a "clone” is a population of cells derived from a single cell or common ancestor by mitosis.
  • a "cell line” is a clone of a primary cell that is capable of stable growth in vitro for many generations.
  • treating is meant administering a therapeutic antibody or a pharmaceutical composition thereof for prophylactic and/or therapeutic purposes.
  • treating a disease or disorder or use for “therapeutic treatment” refers to administering treatment to a subject already suffering from a disease to improve the subject's condition.
  • the subject may be diagnosed with an inflammatory disorder based on identification of any of the
  • prevent a disease or disorder refers to prophylactic treatment of a subject who is not yet ill, but who is susceptible to, or otherwise at risk of, developing a particular disease.
  • a subject is determined to be at risk of developing an inflammatory disorder using the diagnostic methods known in the art.
  • a “vector” is a replicon, such as plasmid, phage, cosmid, or virus in which another nucleic acid segment may be operably inserted so as to bring about the replication or expression of the segment.
  • a replicon such as plasmid, phage, cosmid, or virus in which another nucleic acid segment may be operably inserted so as to bring about the replication or expression of the segment.
  • Figure 1 is the amino acid sequence of human FKN.
  • Figure 2 is a table showing the binding characteristics (i.e., neutralizing activity, binding affinity, and species cross-reactivity) of anti-FKN monoclonal antibodies.
  • Figure 3 is an alignment of the heavy chain variable regions of the humanized anti-FKN mAb sequences (SEQ ID NOS 36-37 and 42-43, respectively, in order of appearance), the m3A5-2 sequence (SEQ ID NO: 26), the germline Ig sequence (SEQ ID NO: 40), and the AAA68427.1 sequence (SEQ ID NO: 34).
  • Figure 4 is an alignment of the light chain variable regions of the humanized anti- FKN mAb sequences (SEQ ID NOS 38 and 44-45, respectively, in order of appearance), the m3A5-2 sequence (SEQ ID NO: 27), the germline Ig sequence (SEQ ID NO: 41), and the ABU90602.1 sequence (SEQ ID NO: 35).
  • Figure 5 is a table summarizing the results from three independent chemotaxis assays.
  • the neutralizing activities of humanized anti-hFKN mAbs were analyzed using a chemotaxis assay. All combinations of H3 and H3-2 with L2 and L4 were successfully humanized, as these mAbs showed similar neutralizing activity with the chimeric mAb. However, HK2, which was made by using narrowed key residues, showed decreased neutralizing activity in combination with L2 or L4.
  • Figures 6A and 6B depict a series of graphs showing the neutralizing activities of m3A5-2 mAb and chimeric mAb.
  • Figure 6A is a graph showing the neutralizing activity of m3A5-2 mAb as determined by a chemotaxis assay.
  • Figure 6B is a graph showing the neutralizing activity of the chimeric mAb as determined by a chemotaxis assay.
  • Figures 7A-7D depict a series of graphs showing the neutralizing activities of humanized anti-hFKN antibodies as determined by a chemotaxis assay.
  • Figure 7A shows the neutralizing activity of H3L2-IgG2.
  • Figure 7B shows the neutralizing activity of H3- L4-IgG2.
  • Figure 7C shows the neutralizing activity of HK2L2-IgG2.
  • Figure 7D shows the neutralizing activity of HK2L4-IgG2.
  • Figures 8A-8F depict a series of graphs showing the neutralizing activities of humanized anti-hFKN antibodies as determined by a chemotaxis assay.
  • Figure 8A shows the neutralizing activity of H3-2L2-IgG2.
  • Figure 8B shows the neutralizing activity of H3-2L4-IgG2.
  • Figure 8C shows the neutralizing activity of H3-2L5-IgG2.
  • Figure 8D shows the neutralizing activity of F£K3L2-IgG2.
  • Figure 8E shows the neutralizing activity of HK3L4-IgG2.
  • Figure 8F shows the neutralizing activity of HK3L5-IgG2.
  • Figure 9 is a table summarizing the results from BIACORE ® assays used to measure binding affinity of the mAbs to hFKN and cynomolgus monkey FKN.
  • Figures 1 OA- IOC depict a series of graphs showing the binding affinities of the chimeric and humanized anti-hFKN antibodies (H3L2, H3-2L2, H3L4, H3-2L4, and HK2L4) to hFKN-SEAP and cynomolgus monkey FKN-SEAP as determined by a BIACORE ® assay.
  • Figure 10A is a bar graph showing the Ka values (1/Ms).
  • Figure 10B is a bar graph showing the Kd values (1/s).
  • Figure IOC is a bar graph showing the KD values (M).
  • Figure 11 depicts the results of epitope mapping using libraries of overlapping synthetic peptides (SEQ ID NOS 115-135, respectively, in order of appearance) from the FKN chemokine domain.
  • Figure 12 depicts the results of epitope mapping of hFKN using ELISA.
  • Figure 13 depicts the results of epitope mapping of hFKN using BIACORE ® .
  • Figure 14 shows the results of the cross saturation experiment to identify the Fab binding site on fractalkine. The plot shows that the E66-Q69, W81-Q87, H70-F73 and H88-D90 regions of FKN are included in the minimal interface with Fab.
  • humanized anti-FKN antibodies may be used to treat inflammatory disorders.
  • Such antibodies may also be used to inhibit the recruitment of leukocytes to an inflammation site.
  • Inflammatory disorders that can be treated according to the invention include ulcerative colitis, Crohn's disease, inflammatory bowel disease, rheumatoid arthritis, myositis, multiple sclerosis, neuromyelitis optica, atherosclerosis, psoriasis, systemic lupus erythematosus (e.g., lupus of the central nervous system or lupus nephritis), nephritis, glomerulonephritis, autoimmune hepatobiliary disease (e.g., autoimmune hepatitis, primary biliary cirrhosis, or primary sclerosing cholangitis), graft- versus-host disease, atopic dermatitis, asthma, neurodegenerative disease (e.g.,
  • Alzheimer's disease demyelinating polyradiculopathy (e.g., Guillain-Barre syndrome or chronic inflammatory demyelinating polyradiculopathy), neuropathic pain, visceral pain of cancer, atherosclerosis, age-related macular degeneration, diabetic nephropathy, sarcoidosis-edged uveitis, diabetes mellitus, lymphomatous tracheobronchitis, allergic hypersensitivity or a hypersecretion condition, such as chronic bronchitis and cystic fibrosis, pulmonary fibrosis of various etiologies (e.g., idiopathic pulmonary fibrosis), chronic obstructive pulmonary disease (COPD), sarcoidosis, allergic and non-allergic rhinitis, allergic or non-allergic urticaria, a skin-related disease characterized by deregulated inflammation, tissue remodeling, angiogenesis, and neoplasm, a disease of the gastrointestinal tract, such as Hirschsprung's disease
  • lymphomatous tracheobronchitis macular edema, myasthenia gravis, nonspecific fibrosing lung disease, osteoarthritis, pancreatitis, pemphigoid gestationis, pemphigus vulgaris, periodontitis, polyarteritis nodosa, polymyalgia rheumatica, pruritus scroti, pruritis/inflammation, psoriatic arthritis, pulmonary histoplasmosis, relapsing
  • polychondritis polychondritis, rosacea, sarcoidosis, scleroderma, septic shock syndrome, shoulder tendinitis or bursitis, Sjogren's syndrome, Still's disease, Sweet's disease, systemic sclerosis, Takayasu's arteritis, temporal arteritis, toxic epidermal necrolysis, transplant- rejection and transplant-rejection-related syndromes, tuberculosis, type-1 diabetes, vasculitis, Vogt-Koyanagi-Harada (VKH) disease, and Wegener's granulomatosis.
  • VKH Vogt-Koyanagi-Harada
  • Chimeric antibodies and methods to produce them are well known and established in the art.
  • the term "chimeric antibody” means an antibody, or FKN- binding fragment thereof, having at least some portion of at least one variable domain derived from the antibody amino acid sequence of a non-human mammal, a rodent, or a reptile, while the remaining portions of the antibody, or FK -binding fragment thereof, are derived from a human.
  • a chimeric antibody may comprise a mouse antigen binding domain with a human Fc or other such structural domain.
  • the invention encompasses humanized anti-FKN antibodies and FKN-binding fragments thereof that, for example, modulate the interaction between FKN and CX3CR1.
  • Humanization can be performed by means of the complementarity determining region (CDR)-grafting method (Kontermann and Diibel, Antibody Engineering, Springer Lab Manual (2001) and Tsurushita et al., Methods 36:69-83 (2005)). Humanization can be also performed following methods known in the art (see, e.g., Jones et al., Nature
  • Humanized antibodies are typically human antibodies in which some hypervariable region residues and possibly some FR residues are substituted by residues from analogous sites in non-human antibodies.
  • variable domains both light and heavy
  • sequence of the variable domain of a rodent antibody is screened against the entire library of known human variable-domain sequences.
  • the human sequence that is closest to that of the rodent is then accepted as the human framework for the humanized antibody.
  • Sims et al. J. Immunol. 151 :2296-2308 (1993) and Chothia et al., J. Mol. Biol. 196:901-917 (1987).
  • Another method uses a particular framework derived from the consensus sequence of all human antibodies of a particular subgroup of light or heavy chains. The same framework may be used for several different humanized antibodies. See, e.g., Carter et al., Proc. Natl. Acad. Set USA
  • humanized antibodies are prepared by a process of analysis of the parental sequences and various conceptual humanized products using three- dimensional models of the parental and humanized sequences.
  • Three-dimensional immunoglobulin models are commonly available and are familiar to those skilled in the art.
  • Computer programs are available which illustrate and display probable three- dimensional conformational structures of selected candidate immunoglobulin sequences. Inspection of these displays permits analysis of the likely role of the residues in the functioning of the candidate immunoglobulin sequence, i.e., the analysis of residues that influence the ability of the candidate immunoglobulin to bind its antigen.
  • FR residues can be selected and combined from the recipient and import sequences so that the desired antibody characteristic, such as increased affinity for the target antigen(s) (e.g., FKN or a fragment thereof), is achieved.
  • the CDR residues are directly and most substantially involved in influencing antigen binding.
  • FKN-binding fragments that modulate the interaction between FKN and CX3CR1.
  • Such fragments may be functional antigen binding fragments of intact, humanized, and/or chimeric antibodies, such as Fab, Fab', F(ab') 2 , Fv, or ScFv fragments (see, e.g., Bird et al., Science 242:423- 426 (1998))
