WO2011005341A2 - Compositions and methods related to protein a (spa) variants - Google Patents

Compositions and methods related to protein a (spa) variants Download PDF

Info

Publication number
WO2011005341A2
WO2011005341A2 PCT/US2010/029959 US2010029959W WO2011005341A2 WO 2011005341 A2 WO2011005341 A2 WO 2011005341A2 US 2010029959 W US2010029959 W US 2010029959W WO 2011005341 A2 WO2011005341 A2 WO 2011005341A2
Authority
WO
WIPO (PCT)
Prior art keywords
protein
spa
amino acid
composition
seq
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2010/029959
Other languages
English (en)
French (fr)
Other versions
WO2011005341A3 (en
Inventor
Olaf Schneewind
Alice Cheng
Dominique Missiakas
Hwan Kim
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University of Chicago
Original Assignee
University of Chicago
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to KR1020177023725A priority Critical patent/KR20170102039A/ko
Priority to SG2011070802A priority patent/SG174968A1/en
Priority to BRPI1010307-4A priority patent/BRPI1010307B1/pt
Priority to AU2010271116A priority patent/AU2010271116B2/en
Application filed by University of Chicago filed Critical University of Chicago
Priority to CA2757543A priority patent/CA2757543C/en
Priority to DK10797468.5T priority patent/DK2414387T3/en
Priority to ES10797468.5T priority patent/ES2563646T3/es
Priority to JP2012503769A priority patent/JP5789250B2/ja
Priority to PL10797468T priority patent/PL2414387T3/pl
Priority to US13/260,878 priority patent/US9567379B2/en
Priority to EP10797468.5A priority patent/EP2414387B1/en
Priority to HRP20160274TT priority patent/HRP20160274T1/hr
Priority to PL17193256T priority patent/PL3281947T3/pl
Priority to EP17193256.9A priority patent/EP3281947B1/en
Priority to SI201031085T priority patent/SI2414387T1/sl
Priority to HK12102899.4A priority patent/HK1162533B/en
Priority to CN201080024448.7A priority patent/CN102612523B/zh
Priority to KR1020117026053A priority patent/KR101773368B1/ko
Publication of WO2011005341A2 publication Critical patent/WO2011005341A2/en
Publication of WO2011005341A3 publication Critical patent/WO2011005341A3/en
Anticipated expiration legal-status Critical
Priority to ZA2011/07702A priority patent/ZA201107702B/en
Priority to US14/335,411 priority patent/US9212219B2/en
Priority to US14/968,023 priority patent/US9907850B2/en
Priority to SM201600033T priority patent/SMT201600033B/it
Priority to CY20201100438T priority patent/CY1123052T1/el
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/305Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Micrococcaceae (F)
    • C07K14/31Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Micrococcaceae (F) from Staphylococcus (G)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/02Bacterial antigens
    • A61K39/085Staphylococcus
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04Antibacterial agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies

Definitions

  • the present invention relates generally to the fields of immunology, microbiology, and pathology. More particularly, it concerns methods and compositions involving bacterial Protein A variants, which can be used to invoke an immune response against the bacteria.
  • the major nosocomial pathogens include Staphylococcus aureus, coagulase-negative Staphylococci (mostly Staphylococcus epidermidis), enterococcus spp., Escherichia coli and Pseudomonas aeruginosa. Although these pathogens cause approximately the same number of infections, the severity of the disorders they can produce combined with the frequency of antibiotic resistant isolates balance this ranking towards S. aureus and S. epidermidis as being the most significant nosocomial pathogens.
  • Staphylococci can cause a wide variety of diseases in humans and other animals through either toxin production or invasion. Staphylococcal toxins are also a common cause of food poisoning, as the bacteria can grow in improperly-stored food.
  • Staphylococcus epidermidis is a normal skin commensal which is also an important opportunistic pathogen responsible for infections of impaired medical devices and infections at sites of surgery.
  • Medical devices infected by S. epidermidis include cardiac pacemakers, cerebrospinal fluid shunts, continuous ambulatory peritoneal dialysis catheters, orthopedic devices and prosthetic heart valves.