  • Such fragments are produced by the proteolytic digestion of intact antibodies by, e.g., papain digestion (see, e.g., WO 94/29348) directly from recombinantly transformed host cells.
  • FKN-binding fragments may be produced using a variety of engineering techniques described below.
  • Fv fragments have a lower interaction energy between their two chains than Fab fragments.
  • Fv fragments have been linked with peptides (see, e.g., Bird et al., Science 242:423-426 (1998) and Huston et al., PNAS 85:5879-5883 (1998)), disulfide bridges (see, e.g., Glockshuber et al., Biochemistry 29:1362-1367 (1990)), and "knob in hole” mutations (see, e.g., Zhu et al., Protein Sci. 6:781-788 (1997)).
  • ScFv fragments can be produced by methods well known to those skilled in the art (see, e.g., Whitlow et al., Methods Enzymol. 2:97-105 (1991) and Huston et al., Int. Rev. Immunol. 10:195-217 (1993)).
  • ScFv may be produced in bacterial cells such as E. coli, but may also be produced in eukaryotic cells.
  • One disadvantage of ScFv is the mono valency of the product, which precludes an increased avidity due to polyvalent binding, and the short half-life of ScFv fragments.
  • ScFv can be forced to form multimers by shortening the peptide linker to 3 to 12 residues to form "diabodies" (see, e.g., Holliger et al., PNAS 90:6444-6448 (1993)). Reducing the linker further can result in ScFV trimers to form "triabodies” (see, e.g., Kortt et al., Protein Eng. 10:423-433 (1997)) and tetramers to form “tetrabodies” (see, e.g., Le Gall et al., FEBS Letters 453: 164-168 (1999)). Construction of bivalent ScFV molecules can also be achieved by genetic fusion with protein dimerizing motifs to form "miniantibodies” (see, e.g., Pack et al., Biochemistry 31 : 1579-1584 (1992)) and
  • ScFv-Sc-Fv tandems may also be produced by linking two ScFv units by a third peptide linker (see, e.g., Kurucz et al., J. Immunol. 154:4576-4582 (1995)).
  • Bispecific diabodies can be produced through the noncovalent association of two single chain fusion products containing a VH domain from one antibody connected by a short linker to the VL domain of another antibody (see, e.g., Kipriyanov et al., Int. J. Can. 77:763-772 (1998)).
  • bispecific diabodies can be enhanced by the introduction of disulfide bridges or "knob in hole” mutations or by the formation of single chain diabodies (ScDb), wherein two hybrid ScFv fragments are connected through a peptide linker (see, e.g., Kontermann et al., J. Immunol. Methods 226: 179-188 (1999)).
  • Tetravalent bispecific molecules are available by, e.g., fusing a ScFv fragment to the CH3 domain of an IgG molecule or to a Fab fragment through the hinge region (see, e.g., Coloma et al., Nature Biotechnol. 15: 159-163 (1997)).
  • tetravalent bispecific molecules are available by the fusion of bispecific single chain diabodies (see, e.g., Alt et al., FEBS Letters 454:90-94 (1999)).
  • Smaller tetravalent bispecific molecules can also be formed by the dimerization of either ScFv-ScFv tandems with a linker containing a helix-loop- helix motif (DiBi miniantibodies) (see, e.g., Muller et al., FEBS Letters 432:45-49 (1998)) or a single chain molecule comprising four antibody variable domains (VH and VL) in an orientation preventing intramolecular pairing (tandem diabody) (see, e.g., Kipriyanov et al., J.
  • Bispecific F(ab') 2 fragments can be created by chemical coupling of Fab' fragments or by heterodimerization through leucine zippers (see, e.g., Shalaby et al., J. Exp. Med. 175:217-225 (1992) and Kostelny et al., J. Immunol. 148: 1547-1553 (1992)). Also available are isolated VH and VL domains (see, e.g., U.S. Patent Nos. 6,248,516; 6,291,158; and 6,172,197, hereby incorporated by reference).
  • Therapeutic formulations comprising an antibody or FKN-binding fragment thereof of the invention may be combined with physiologically acceptable carriers, excipients, or stabilizers in the form of aqueous or dried formulations.
  • Acceptable carriers, excipients, or stabilizers include, e.g., saline; buffers, such as phosphate, citrate, and other organic acids; antioxidants, including ascorbic acid; low molecular weight polypeptides; proteins (e.g., serum albumin, gelatin, or immunoglobulins); hydrophilic polymers such as polyvinylpyrrolidone; amino acids; monosaccharides, disaccharides, and other carbohydrates, including glucose, mannose, or dextrins; chelating agents, such as EDTA; sugar alcohols, such as mannitol or sorbitol; salt-forming counterions, such as sodium; or nonionic surfactants, such as TWEENTM, PLURONICSTM, or PEG.
  • buffers such as
  • the antibodies or FKN-binding fragments thereof of the invention may be entrapped in microcapsules, in colloidal drug delivery systems (e.g., liposomes, albumin microspheres, microemulsions, nanoparticles, or nanocapsules), or in macroemulsions.
  • colloidal drug delivery systems e.g., liposomes, albumin microspheres, microemulsions, nanoparticles, or nanocapsules
  • macroemulsions e.g., liposomes, albumin microspheres, microemulsions, nanoparticles, or nanocapsules
  • sustained-release matrices include polyesters, hydrogels (for example, poly(2- hydroxyethyl-methacrylate) or poly(vinylalcohol)), polylactides (see, e.g., U.S. Patent No.
  • LUPRON DEPOTTM injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), and poly-D-(-)-3-hydroxybutyric acid.
  • the formulations to be used for in vivo administration must be sterile. This is readily accomplished by filtration through sterile filtration membranes.
  • Therapeutic antibodies or FKN-binding fragments thereof of the invention can be used either alone or in combination with other compositions in a therapy.
  • an antibody of the invention may be co-administered with one or more of another antibody, anti-inflammatory agents, cytotoxic agents, anti-angiogenic agents, cytokines, growth inhibitory agents, or anti-TNF-a therapy.
  • Such combined therapies include combined administration (where the two or more agents are included in the same or separate formulations) and separate administration (e.g., simultaneously or sequentially). When two or more agents are administered separately, administration of the antibody of the invention can occur prior to or following administration of the adjunct therapy.
  • the effective amounts of therapeutic agents administered in combination with an anti-FKN antibody or FKN-binding fragment thereof will be at a physician's discretion. The dosage determination is calculated to achieve maximal management of the
  • the dose will additionally depend on such factors as the type of therapeutic agent to be used and the specific subject being treated. Suitable dosages can be lowered due to the combined action (synergy) of the additional therapeutic agent and the anti-FKN antibody or FKN-binding fragment thereof.
  • An anti-inflammatory compound may be administered in combination with the antibodies or FKN-binding fragments of the invention.
  • exemplary anti-inflammatory agents include steroids, such as a glucocorticoid, non-steroidal anti-inflammatory drugs (e.g., ibuprofen or tacrolimus), cyclooxygenase-2-specific inhibitors such as rofecoxib (Vioxx®) and celecoxib (Celebrex®), corticosteroids (e.g., prednisone or hydrocortisone), specific cytokines directed at T lymphocyte function, flubiprofen, diclofenac, and ketarolac. See, e.g., U.S. Patent Nos. 7,1 12,578 and 7,199,119, hereby incorporated by reference.
  • therapeutic agents that may be administered include, e.g., aminosalicylates
  • sulfasalazine e.g., azulfadine
  • mesalamine e.g., Asacol ® or Pentasa ®
  • azathioprine e.g., Imuran ®
  • 6-mercaptopurine e.g., Purinethol ®
  • cyclosporine methotrexate, infliximab (e.g., Remicade ® ), interferons (e.g., interferon- ⁇ ), glatiramer acetate (e.g., Copaxone ® ), natalizumab (Tysabri ® ), anti-integrin a4,
  • ursodeoxycholic acid tacrine hydrochloride, HMG CoA reductase inhibitor, lidocaine, sulfonylurea, cyclophosphamide, intravenous immunoglobulin, amitriptyline, opiates (e.g., morphine), diphenoxylate, atropine, vitamin D, calcium, lamotrigine, quetiapine, prostaglandin El, nitroglycerin, pegaptanib, ranibizumab, isosorbide dinitrate,
  • perospirone topiramate, oxcarbazepine, dopamine, mycophenolate mofetil, mizoribine, levetiracetam, fentanyl, tramadol, digitalis, capsaicin, natriuretic peptide, cloridine, - dronates (e.g., alendronate), bezafibrate, mexiletine, glinides (e.g., nateglinide or repaglinide), donepezil hydrochloride, lefiunomide, pregabalin, rivastigmine tartrate, phentanyl, prostacyclin, procainamide, colchicine, a-glucosidase inhibitors, diuretics (e.g., thiazide diuretics or anti-aldosterone diuretics), tacrolimus, memantine hydrochloride, pentazocine, clopidogrel, tissue plasminogen activator, thali
  • Treatment of a disorder described herein may additionally involve administration of other therapies.
  • plasmapheresis e.g., plasma exchange therapy
  • demyelinating polyradiculopathy e.g., chronic inflammatory demyelinating
  • Alleviation or treatment of an inflammatory disorder generally involves the lessening of one or more symptoms or complications associated with the disorder.
  • the therapeutically effective amount of the therapeutic antibody, FKN-binding fragments, or pharmaceutical composition thereof can be any suitable therapeutically effective amount.
  • the "therapeutically effective amount" of the antibody to be administered is the minimum amount necessary to prevent, ameliorate, or treat an inflammatory disorder.
  • the antibodies, FKN-binding fragments, and pharmaceutical composition described herein are administered to a subject in accordance with known methods, such as intravenous administration as a bolus or by continuous infusion over a period of time, topically, orally, subcutaneous ly, by bronchial injection, intracerebrally, intranasally, transdermally, intraperitoneally, intramuscularly, intrapulmonary, vaginally, rectally, intraarticularly, intraarterially, intralesionally, parenterally, intraventricularly in the brain, or intraocularly.
  • Local administration may be particularly desired if extensive side effects or toxicity is associated with the treatment.
  • Formulations for oral use may also be provided as chewable tablets, or as hard gelatin capsules, wherein the active ingredient is mixed with an inert solid diluent, or as soft gelatin capsules wherein the active ingredient is mixed with water or an oil medium.
  • the cells can be any of a wide range of types including, without limitation, hemopoietic cells (e.g., bone marrow cells,
  • macrophages monocytes, dendritic cells, T cells, or B cells
  • fibroblasts epithelial cells, endothelial cells, keratinocytes, or muscle cells:
  • compositions of the present invention depend on various clinical factors, including the overall health of the subject and the severity of the symptoms of the inflammatory disorder. Treatment can be continued for a period of time ranging from 1 day to 4 years, 1 day to 3 years, 1 day to 2 years, 1 day to a year, 1 to 100 days, 1 to 60 days, 1 to 20 days, 1 to 10 days, or until the inflammatory disorder or symptoms of the inflammatory disorder are treated or alleviated.
  • the compositions of the present invention may be administered four times per day, three times per day, twice per day, daily, weekly, bi-monthly, monthly, every two months, every three months, or annually.
  • Dosages vary depending on the severity of the condition and are titrated to achieve a steady-state blood serum concentration ranging from about 1 ng/mL to 10 ⁇ g/mL, or 1 to 500 ng/mL.
  • the amount of antibody administered is typically in the range of about 0.001 to about 30 mg/kg of subject weight (e.g., 0.01 to about 10 mg/kg of subject weight).
  • Mouse anti-hFKN monoclonal antibodies were generated as described previously (see, e.g., U.S. Patent No. 7,390,490, hereby incorporated by reference).
  • Neutralizing mAb clones 1F3-1, 3A5-2, 1F3, 1G1, 2B2, 3D5, 3H7, 6D1, 7F6, and 5H7-6 were obtained.
  • Clones 1F3-1, 3A5-2, and 5H7-6 were analyzed using chemotaxis assays for measuring neutralizing activity, BIACORE ® assays for measuring binding affinity to hFKN, and enzyme-linked immunosorbent assays (ELISA) for measuring species cross- reactivity to cynomolgus monkey FKN.
  • the neutralizing activity, binding affinity, and species cross-reactivity to cynomolgus monkey FKN are summarized in Figure 2.
  • Clone 3A5-2 showed the highest neutralizing activity and the highest binding affinity to hFKN.
  • Clone 3A5-2 showed equal reactivity to cynomolgus monkey FKN and hFKN. Therefore, clone 3A5-2 was selected as a candidate for humanization.
  • Chemotaxis assays were performed as follows. Cells were placed in the upper wells of a transwell culture plate (MultiScreen-MIC Plate, 5.0 . um, Millipore, Catalog No. MAMIC 5S10) with ligand in the lower wells. First, recombinant human FKN (R&D Systems, Catalog No. 362-CX/CF) (33 ng/ml final concentration) (Figure 1) was pre- incubated with purified antibodies at various concentrations (0 to 10 g/ml) at room temperature.
  • composition contained the following components: lOx chemokine solution, 15 ⁇ /well; lOx purified mAb, 15 ⁇ /well; and lx chemotaxis buffer (0.5% BSA, 0.5% FBS, 20 mM HEPES (pH 7.4), 50 ⁇ 2-mercaptoethanol in RPMI 1640
  • BIACORE ® assays were performed as follows. Recombinant Protein-A/G (Pierce Chemical) was immobilized on BIACORE ® sensor chips (CM5) that were pre-activated with amine coupling reagents (GE Healthcare). Purified mAbs were added into the sensor chips at a concentration of 0.2 ⁇ g/ml. Soluble antigens (soluble FKN conjugated to secreted alkaline phosphatase (SEAP) or control SEAP proteins) were added into the sensor chips at various concentrations (0 to 200 nM). Association of added antigens with mAbs captured on the sensor chips was monitored continuously, and the relative binding response of the antigens was determined using a BIACORE A 100 system (GE
  • ImmunoResearch Laboratories, Catalog No. 711-005-152) was coated on the wells of a 96-well plate (Nunc, Catalog No. 442402). After overnight incubation at 4°C, the wells were blocked with lx Block- Ace (DainipponPharma) for 1 hour at room temperature. After washing three times with 0.05% Tween 20/PBS, 10 nM rabbit polyclonal anti- PLAP antibody (Biomeda) was added to the wells (50 ⁇ /well). After incubating for 1 hour at room temperature and washing three times as described above, culture
  • TMB (3,3 ',5,5'- tetramethylbenzidine) solution was added to the wells and allowed to incubate for 15-30 minutes.
  • Soluble hFKN-SEAP was prepared as follows. cDNA encoding the extracellular region of hFKN was amplified with 5'-SalI-hFKN primer (CGCGTCGACGCCACCAT- GGCTCCGATATCTCTGTC; SEQ ID NO: 2) and 3'-NotI-hFKN primer (GCGGGCG- GCCGCCCTCCGGGTGGCAGCCTGGG; SEQ ID NO: 3) and subcloned into pcDNA3.1 (+) dSall SEAP vector containing SEAP cDNA. The expression vector of hFKN-SEAP was transfected into HEK293EBNA (HEK293E) cells (Invitrogen).
  • HEK293E HEK293E
  • HEK293E cells were inoculated with DMEM (Invitrogen) supplemented with 10% fetal bovine serum on the day before transfection. On the day of transfection, the medium was exchanged with OPTI-MEM II serum free media (Invitrogen).
  • the expression vector was transfected with TransIT LT1 (TAKARA) according to the manufacturers' instructions. After 3 days of incubation (5% CO 2 at 37°C), the culture supernatant was harvested. The concentration of SEAP protein was measured using Great EscAPe SEAP Chemiluminescence Kit 2.0 (Clontech).
  • Soluble cynomolgus monkey FKN-SEAP was prepared as follows. cDNA encoding the extracellular region of cynomolgus monkey FKN was amplified with 5'- Xhol-cynomolgus monkey FKN primer (GCGCTCGAGGCCACCATGGCTCCGATA- TCTCTGTCGTGG; SEQ ID NO: 4) and 3'-NotI-cynomolgus monkey FKN primer (CGCGGCGGCCGCGGTGGCAGCCTGGGAGTCAGGGAC; SEQ ID NO: 5) and subcloned into pENTRl A (Invitrogen) containing SEAP cDNA. The fragment encoding cynomolgus monkey FKN and SEAP was transferred to pcDNA3.1 containing cassette B by using the GATEWAY system (Invitrogen). Culture supernatant containing
  • cynomolgus monkey FKN-SEAP was prepared as described above.
  • Example 3 cDNA cloning of the variable regions of heavy and light chains of clone 3A5-2 mouse anti-hFKN mAb
  • cDNAs of heavy and light chains of clone 3A5-2 were amplified by RT-PCR.
  • the total RNA was extracted from the hybridoma of clone 3A5-2 with RNeasy Mini Kit (QIAGEN).
  • cDNAs were synthesized using a cDNA synthesis kit (TAKARA) and amplified with 5'-Mm-HC-Leaderl primer (GGGATGGRATGSAG- CTGKGTMATSCTCTT; SEQ ID NO: 6), 5'- Mm-HC-Leader2 primer (GGGATGRA- CTTCGGGYTGAGCTKGGTTTT; SEQ ID NO: 7), or 5'- Mm-HC-Leader3 primer (GGGATGGCTGTCTTGGGGCTGCTCTTCT; SEQ ID NO: 8) and 3'- Mm-IgG2a- CH3-R primer (TCATTTACCCGGAGTCCGGGAGAAGCTCTTAGTC; SEQ ID NO: 9) for the heavy chain
  • Double-stranded cDNA was prepared using a cDNA synthesis kit (TAKARA) and 5' adaptor (ad29S; ACATCACTC- CGT (SEQ ID NO: 16) and as29AS; ACGGAGTGATGTCCGTCGACGTATCTCTGC- GTTGATACTTCAGCGTAGCT (SEQ ID NO: 17) were annealed) was added.
  • cDNA was amplified with 5'-PCRl primer (GTATCAACGCAGAGATACGTCGACGG; SEQ ID NO: 18) for the first PCR and 5'-PCR4 primer (AGCTACGCTGAAGTATCAACGC- AG-AG; SEQ ID NO: 19) for the second PCR and 3' HC RACE primer_l (GTACGGA- GTACTCCAAAAATGTTG; SEQ ID NO: 20) for the first PCR or 3' HC RACE primer_2 (TCTTCAGGCTGCAGGCTGATGATC; SEQ ID NO: 21) for the second PCR for H chain, 3' LC RACE primer_3 (AAATCTTCAGGCTGCAGGCTGTTG; SEQ ID NO: 22) for the first PCR or 3' LC RACE primer_4 (CTGTTGATCTTGAGAGAATAT- TGTG; SEQ ID NO: 23) for the second PCR for L chain, respectively. Amplified cDNAs were subcloned and sequenced as described above
  • Amino acid sequence of the heavy (H) chain variable region QVQLQQSGPELVKPGASVKMSCKASGYTFTTSTYTIHWVKQRPGQGLEWIGWIYP GDGSPKFNERFKGKTTLTADKSSNTAYMLLSSLTSEDSAIYFCATGPTDGDYFDY WGQGTTLTVSS (SEQ ID NO: 26)
  • Mouse anti-hFKN mAb, clone 3A5-2 was humanized by means of the
  • CDR complementarity determining region
  • CDR-L1 RASGNIHNFLA (SEQ ID NO: 31)
  • CDR-L2 NEKTLAD (SEQ ID NO: 32)
  • CDR-L3 QQFWSTPYT (SEQ ID NO: 33) Human acceptor frameworks were selected among the human variable region segments. Identified CDRs of 3 A5-2 were grafted into the selected human acceptor frameworks. The designed humanized sequences are as follows.
  • H chain (designated as H3: SEP ID NO: 36)
  • H chain (designated as H3-2: SEP ID NO: 37) QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYIHWVKQAPGQGLEWIGWIYP GDGSPKFNERFKGRTTLTADKSTNTAYMLLSSLRSEDTAVYFCATGPTDGDYFD YWGQGTTVTVSS
  • L chain (designated as L2; SEQ ID NO: 38)
  • H chain (designated as H4; SEQ ID NO: 39)
  • H chain (designated as HK2; SEQ ID NO: 42)
  • L chain (designated as L4; SEQ ID NO: 44)
  • leader sequences for expression of humanized mAbs germline segments were searched based on the similarity to AAA68427.1 and ABU90602.1. Segments VHl-1-18 and VKI-O12 were the most similar to the AAA68427.1 and ABU90602.1, respectively. Their leader sequences were used for expression of humanized mAbs. Their leader sequences are as follows.
  • Variable regions of the designed humanized anti-hFKN mAbs added with leader sequences described above were generated by PCR with the following primers.
  • h3A5-2_VH3-2R primer SEQ ID NO: 52:
  • h3A5-2_VH3-3 primer SEQ ID NO: 53:
  • h3A5-2_VH3-4R primer (SEQ ID NO: 54):
  • h3A5-2_VH3-6R primer SEQ ID NO: 56:
  • h3A5-2_VH3-7 primer (SEQ ID NO: 57):
  • h3A5-2_VH3-8R primer (SEQ ID NO: 58): GTCCTGCCCTTGAACCTCTCATTGAACTTAGGACTACCATCTCCAGGATA h3A5-2_VH3-9 primer (SEQ ID NO: 59):
  • h3A5-2_VH3-l 1 primer (SEQ ID NO: 61):
  • h3A5-2_VH3-12R primer SEQ ID NO: 62:
  • h3A5-2_R primer SEQ ID NO: 64:
  • h3A5-2_VL2-l primer (SEQ ID NO: 65):
  • h3A5-2_VL2-3 primer (SEQ ID NO: 67):
  • h3A5-2_VL2-4R primer (SEQ ID NO: 68): GAACTTAGGGGCTTTCCCTGGTTTCTGTTGATACCATGCTAAAAAATTGTGAA TATTCCCGCTTGCTCGG h3A5-2_VL2-5 primer (SEQ ID NO: 69):
  • h3A5-2_VL-R (SEQ ID NO: 73):
  • H3 and L2 were amplified by PCR with 5'-Eco-Sal-h3A5-2_VH_F primer (GCGAATTCGTCGACGCCACCATGGACTGGACCTGGAGCATCCTTTT- CTTG; SEQ ID NO: 74) and 3'-NheI-h3A5-2_VH_R (CGCGCTAGCTGAAGAGAC- GGTGACCGTGGT-CCC; SEQ ID NO: 75) for H3 and 5 '-h3A5-2_VL_SalI-kozac_F primer (GCGGTCGACGCCACCATGGACATGAGGGTCCCC; SEQ ID NO: 76) and 3'-h3A5-2_VL-R primer (GACAGATGGTGCAGCCACAGTTCGTTTGATCTCCAC- CTTGGTCCCTCC; SEQ ID NO: 77) for L2, respectively.
  • 5'-Eco-Sal-h3A5-2_VH_F primer GCGAATTCGTCGACGCCACCATGGACTGGACC
  • H4 was generated by Genscript USA Inc. The sequence of H4 is as follows.
  • variable region of HK2 was generated by point mutations with PCR from H4 with the following primers.
  • h3A5-2_HKG2_340F primer (SEQ ID NO: 82):
  • h3A5-2_HKG2_370R primer SEQ ID NO: 83:
  • h3A5-2_HKG2_Nhe24R (SEQ ID NO: 84):
  • variable region of HK3 was generated by point mutations with PCR from HK2 with primers as follows.
  • h3A5-2_HKG2_sal24F primer SEQ ID NO: 85:
  • h3A5-2_HKG2_Nhe24R primer (SEQ ID NO: 88):
  • variable region of L4 was generated by point mutations with PCR from L2 with primers as follows. h3A5-2_VL4_sal24F primer (SEQ ID NO:89):
  • h3A5-2_VL4_200R primer (SEQ ID NO: 90):
  • h3A5-2_VL4_190F primer (SEQ ID NO: 91):
  • h3A5-2_VL4_BsiW24R primer (SEQ ID NO: 94):
  • variable region of L5 was generated by point mutations with PCR from L4 with primers as follows. h3A5-2_VL4_sal24F primer (SEQ ID NO: 95):
  • VL5_F primer (SEQ ID NO: 97):
  • h3A5-2_VL4_BsiW24R (SEQ ID NO: 98):