  • Staphylococcus aureus is the most common cause of nosocomial infections with a significant morbidity and mortality. It is the cause of some cases of osteomyelitis, endocarditis, septic arthritis, pneumonia, abscesses, and toxic shock syndrome. S. aureus can survive on dry surfaces, increasing the chance of transmission. Any S. aureus infection can cause the staphylococcal scalded skin syndrome, a cutaneous reaction to exotoxin absorbed into the bloodstream. It can also cause a type of septicemia called pyaemia that can be life-threatening. Problematically, Methicillin-resistant Staphylococcus aureus (MRSA) has become a major cause of hospital-acquired infections.
  • MRSA Methicillin-resistant Staphylococcus aureus
  • S. aureus and S. epidermidis infections are typically treated with antibiotics, with penicillin being the drug of choice, whereas vancomycin is used for methicillin resistant isolates.
  • the percentage of staphylococcal strains exhibiting wide-spectrum resistance to antibiotics has become increasingly prevalent, posing a threat for effective antimicrobial therapy.
  • vancomycin resistant S. aureus strain has aroused fear that MRSA strains are emerging and spreading for which no effective therapy is available.
  • S. aureus secretes a plethora of virulence factors into the extracellular milieu (Archer, 1998; 3,s et ah, 2000; Foster, 2005; Shaw et ah, 2004; Sibbald et ah, 2006). Like most secreted proteins, these virulence factors are translocated by the Sec machinery across the plasma membrane. Proteins secreted by the Sec machinery bear an N-terminal leader peptide that is removed by leader peptidase once the pre- protein is engaged in the Sec translocon (Dalbey and Wickner, 1985; van WeIy et ah, 2001).
  • ESAT-6 early secreted antigen target 6 kDa
  • CFP-10 culture filtrate antigen 10 kDa
  • ESX-I serum secretion system
  • Protein A (SpA)(SEQ ID NO:33), a cell wall anchored surface protein of Staphylococcus aureus, provides for bacterial evasion from innate and adaptive immune responses. Protein A binds immunoglobulins at their Fc portion, interacts with the VH3 domain of B cell receptors inappropriately stimulating B cell proliferation and apotosis, binds to von Willebrand factor Al domains to activate intracellular clotting, and also binds to the TNF Receptor- 1 to contribute to the pathogenesis of staphylococcal pneumonia. Due to the fact that Protein A captures immunoglobulin and displays toxic attributes, the possibility that this surface molecule may function as a vaccine in humans has not been rigorously pursued.
  • Protein A variants no longer able to bind to immunoglobulins, which are thereby removed of their toxigenic potential, i.e., are non-toxigenic, stimulate humoral immune responses that protect against staphylococcal disease.
  • the SpA variant is a full length SpA variant comprising a variant A, B, C, D, and E domain.
  • the SpA variant comprises or consists of the amino acid sequence that is 80, 90, 95, 98, 99, or 100% identical to the amino acid sequence of SEQ ID NO:34
  • the SpA variant comprises a segment of SpA.
  • the SpA segment can comprise at least or at most 1, 2, 3, 4, 5 or more IgG binding domains.
  • the IgG domains can be at least or at most 1, 2, 3, 4, 5 or more variant A, B, C, D, or E domains.
  • the SpA variant comprises at least or at most 1, 2, 3, 4, 5, or more variant A domains.
  • the SpA variant comprises at least or at most 1, 2, 3, 4, 5, or more variant B domains. In still a further aspect the SpA variant comprises at least or at most 1, 2, 3, 4, 5, or more variant C domains. In yet a further aspect the SpA variant comprises at least or at most 1, 2, 3, 4, 5, or more variant D domains. In certain aspects the SpA variant comprises at least or at most 1, 2, 3, 4, 5, or more variant E domains. In a further aspect the SpA variant comprises a combination of A, B, C, D, and E domains in various combinations and permutations. The combinations can include all or part of a SpA signal peptide segment, a SpA region X segment, and/or a SpA sorting signal segment.
  • the SpA variant does not include a SpA signal peptide segment, a SpA region X segment, and/or a SpA sorting signal segment.
  • a variant A domain comprises a substitution at position(s) 7, 8, 34, and/or 35 of SEQ ID NO:4.
  • a variant B domain comprises a substitution at position(s) 7, 8, 34, and/or 35 of SEQ ID NO:6.
  • a variant C domain comprises a substitution at position(s) 7, 8, 34, and/or 35 of SEQ ID NO:5.
  • a variant D domain comprises a substitution at position(s) 9, 10, 37, and/or 38 of SEQ ID NO:2.
  • a variant E domain comprises a substitution at position(s) 6, 7, 33, and/or 34 of SEQ ID NO:3.
  • the SpA variant includes a substitution of (a) one or more amino acid substitution in an IgG Fc binding sub-domain of SpA domain A, B, C, D, and/or E that disrupts or decreases binding to IgG Fc, and (b) one or more amino acid substitution in a V H 3 binding sub-domain of SpA domain A, B, C, D, and/or E that disrupts or decreases binding to V H 3.
  • amino acid sequence of a SpA variant comprises an amino acid sequence that is at least 50%, 60%, 70%, 80%, 90%, 95%, or 100% identical, including all values and ranges there between, to the amino acid sequence of SEQ ID NOs:2-6.
  • the SpA variant includes (a) one or more amino acid substitution in an IgG Fc binding sub-domain of SpA domain D, or at a corresponding amino acid position in other IgG domains, that disrupts or decreases binding to IgG Fc, and (b) one or more amino acid substitution in a V H 3 binding sub-domain of SpA domain D, or at a corresponding amino acid position in other IgG domains, that disrupts or decreases binding to V H 3.
  • amino acid residue F5, Q9, QlO, SI l, F13, Y14, L17, N28, 131, and/or K35 (SEQ ID NO:2, QQNNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLN ES) of the IgG Fc binding sub-domain of domain D are modified or substituted.
  • amino acid residue Q26, G29, F30, S33, D36, D37, Q40, N43, and/or E47 (SEQ ID NO:2) of the V H 3 binding sub-domain of domain D are modified or substituted such that binding to Fc or V H 3 is attenuated.
  • corresponding modifications or substitutions can be engineered in corresponding positions of the domain A, B, C, and/or E. Corresponding positions are defined by alignment of the domain D amino acid sequence with one or more of the amino acid sequences from other IgG binding domains of SpA, for example see FIG. 1.
  • the amino acid substitution can be any of the other 20 amino acids.
  • conservative amino acid substitutions can be specifically excluded from possible amino acid substitutions.
  • only non-conservative substitutions are included. In any event, any substitution or combination of substitutions that reduces the binding of the domain such that SpA toxicity is significantly reduced is contemplated.
  • a variant SpA comprises at least or at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more variant SpA domain D peptides.
  • amino acid residues of the variant SpA are substituted or modified - including but not limited to amino acids F5, Q9, QlO, SI l, F13, Y14, L17, N28, 131, and/or K35 (SEQ ID NO:2) of the IgG Fc binding sub-domain of domain D and amino acid residue Q26, G29, F30, S33, D36, D37, Q40, N43, and/or E47 (SEQ ID NO:2) of the V H 3 binding sub-domain of domain D.
  • glutamine residues at position 9 and/or 10 of SEQ ID NO:2 are mutated.
  • aspartic acid residues 36 and/or 37 of SEQ ID NO:2 are mutated.
  • glutamine 9 and 10, and aspartic acid residues 36 and 37 are mutated.
  • Purified non-toxigenic SpA or SpA-D mutants/variants described herein are no longer able to significantly bind (i.e., demonstrate attenuated or disrupted binding affinity) Fc ⁇ or F(ab) 2 V H 3 and also do not stimulate B cell apoptosis.
  • non-toxigenic Protein A variants can be used as subunit vaccines and raise humoral immune responses and confer protective immunity against S. aureus challenge.