  • Constant regions of IgG2 and IgK were amplified with 5'-NheI-IgG2_F primer (CGCGCTAGCACCAAGGGCCCATCGGTCTTCCCC; SEQ ID NO: 99) and 3'- EcoRV-IgG2_R primer (CGCGATATCTCATTTACCCGGAGACAGGGAGAG; SEQ ID NO: 100) for IgG2 and 5'-BsiWI-Igk_F primer (CGCCGTACGGTGGCTGCACCA- TCTGTCTTCATC; SEQ ID NO: 101) and 3'-EcoRV-Igk_R primer (CGCGATATCCT- AACACTCTCCCCTGTTGAAGCT; SEQ ID NO: 102) for IgK, respectively. Amplified constant regions were subcloned into pENTRl A dNotl in which Notl was deleted.
  • variable regions were subcloned into pENTRl A-IgG2 or pENTRl A- IgK by using Sall-Nhel sites for heavy chains or Sall-BsiWI sites for light chains, respectively.
  • the constant region of IgK was amplified with 5'- hIGK F primer (CGAACTGTGGCTGCACCATCTGTC; SEQ ID NO: 103) and 3'- hlGK Notl- R primer (CGCGCGGCCGCCTAACACTCTCCCCTGTTGAAGCTCTT; SEQ ID NO: 104).
  • the amplified IgK constant region and the generated L2 were combined by PCR and subcloned into pENTRl A.
  • Subcloned variable regions and constant regions were transferred into pEE6.4 or pEE12.4 (Lonza) for the heavy chain and light chain, respectively, by using the GATEWAY system (Invitrogen).
  • H3-2 was generated by point mutation with the GeneTailor Site-Directed
  • GeneTailor Site-Directed Mutagenesis was performed according to according to the manufacturers' instructions. Mutated variable region and constant region were transferred into pEE6.4 as described above.
  • Expression vectors of heavy and light chains of humanized anti-hFKN mAbs were transfected into HEK293E cells. On the day of transfection, HEK293E cells were inoculated with DMEM (Invitrogen) with 10% fetal bovine serum. After incubating for 5 hours, a mixture of heavy and light chain expression vectors was transfected with DMEM (Invitrogen) with 10% fetal bovine serum. After incubating for 5 hours, a mixture of heavy and light chain expression vectors was transfected with
  • variable region of heavy chain of mouse 3A5-2 was amplified with 5'-EcoRI- SalI-3A5-2 VH primer (GCGGAATTCGTCGACGCCACCATGCGATGGAGCTGGA- TC; SEQ ID NO: 107) and 3'-IgG overlapped 3A5-2 VH primer (GACCGATGGGCC- CTTGGTGGAGGCTGAGGAGACTGTGAGAGTGGTGCC; SEQ ID NO: 108).
  • Human IgG2 constant region was amplified with 5'- hIgG2 primer (GCCTCCACCA- AGGGCCCATCGGTCTTCCCCCTGGCGCCCTG; SEQ ID NO: 109) and 3'-NotI- hIgG2 (CGCGCGGCCGCTCATTTACCCGGAGACAGGGAGAG; SEQ ID NO: 110). Amplified 3A5-2 VH and human IgG2 constant region were combined with PCR and subcloned into pCX-IRES-bsr, which has the blasticidin resistant gene for cell selection.
  • variable region of light chain of mouse 3A5-2 was amplified with 5'- 3A_VL-SalI- kozac_F primer (GCGGTCGACGCCACCATGAGTGTGCTCACTCAG; SEQ ID NO: 111) and 3'- 3A-IgGl,2_VH-R primer (GACAGATGGTGCAGCCACAGTTCGTTTT ATTTCCAGCTTGGTCCCCCCT; SEQ ID NO: 112).
  • Human IgK constant region was amplified with 5'-hIGK_F primer (CGAACTGTGGCTGCACCATCTGTC; SEQ ID NO: 113) and 3'- hIGK Notl-R (CGCGCGGCCGCCTAACACTCTCCCCTGTTGA- AGCTCTT; SEQ ID NO: 114). Amplified 3A5-2 VH and human IgG2 constant region were combined with PCR and subcloned into pMX-IRES-puro, which has the puromycin resistant gene for cell selection.
  • the expression vector of chimeric light chain was transfected into HEK293E cells with pE-Eco and pGp (TAKARA) for retrovirus packaging.
  • HEK293E cells were inoculated with DMEM (Invitrogen) with 10% FBS on the day before transfection.
  • vectors were transfected with TranIT LT1 (TAKARA).
  • TAKARA TranIT LT1
  • Selected cells were subsequently infected with another recombinant retrovirus carrying chimeric heavy chain, which was made using a similar method as described for the light chain.
  • double-selected cells were cultured with SF-O (Sanko Junyaku) containing 8 mM Glutamax, 55 ⁇ 2- mercaptoethanol, lx cholesterol (Invitrogen) in the Integra CELLine (Integra Bioscience). Culture supernatant was purified using a recombinant protein A Sepharose column
  • Humanized anti-hFKN mAbs were analyzed using a chemotaxis assay for measuring neutralizing activity and a BIACORE ® assay for measuring binding affinity to hFKN and cynomolgus monkey FKN. Representative data and results from three independent chemotaxis assays are summarized in Figure 5 and shown in Figures 6A-B, 7A-D, and 8A-F. All combinations of H3 and H3-2 for heavy chain with L2 and L4 for light chain were successfully humanized as these mAbs showed similar neutralizing activity with the chimeric mAb. However, HK2, which was made by using narrowed key residues, showed decreased neutralizing activity in combination with L2 or L4. The results of the BIACORE ® assay are summarized in Figures 9 and lOA-C. All
  • Chemotaxis assays were performed as follows. Cells were placed in the upper wells of a transwell culture plate (MultiScreen-MIC Plate, 5.0 ⁇ , Millipore, Catalog No. MAMIC 5S10) with ligand in the lower wells. First, recombinant human FKN (R&D Systems, Catalog No. 362-CX/CF) (10 ng/ml final concentration) was added with purified antibodies at various concentrations (0 to 10 ⁇ g/ml) to the lower wells. The composition contained the following components: 3x chemokine solution, 50 ⁇ /well; 1.5x purified mAb, 100 ⁇ /well; chemokine and purified antibodies were diluted with lx chemotaxis buffer (described above).
  • B300.19 cells transfected with CX3CR1 (2x10 5 cells/75 ⁇ ) were applied together with purified antibodies at various concentrations (0 to 10 ⁇ g/ml) to the upper wells.
  • the composition contained the following components: 3x cell suspension, 25 ⁇ well; 1.5x purified mAb solution, 50 ⁇ /well; cells and purified antibodies were diluted with lx chemotaxis buffer.
  • the chemotaxis assay was performed in a 5%-CO 2 incubator at 37°C for 4 hours. After the incubation, 150 ⁇ of the lower wells were harvested, fixed with 50 ⁇ of 4% PF A/PBS, and 30 ⁇ of the samples were applied to the FACSCantoII cell analyzer to count migrated cells.
  • Epitope mapping using libraries of overlapping synthetic peptides from FKN chemokine domain was performed.
  • the twenty-one kinds of 15 residue peptides were synthesized by Sigma Genosys.
  • the peptides were dissolved to 10 mg/ml with DMSO. These peptides (50 ⁇ g/ml) were coated on an ELISA plate (Nunc) overnight at 4°C.
  • the peptide solutions were removed and PBS solution containing 1% BlockAce (Dainippon Pharma) was added to each well, incubated for 1 hour at room temperature, and washed with Tris-buffered saline (pH 7.4) containing 0.05% Tween 20 (washing solution).
  • H3- 2L4 antibody solution (50 ⁇ g/ml) was added to the wells and incubated for 2 hours at room temperature. The antibody solution was removed and washed with washing solution. Peroxidase-labeled anti-human IgG antibody solution (Zymed; 400 ng/ml) was added to the wells and incubated for 1 hour at room temperature. The antibody solution was removed and washed with washing solution. TMBZ solution (Sigma) was added to each well and incubated for 10 minutes at room temperature. The reaction was terminated with IN H 2 S0 4 solution and absorbance at 450-650 nm was measured.
  • hFKN-SEAP Alanine or serine substitution mutants of hFKN-SEAP were prepared as follows. cDNA encoding the extracellular region of hFKN was isolated from the expression vector of hFKN-SEAP, pcDNA3.1 (+) hFKN-SEAP, by using Sall/NotI restriction enzymes and subcloned into pENTRlA_dSEAP-(His)10 vector containing SEAP cDNA (pENTRIA was purchased from Invitrogen). Alanine or serine substitution mutations were induced by using GeneTailorTM Site-Directed Mutagenesis System (Invitrogen) according to the manufacturer's instructions.
  • the mutation- induced cDNA fragments of hFKN-SEAP were transferred into pcDNA3.1 (+)_cassette B vector (cassette B was purchased from Invitrogen) using the Gateway system (Invitrogen).
  • the expression vectors of the alanine or serine substitution mutant of hF N-SEAP were transfected into HEK293EBNA (HEK293E) cells (Invitrogen).
  • HEK293E cells were inoculated with DMEM
  • the expression vectors were transfected with TransIT LT1 (Takara) according to the manufacturer's instructions. After 3 of days incubation (5% C0 2 at 37°C), the culture supernatant was harvested. The concentration of SEAP proteins was measured by using Great EscAPe SEAP Chemiluminescence Kit 2.0 (Clontech).
  • Anti-hFKN polyclonal antibody (eBioscience) and H3-2L4 were each coated on wells of an ELISA plate (Nunc) overnight at 4°C. For each, the antibody solution was removed and PBS containing 1% bovine serum albumin was added to each well and incubated for 1 hour at room temperature, then washed with Tris-buffered saline (pH 7.4) containing 0.05% Tween20 (washing solution). Alanine or serine substitution mutants were diluted to 0.13 nM with PBS containing 1% BSA and 50 ⁇ aliquots were added to the ELISA plate wells and incubated for 4 hours at room temperature. The mutant solutions were removed and washed with washing solution.
  • Anti-histidine-tag antibody (Bethyl) was immobilized on a CM5 sensor chip (GE Healthcare). Alanine- or serine-substituted mutant solutions were 10 times diluted with HBS-EP buffer (GE Healthcare), loaded on the chip, washed with HBS-EP, and antigen binding level was measured. H3-2L4 and anti-FKN polyclonal antibody solution were loaded on the antigen bound chip, washed with HBS-EP, and antibody binding level was measured. [Antibody binding level/Antigen binding level] was calculated and the values calculated for each mutant were compared with that of wild type. The results are shown in Figure 13.
  • Mouse anti-human FKN monoclonal antibodies (1F3, 1G1, 2B2, 3D5, 6D1, 7F6 ) and H3-2L4 antibody were coated on an ELISA plate (Nunc) overnight at 4°C.
  • the antibody solutions were removed.
  • PBS solution containing 1% BSA was added to each well and incubated for 1 hour at room temperature, and the wells were washed with Tris- buffered saline (pH 7.4) containing 0.05% Tween 20.
  • the wild type and R68A mutated FKN-SEAP-His solution (1, 0.5, 0.25, 0.125 nM) were added to the wells and incubated for 2 hours at room temperature.
  • the antigen solutions were removed and washed with washing solution.
  • p-Nitrophenyl phosphate solution (Thermo Scientific) was added to each well and incubated for 30 minutes at room temperature. The reaction was
  • Neutralizing activity of these antibodies was tested based on a chemotaxis assay, as described above. 10 nM human FKN and various concentrations of these antibodies were added in the lower wells of a transwell plate. In the upper well of the plate,
  • the flow-through fraction was applied to an anti-human IgG Fc antibody (Jackson ImmunoResearch Laboratories) immobilized column and flow-through was collected.
  • the flow-through fraction was concentrated and applied to Superose 12 10/300 GL (GE Healthcare) and fractions containing Fab fragment were collected. Purity of these fractions was analyzed by SDS PAGE and Fab dominant fractions were pooled. Identification of Fab binding site on fractalkine