  • immunization with SpA-D variants resulted in an increase in Protein A specific antibody.
  • immunization with the non-toxigenic Protein A variants generated significant protection from staphylococcal infection and abscess formation.
  • S. aureus strains express Protein A
  • immunization of humans with the non-toxigenic Protein A variants can neutralize this virulence factor and thereby establish protective immunity.
  • the protective immunity protects or ameliorates infection by drug resistant strains of Staphylococcus, such as USA300 and other MRSA strains.
  • Embodiments include the use of Protein A variants in methods and compositions for the treatment of bacterial and/or staphylococcal infection.
  • This application also provides an immunogenic composition comprising a Protein A variant or immunogenic fragment thereof.
  • the immunogenic fragment is a Protein A domain D segment.
  • the present invention provides methods and compositions that can be used to treat (e.g., limiting staphylococcal abscess formation and/or persistence in a subject) or prevent bacterial infection.
  • methods for stimulating an immune response involve administering to the subject an effective amount of a composition including or encoding all or part of a Protein A variant polypeptide or antigen, and in certain aspects other bacterial proteins.
  • bacterial proteins include, but are not limited to (i) a secreted virulence factor, and/or a cell surface protein or peptide, or (ii) a recombinant nucleic acid molecule encoding a secreted virulence factor, and/or a cell surface protein or peptide.
  • the subject can be administered all or part of a Protein A variant, such as a variant Protein A domain D segment.
  • the polypeptide of the invention can be formulated in a pharmaceutically acceptable composition.
  • the composition can further comprise one or more of at least or at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, or 19 additional staphylococcal antigen or immunogenic fragment thereof (e.g.
  • Additional staphylococcal antigens that can be used in combination with a Protein A variant include, but are not limited to 52kDa vitronectin binding protein (WO 01/60852), Aaa (GenBank CAC80837), Aap (GenBank accession AJ249487), Ant (GenBank accession NP_372518), autolysin glucosaminidase, autolysin amidase, Cna, collagen binding protein (US6288214), EFB (FIB), Elastin binding protein (EbpS), EPB, FbpA, fibrinogen binding protein (US6008341), Fibronectin binding protein (US5840846), FnbA, FnbB, GehD (US 2002/0169288), HarA, HBP, Immunodominant ABC transporter, IsaA/PisA, laminin receptor, Lipase GehD, MAP, Mg2+ transporter, MHC II analogue (US5648240), MRPII, Npas
  • the staphylococcal antigen or immunogenic fragment can be administered concurrently with the Protein A variant.
  • the staphylococcal antigen or immunogenic fragment and the Protein A variant can be administered in the same composition.
  • the Protein A variant can also be a recombinant nucleic acid molecule encoding a Protein A variant.
  • a recombinant nucleic acid molecule can encode the Protein A variant and at least one staphylococcal antigen or immunogenic fragment thereof.
  • the term “modulate” or “modulation” encompasses the meanings of the words “enhance,” or “inhibit.” "Modulation" of activity may be either an increase or a decrease in activity.
  • modulator refers to compounds that effect the function of a moiety, including up-regulation, induction, stimulation, potentiation, inhibition, down-regulation, or suppression of a protein, nucleic acid, gene, organism or the like.
  • the methods and compositions use or include or encode all or part of the Protein A variant or antigen.
  • the Protein A variant may be used in combination with secreted factors or surface antigens including, but not limited to one or more of an isolated Eap, Ebh, Emp, EsaB, EsaC, EsxA, EsxB, SdrC, SdrD, SdrE, IsdA, IsdB, CIfA, CIfB, Coa, HIa, IsdC, SasF, vWbp, or vWh polypeptide or immunogenic segment thereof.