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Neurology (AREA)
  • Neurosurgery (AREA)
  • Pain & Pain Management (AREA)
  • Rheumatology (AREA)
  • Biomedical Technology (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Epidemiology (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Transplantation (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicines Containing Plant Substances (AREA)
PCT/JP2010/069653 2009-10-30 2010-10-28 Compositions and methods for treating inflammatory disorders Ceased WO2011052799A1 (en)

Priority Applications (24)

Application Number Priority Date Filing Date Title
SI201031803T SI2493930T1 (sl) 2009-10-30 2010-10-28 Izboljšana protitelesa proti humanemu fraktalkinu in njihova uporaba
BR112012010266A BR112012010266A2 (pt) 2009-10-30 2010-10-28 anticorpo anti-fractalquina ou fragmento de ligação a fkn do mesmo, composição farmacêutica, ácido nucleico, vetor, célula hospedeira, métodos para preparar um anticorpo anti-fractalquina ou fragmento de ligação a fkn do mesmo, e para tratar um distúrbio inflamatório, e, uso de um anticorpo ou fragmento de ligação a fkn do mesmo
AU2010312408A AU2010312408B2 (en) 2009-10-30 2010-10-28 Compositions and methods for treating inflammatory disorders
NZ599779A NZ599779A (en) 2009-10-30 2010-10-28 Compositions and methods for treating inflammatory disorders
ES10826929T ES2698389T3 (es) 2009-10-30 2010-10-28 Anticuerpos anti-fractalcina humana mejorados y sus usos
RU2012122203/10A RU2569109C2 (ru) 2009-10-30 2010-10-28 Композиции и способы для лечения воспалительных нарушений
DK10826929.1T DK2493930T3 (en) 2009-10-30 2010-10-28 Enhanced anti-human fractalkin antibodies and their applications.
SM20180637T SMT201800637T1 (it) 2009-10-30 2010-10-28 Anticorpi anti-fractalchina umana migliorati e utilizzi degli stessi
CA2778895A CA2778895C (en) 2009-10-30 2010-10-28 Anti-fractalkine antibody, composition and method for treating inflammatory disorders
PL10826929T PL2493930T3 (pl) 2009-10-30 2010-10-28 Udoskonalone przeciwciała przeciwko ludzkiej fraktalkinie i ich zastosowania
EP10826929.1A EP2493930B1 (en) 2009-10-30 2010-10-28 Improved anti human Fraktalkine antibodies and uses thereof
CN201080049138.0A CN102597003B (zh) 2009-10-30 2010-10-28 用于治疗炎性病症的组合物和方法
JP2012520621A JP5631991B2 (ja) 2009-10-30 2010-10-28 炎症性疾患を処置するための組成物および方法
US13/504,742 US8932592B2 (en) 2009-10-30 2010-10-28 Compositions and methods for treating inflammatory disorders
LTEP10826929.1T LT2493930T (lt) 2009-10-30 2010-10-28 Pagerinti žmogaus anti-fraktalkino antikūnai ir jų panaudojimas
KR1020167014386A KR102099596B1 (ko) 2009-10-30 2010-10-28 염증성 장애 치료용 조성물 및 방법
RS20181424A RS58142B1 (sr) 2009-10-30 2010-10-28 Poboljšana antitela protiv ljudskog fraktalkina i njihove primene
MX2012005052A MX2012005052A (es) 2009-10-30 2010-10-28 Composiciones y metodos para tratar trastornos inflamatorios.
PH1/2012/500828A PH12012500828A1 (en) 2009-10-30 2010-10-28 Compositions and methods for treating inflammatory disorders
UAA201206559A UA105073C2 (uk) 2009-10-30 2010-10-28 Антитіло проти фракталкіну, композиція і спосіб для лікування запальних порушень
HRP20181973TT HRP20181973T1 (hr) 2009-10-30 2010-10-28 Poboljšana anti humana fraktalkinska protutijela i njihova uporaba
ZA2012/03002A ZA201203002B (en) 2009-10-30 2012-04-24 Compositions and methods for treating inflammatory disorders
IL219470A IL219470A (en) 2009-10-30 2012-04-29 Antibacterial antibody, preparations containing it and its uses
CY20181101274T CY1121167T1 (el) 2009-10-30 2018-11-29 Βελτιωμενα αντισωματα εναντι της ανθρωπινης φρακταλκινης και χρησεις αυτων