  • Additional staphylococcal antigens that can be used in combination with a Protein A variant include, but are not limited to 52kDa vitronectin binding protein (WO 01/60852), Aaa, Aap, Ant, autolysin glucosaminidase, autolysin amidase, Cna, collagen binding protein (US6288214), EFB (FIB), Elastin binding protein (EbpS), EPB, FbpA, fibrinogen binding protein (US6008341), Fibronectin binding protein (US5840846), FnbA, FnbB, GehD (US 2002/0169288), HarA, HBP, Immunodominant ABC transporter, IsaA/PisA, laminin receptor, Lipase GehD, MAP, Mg2+ transporter, MHC II analogue (US5648240), MRPII, Npase, RNA III activating protein (RAP), SasA, SasB, SasC, SasD, Sa
  • the isolated Protein A variant is multimerized, e.g., dimerized or a linear fusion of two or more polypeptides or peptide segments.
  • a composition comprises multimers or concatamers of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more isolated cell surface proteins or segments thereof.
  • Concatamers are linear polypeptides having one or more repeating peptide units.
  • SpA polypeptides or fragments can be consecutive or separated by a spacer or other peptide sequences, e.g., one or more additional bacterial peptide.
  • the other polypeptides or peptides contained in the multimer or concatamer can include, but are not limited to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 of Eap, Ebh, Emp, EsaB, EsaC, EsxA, EsxB, SdrC, SdrD, SdrE, IsdA, IsdB, CIfA, CIfB, Coa, HIa, IsdC, SasF, vWbp, vWh or immunogenic fragments thereof.
  • Additional staphylococcal antigens that can be used in combination with a Protein A variant include, but are not limited to 52kDa vitronectin binding protein (WO 01/60852), Aaa, Aap, Ant, autolysin glucosaminidase, autolysin amidase, Cna, collagen binding protein (US6288214), EFB (FIB), Elastin binding protein (EbpS), EPB, FbpA, fibrinogen binding protein (US6008341), Fibronectin binding protein (US5840846), FnbA, FnbB, GehD (US 2002/0169288), HarA, HBP, Immunodominant ABC transporter, IsaA/PisA, laminin receptor, Lipase GehD, MAP, Mg2+ transporter, MHC II analogue (US5648240), MRPII, Npase, RNA III activating protein (RAP), SasA, SasB, SasC, SasD, Sa
  • Protein A variant refers to polypeptides that include a SpA IgG domain having two or more amino acid substitutions that disrupt binding to Fc and V H 3.
  • a SpA variant includes a variant domain D peptide, as well as variants of SpA polypeptides and segments thereof that are non- toxigenic and stimulate an immune response against staphylococcus bacteria Protein A and/or bacteria expressing such.
  • Embodiments of the present invention include methods for eliciting an immune response against a staphylococcus bacterium or staphylococci in a subject comprising providing to the subject an effective amount of a Protein A variant or a segment thereof.
  • the methods for eliciting an immune response against a staphylococcus bacterium or staphylococci in a subject comprising providing to the subject an effective amount of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or more secreted proteins and/or cell surface proteins or segments/fragments thereof.
  • a secreted protein or cell surface protein includes, but is not limited to Eap, Ebh, Emp, EsaB, EsaC, EsxA, EsxB, SdrC, SdrD, SdrE, IsdA, IsdB, CIfA, CIfB, Coa, HIa, IsdC, SasF, vWbp, and/or vWh proteins and immunogenic fragments thereof.
  • Additional staphylococcal antigens that can be used in combination with a Protein A variant include, but are not limited to 52kDa vitronectin binding protein (WO 01/60852), Aaa, Aap, Ant, autolysin glucosaminidase, autolysin amidase, Cna, collagen binding protein (US6288214), EFB (FIB), Elastin binding protein (EbpS), EPB, FbpA, fibrinogen binding protein (US6008341), Fibronectin binding protein (US5840846), FnbA, FnbB, GehD (US 2002/0169288), HarA, HBP, Immunodominant ABC transporter, IsaA/PisA, laminin receptor, Lipase GehD, MAP, Mg2+ transporter, MHC II analogue (US5648240), MRPII, Npase, RNA III activating protein (RAP), SasA, SasB, SasC, SasD, Sa
  • Embodiments of the invention include compositions that include a polypeptide, peptide, or protein that is or is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical or similar to Protein A, or a second protein or peptide that is a secreted bacterial protein or a bacterial cell surface protein.