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US25652109P 2009-10-30 2009-10-30
US61/256,521 2009-10-30

Publications (1)

Publication Number Publication Date
WO2011052799A1 true WO2011052799A1 (en) 2011-05-05

Family

ID=43922220

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/JP2010/069653 Ceased WO2011052799A1 (en) 2009-10-30 2010-10-28 Compositions and methods for treating inflammatory disorders

Country Status (33)

Country Link
US (1) US8932592B2 (https=)
EP (1) EP2493930B1 (https=)
JP (2) JP5631991B2 (https=)
KR (2) KR101627605B1 (https=)
CN (1) CN102597003B (https=)
AR (2) AR078796A1 (https=)
AU (1) AU2010312408B2 (https=)
BR (1) BR112012010266A2 (https=)
CA (1) CA2778895C (https=)
CL (2) CL2012001143A1 (https=)
CY (1) CY1121167T1 (https=)
DK (1) DK2493930T3 (https=)
ES (1) ES2698389T3 (https=)
HR (1) HRP20181973T1 (https=)
HU (1) HUE041952T2 (https=)
IL (1) IL219470A (https=)
JO (1) JO3437B1 (https=)
LT (1) LT2493930T (https=)
MX (1) MX2012005052A (https=)
MY (1) MY158481A (https=)
NZ (1) NZ599779A (https=)
PE (1) PE20121645A1 (https=)
PH (1) PH12012500828A1 (https=)
PL (1) PL2493930T3 (https=)
PT (1) PT2493930T (https=)
RS (1) RS58142B1 (https=)
RU (1) RU2569109C2 (https=)
SI (1) SI2493930T1 (https=)
SM (1) SMT201800637T1 (https=)
TW (1) TWI414308B (https=)
UA (1) UA105073C2 (https=)
WO (1) WO2011052799A1 (https=)
ZA (1) ZA201203002B (https=)

Cited By (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2968600A4 (en) * 2013-03-13 2017-03-08 Petropoulos, Konstantin Antibody drug conjugates
US9605080B2 (en) 2014-11-21 2017-03-28 Bristol-Myers Squibb Company Antibodies against CD73
EP3159007A1 (en) 2015-10-19 2017-04-26 Eisai R&D Management Co., Ltd. Pharmaceutical composition for treating rheumatoid arthritis
EP3211007A1 (en) * 2016-02-29 2017-08-30 Eisai R&D Management Co., Ltd. Pharmaceutical composition for treating crohn's disease
US20180111988A1 (en) * 2016-10-26 2018-04-26 Eisai R&D Management Co., Ltd. Pharmaceutical composition for treating rheumatoid arthritis
US20180303933A1 (en) * 2017-04-14 2018-10-25 Eisai R&D Management Co., Ltd. Method and pharmaceutical composition for treating crohn's disease
US10653791B2 (en) 2014-11-21 2020-05-19 Bristol-Myers Squibb Company Antibodies comprising modified heavy constant regions
WO2020218232A1 (ja) 2019-04-23 2020-10-29 エーザイ・アール・アンド・ディー・マネジメント株式会社 関節リウマチ治療のためのバイオマーカー
WO2022092183A1 (ja) 2020-10-30 2022-05-05 エーザイ・アール・アンド・ディー・マネジメント株式会社 医薬組成物
US20220196674A1 (en) * 2019-04-17 2022-06-23 Abdolamir Landi Treatment of autoimmune liver disease

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20220110827A (ko) * 2019-12-09 2022-08-09 알렉시온 파마슈티칼스, 인코포레이티드 시신경척수염 스펙트럼 장애의 치료를 위한 항-c5 항체
CN113087795B (zh) * 2019-12-23 2025-06-10 上海普铭生物科技有限公司 针对趋化因子cx3cl1的抗体及其应用
CN121537534B (zh) * 2026-01-22 2026-04-07 华中科技大学同济医学院附属协和医院 靶向cx3cl1的嵌合抗原受体-巨噬细胞及在gjb2突变相关遗传性耳聋治疗中的应用

Citations (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1997002290A1 (en) * 1995-06-30 1997-01-23 Mochida Pharmaceutical Co., Ltd. ANTIFas LIGAND ANTIBODIES AND ASSAY METHOD BY USING THE SAME
US6043086A (en) 1996-05-07 2000-03-28 Millenium Biotherapeutics, Inc. Neurotactin and uses therefor
US6172197B1 (en) 1991-07-10 2001-01-09 Medical Research Council Methods for producing members of specific binding pairs
US6248516B1 (en) 1988-11-11 2001-06-19 Medical Research Council Single domain ligands, receptors comprising said ligands methods for their production, and use of said ligands and receptors
US6291158B1 (en) 1989-05-16 2001-09-18 Scripps Research Institute Method for tapping the immunological repertoire
JP2002345454A (ja) * 2001-03-19 2002-12-03 Eisai Co Ltd 抗cx3cr1抗体、抗フラクタルカイン抗体及びフラクタルカインの利用
US20020192212A1 (en) 2001-03-19 2002-12-19 Toshio Imai Uses of anti-CX3CR1 antibody, anti-fractalkine antibody and fractalkine
WO2004108895A2 (en) * 2003-05-30 2004-12-16 Neuralab Limited Humanized antibodies that recognize beta amyloid peptide
WO2005032589A1 (ja) * 2003-10-02 2005-04-14 Japan Science And Technology Agency Gvhdの予防及び治療
WO2006033386A1 (ja) * 2004-09-22 2006-03-30 Kirin Beer Kabushiki Kaisha 安定化されたヒトIgG4抗体
WO2006046739A1 (ja) 2004-10-29 2006-05-04 Eisai R & D Management Co., Ltd. 炎症性疾患治療剤
US7112578B2 (en) 1999-12-09 2006-09-26 Bruce H. Levin Methods and compositions for treatment of inflammatory disease
US7199119B2 (en) 2002-10-31 2007-04-03 Amgen Inc. Antiinflammation agents

Family Cites Families (23)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5397703A (en) 1992-07-09 1995-03-14 Cetus Oncology Corporation Method for generation of antibodies to cell surface molecules
AU691811B2 (en) 1993-06-16 1998-05-28 Celltech Therapeutics Limited Antibodies
US6180377B1 (en) 1993-06-16 2001-01-30 Celltech Therapeutics Limited Humanized antibodies
US6114507A (en) 1995-06-30 2000-09-05 Mochida Pharmaceutical Co., Ltd. Anti-Fas ligand antibody and assay method using the anti-Fas ligand antibody
US6096312A (en) 1995-06-30 2000-08-01 Mochida Pharmaceutical Co., Ltd. Agent for suppressing a reduction of CD4+ lymphocytes
AU1825097A (en) 1996-01-24 1997-08-20 Schering Corporation Mammalian cx3c chemokine genes
US6548654B1 (en) 1996-01-24 2003-04-15 Schering Corporation DNA encoding mammalian CX3C chemokine genes
US7115379B1 (en) 1996-01-24 2006-10-03 Schering Corporation Anti-mammalian CX3C cytokine antibodies
US6566503B2 (en) 1996-01-24 2003-05-20 Schering Corporation Mammalian CX3C chemokine
EP0966484A4 (en) 1996-05-07 2002-04-17 Millennium Pharm Inc NEUROTACTIN AND APPLICATIONS THEREOF
SE9802729D0 (sv) 1998-08-13 1998-08-13 Astra Pharma Prod Novel Compounds
WO2000011950A1 (en) 1998-08-31 2000-03-09 Oregon Health Science University Prevention of cell migration initiation with cmv us28 receptor antagonists
JP2001218581A (ja) 1999-11-30 2001-08-14 Eisai Co Ltd モノクローナル抗体の作製法
AU2000273378A1 (en) 2000-02-18 2001-08-27 Millennium Pharmaceuticals, Inc. Therapeutic methods that target fractalkine or cx3cr1
US8647612B2 (en) 2008-03-05 2014-02-11 Encore Health, Llc Dithiol compounds, derivatives, and treatment of presbyopia
SE0101082D0 (sv) 2001-03-27 2001-03-27 Astrazeneca Ab Novel use
ES2330731T3 (es) 2001-08-30 2009-12-15 Chemocentryx, Inc. Compuestos biciclicos como inhibidores de la union de quimioquina a us28.
EP1520586A1 (en) 2003-09-30 2005-04-06 Institut National De La Sante Et De La Recherche Medicale (Inserm) Inhibition of fractalkine or of its receptor for the treatment of atopic allergic diseases
EP1675862A1 (en) 2003-10-07 2006-07-05 AstraZeneca AB New 2-substituted, 4-amino-thiazolo 4,5-d pyrimidines, useful as chemokine receptor antagonists, esp. cx3cr1
UA90707C2 (en) 2005-04-06 2010-05-25 Астразенека Аб Novel 5-substituted 7-amino-[1,3]thiazolo[4,5-d]pyrimidine derivatives
AR053347A1 (es) 2005-04-06 2007-05-02 Astrazeneca Ab Derivados de [1,3]tiazolo[4,5-d]pirimidin-2(3h)-ona 5,7-sustituidos
WO2008052108A2 (en) 2006-10-26 2008-05-02 Centocor Ortho Biotech Inc. Methods for use in human-adapting monoclonal antibodies
ES3006441T3 (en) * 2007-09-14 2025-03-18 Amgen Inc Homogeneous antibody populations

Patent Citations (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6248516B1 (en) 1988-11-11 2001-06-19 Medical Research Council Single domain ligands, receptors comprising said ligands methods for their production, and use of said ligands and receptors
US6291158B1 (en) 1989-05-16 2001-09-18 Scripps Research Institute Method for tapping the immunological repertoire
US6172197B1 (en) 1991-07-10 2001-01-09 Medical Research Council Methods for producing members of specific binding pairs
WO1997002290A1 (en) * 1995-06-30 1997-01-23 Mochida Pharmaceutical Co., Ltd. ANTIFas LIGAND ANTIBODIES AND ASSAY METHOD BY USING THE SAME
US6043086A (en) 1996-05-07 2000-03-28 Millenium Biotherapeutics, Inc. Neurotactin and uses therefor
US7112578B2 (en) 1999-12-09 2006-09-26 Bruce H. Levin Methods and compositions for treatment of inflammatory disease
JP2002345454A (ja) * 2001-03-19 2002-12-03 Eisai Co Ltd 抗cx3cr1抗体、抗フラクタルカイン抗体及びフラクタルカインの利用
US20020192212A1 (en) 2001-03-19 2002-12-19 Toshio Imai Uses of anti-CX3CR1 antibody, anti-fractalkine antibody and fractalkine
US7390490B1 (en) 2001-03-19 2008-06-24 Eisai Co., Ltd. Uses of anti-CX3CR1 antibody, anti-fractalkine antibody and fractalkine
US7199119B2 (en) 2002-10-31 2007-04-03 Amgen Inc. Antiinflammation agents
WO2004108895A2 (en) * 2003-05-30 2004-12-16 Neuralab Limited Humanized antibodies that recognize beta amyloid peptide
WO2005032589A1 (ja) * 2003-10-02 2005-04-14 Japan Science And Technology Agency Gvhdの予防及び治療
US20060233710A1 (en) 2003-10-02 2006-10-19 Kouji Matsushima Prevention and treatment for GVHD
WO2006033386A1 (ja) * 2004-09-22 2006-03-30 Kirin Beer Kabushiki Kaisha 安定化されたヒトIgG4抗体
WO2006046739A1 (ja) 2004-10-29 2006-05-04 Eisai R & D Management Co., Ltd. 炎症性疾患治療剤
EP1806145A1 (en) 2004-10-29 2007-07-11 Eisai R&D Management Co., Ltd. Remedy for inflammatory diseases

Non-Patent Citations (11)

* Cited by examiner, † Cited by third party
Title
ALT ET AL., FEBS LETTERS, vol. 454, 1999, pages 90 - 94
COLOMA ET AL., NATURE BIOTECHNOL., vol. 15, 1997, pages 159 - 163
KIPRIYANOV ET AL., INT. J. CAN., vol. 77, 1998, pages 763 - 772
KIPRIYANOV ET AL., J. MOL. BIOL., vol. 293, 1999, pages 41 - 56
KONTERMANN ET AL., J. IMMUNOL. METHODS, vol. 226, 1999, pages 179 - 188
KOSTELNY ET AL., J. IMMUNOL., vol. 148, 1992, pages 1547 - 1553
MORRISON ET AL., PROC. NATL. ACAD.. SCI. U.S.A., vol. 81, 1984, pages 6851 - 6855
MULLER ET AL., FEBS LETTERS, vol. 432, 1998, pages 45 - 49
NANKI T. ET AL.: "Inhibition of fractalkine ameliorates murine collagen-induced arthritis", THE JOURNAL OF IMMUNOLOGY, THE AMERICAN ASSOCIATION OF IMMUNOLOGISTS, vol. 173, no. 11, 1 December 2004 (2004-12-01), pages 7010 - 7016, XP002996170
See also references of EP2493930A4
SHALABY ET AL., J. EXP. MED., vol. 175, 1992, pages 217 - 225

Cited By (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2968600A4 (en) * 2013-03-13 2017-03-08 Petropoulos, Konstantin Antibody drug conjugates
US11352440B2 (en) 2014-11-21 2022-06-07 Bristol-Myers Squibb Company Antibodies against CD73 and uses thereof
US9605080B2 (en) 2014-11-21 2017-03-28 Bristol-Myers Squibb Company Antibodies against CD73
US10100129B2 (en) 2014-11-21 2018-10-16 Bristol-Myers Squibb Company Antibodies against CD73 and uses thereof
US10167343B2 (en) 2014-11-21 2019-01-01 Bristol-Myers Squibb Company Antibodies against CD73
US10653791B2 (en) 2014-11-21 2020-05-19 Bristol-Myers Squibb Company Antibodies comprising modified heavy constant regions
EP3159007A1 (en) 2015-10-19 2017-04-26 Eisai R&D Management Co., Ltd. Pharmaceutical composition for treating rheumatoid arthritis
EP3211007A1 (en) * 2016-02-29 2017-08-30 Eisai R&D Management Co., Ltd. Pharmaceutical composition for treating crohn's disease
US20180111988A1 (en) * 2016-10-26 2018-04-26 Eisai R&D Management Co., Ltd. Pharmaceutical composition for treating rheumatoid arthritis
US20180303933A1 (en) * 2017-04-14 2018-10-25 Eisai R&D Management Co., Ltd. Method and pharmaceutical composition for treating crohn's disease
US11052150B2 (en) 2017-04-14 2021-07-06 Eisai R&D Management Co., Ltd. Method and pharmaceutical composition for treating Crohn's disease
US20220196674A1 (en) * 2019-04-17 2022-06-23 Abdolamir Landi Treatment of autoimmune liver disease
WO2020218232A1 (ja) 2019-04-23 2020-10-29 エーザイ・アール・アンド・ディー・マネジメント株式会社 関節リウマチ治療のためのバイオマーカー
US20220205980A1 (en) * 2019-04-23 2022-06-30 Eisai R&D Management Co., Ltd. Biomarker for rheumatoid arthritis treatment
WO2022092183A1 (ja) 2020-10-30 2022-05-05 エーザイ・アール・アンド・ディー・マネジメント株式会社 医薬組成物

Also Published As

Publication number Publication date
KR102099596B1 (ko) 2020-04-10
LT2493930T (lt) 2019-01-10
JP2015027304A (ja) 2015-02-12
EP2493930A4 (en) 2013-12-04
MY158481A (en) 2016-10-14
NZ599779A (en) 2014-03-28
ZA201203002B (en) 2013-06-26
RS58142B1 (sr) 2019-02-28
CN102597003A (zh) 2012-07-18
KR101627605B1 (ko) 2016-06-07
RU2012122203A (ru) 2013-12-10
CA2778895C (en) 2018-08-07
AU2010312408A1 (en) 2012-06-21
HRP20181973T1 (hr) 2019-01-25
KR20120104560A (ko) 2012-09-21
AR078796A1 (es) 2011-12-07
SI2493930T1 (sl) 2018-12-31
TW201127401A (en) 2011-08-16
US20120213799A1 (en) 2012-08-23
RU2569109C2 (ru) 2015-11-20
CL2012001143A1 (es) 2012-10-05
EP2493930B1 (en) 2018-09-19
JO3437B1 (ar) 2019-10-20
ES2698389T3 (es) 2019-02-04
CN102597003B (zh) 2016-03-23
SMT201800637T1 (it) 2019-01-11
HUE041952T2 (hu) 2019-06-28
PH12012500828A1 (en) 2013-01-07
PE20121645A1 (es) 2012-12-06
PT2493930T (pt) 2018-11-29
MX2012005052A (es) 2012-05-29
AU2010312408B2 (en) 2015-07-09
PL2493930T3 (pl) 2019-03-29
JP5631991B2 (ja) 2014-11-26
EP2493930A1 (en) 2012-09-05
KR20160066055A (ko) 2016-06-09
CY1121167T1 (el) 2020-05-29
IL219470A0 (en) 2012-06-28
AR109533A2 (es) 2018-12-19
CA2778895A1 (en) 2011-05-05
CL2015000114A1 (es) 2015-04-10
UA105073C2 (uk) 2014-04-10
JP2013509158A (ja) 2013-03-14
IL219470A (en) 2017-10-31
DK2493930T3 (en) 2018-12-17
US8932592B2 (en) 2015-01-13
TWI414308B (zh) 2013-11-11
BR112012010266A2 (pt) 2016-12-06

Similar Documents

Publication Publication Date Title
US8932592B2 (en) Compositions and methods for treating inflammatory disorders
JP6944509B2 (ja) Il−18結合分子
CA2822288A1 (en) Anti-c5/c5a/c5adesr antibodies and fragments
US9181332B2 (en) Anti-A(β) oligomer humanized antibody
MX2012011629A (es) Proteinas de union a tnf-alfa.
US20240309113A1 (en) Novel anti-masp-2 antibodies
CN117999096A (zh) 治疗神经学疾病的方法
JP2024505674A (ja) 抗il1rap抗体
HK1174041B (en) Improved anti human fraktalkine antibodies and uses thereof
HK1174041A (en) Improved anti human fraktalkine antibodies and uses thereof
CN114375305A (zh) Cr2结合蛋白及其在医学疗法中的用途
JP2022060182A (ja) 二重特異性抗体を有効成分として含む医薬組成物
HK40039608A (en) MONOCLONAL ANTIBODY TO IL-5Rα
EA040834B1 (ru) ГУМАНИЗИРОВАННОЕ АНТИТЕЛО К IL-23p19 ИЛИ ЕГО АНТИГЕНСВЯЗЫВАЮЩИЙ ФРАГМЕНТ, ЕГО ПРИМЕНЕНИЕ И ФАРМАЦЕВТИЧЕСКАЯ КОМПОЗИЦИЯ, СОДЕРЖАЩАЯ УКАЗАННОЕ АНТИТЕЛО
HK1227416A1 (en) Tumor necrosis factor-like ligand 1a specific antibodies and compositions and uses thereof
HK1185624B (en) Anti-il-23 antibodies
HK1185624A (en) Anti-il-23 antibodies

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 201080049138.0

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 10826929

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 2778895

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 12012500828

Country of ref document: PH

WWE Wipo information: entry into national phase

Ref document number: 2012520621

Country of ref document: JP

Ref document number: 000580-2012

Country of ref document: PE

Ref document number: 13504742

Country of ref document: US

Ref document number: MX/A/2012/005052

Country of ref document: MX

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 1201001966

Country of ref document: TH

WWE Wipo information: entry into national phase

Ref document number: 2010826929

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 4669/CHENP/2012

Country of ref document: IN

WWE Wipo information: entry into national phase

Ref document number: 2010312408

Country of ref document: AU

Ref document number: A201206559

Country of ref document: UA

ENP Entry into the national phase

Ref document number: 20127014048

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2012122203

Country of ref document: RU

ENP Entry into the national phase

Ref document number: 2010312408

Country of ref document: AU

Date of ref document: 20101028

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112012010266

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: 2015000114

Country of ref document: CL

ENP Entry into the national phase

Ref document number: 112012010266

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20120430