  • a composition may include a polypeptide, peptide, or protein that is or is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical or similar to a Protein A domain D polypeptide (SEQ ID NO:2), domain E (SEQ ID NO:3), domain A (SEQ ID NO:4), domain C (SEQ ID NO:5), domain B (SEQ ID NO:6), or a nucleic acid sequence encoding a Protein A domain D, domain E, domain A, domain C, or domain B polypeptide.
  • a Protein A polypeptide segment will have an amino acid sequence of SEQ ID NO:8.
  • Sequence identity and/or similarity is determined using standard techniques known in the art, including, but not limited to, the local sequence identity algorithm of Smith & Waterman (1981), by the sequence identity alignment algorithm of Needleman & Wunsch (1970), by the search for similarity method of Pearson & Lipman (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Drive, Madison, Wis.), the Best Fit sequence program described by Devereux et al.
  • percent identity is calculated by using alignment tools known to and readily ascertainable to those of skill in the art. Percent identity is essentially the number of identical amino acids divided by the total number of amino acids compared times one hundred.
  • Still further embodiments include methods for stimulating in a subject a protective or therapeutic immune response against a staphylococcus bacterium comprising administering to the subject an effective amount of a composition including (i) a SpA variant, e.g., a variant SpA domain D polypeptide or peptide thereof; or, (ii) a nucleic acid molecule encoding such a SpA variant polypeptide or peptide thereof, or (iii) administering a SpA variant domain D polypeptide with any combination or permutation of bacterial proteins described herein.
  • the composition is not a staphylococcus bacterium.
  • the subject is a human or a cow.
  • composition is formulated in a pharmaceutically acceptable formulation.
  • the staphylococci may be Staphylococcus aureus.
  • vaccines comprising a pharmaceutically acceptable composition having an isolated SpA variant polypeptide, or any other combination or permutation of protein(s) or peptide(s) described herein, wherein the composition is capable of stimulating an immune response against a staphylococcus bacterium.
  • the vaccine may comprise an isolated SpA variant polypeptide, or any other combination or permutation of protein(s) or peptide(s) described.
  • the isolated SpA variant polypeptide, or any other combination or permutation of protein(s) or peptide(s) described are multimerized, e.g., dimerized or concatamerized.
  • the vaccine composition is contaminated by less than about 10, 9, 8, 7, 6, 5, 4, 3, 2, 1, 0.5, 0.25, 0.05% (or any range derivable therein) of other Staphylococcal proteins.
  • a composition may further comprise an isolated non-SpA polypeptide.
  • the vaccine comprises an adjuvant.
  • a protein or peptide of the invention is linked (covalently or non-covalently) to the adjuvant, preferably the adjuvant is chemically conjugated to the protein.
  • a vaccine composition is a pharmaceutically acceptable composition having a recombinant nucleic acid encoding all or part of a SpA variant polypeptide, or any other combination or permutation of protein(s) or peptide(s) described herein, wherein the composition is capable of stimulating an immune response against a staphylococcus bacteria.
  • the vaccine composition may comprise a recombinant nucleic acid encoding all or part of a SpA variant polypeptide, or any other combination or permutation of protein(s) or peptide(s) described herein.
  • the recombinant nucleic acid contains a heterologous promoter.
  • the recombinant nucleic acid is a vector.
  • the vector is a plasmid or a viral vector.
  • the vaccine includes a recombinant, non-staphylococcus bacterium containing the nucleic acid.
  • the recombinant non-staphylococci may be Salmonella or another gram- positive bacteria.
  • the vaccine may comprise a pharmaceutically acceptable excipient, more preferably an adjuvant.
  • Still further embodiments include methods for stimulating in a subject a protective or therapeutic immune response against a staphylococcus bacterium comprising administering to the subject an effective amount of a composition of a SpA variant polypeptide or segment/fragment thereof and further comprising one or more of a Eap, Ebh, Emp, EsaB, EsaC, EsxA, EsxB, SdrC, SdrD, SdrE, IsdA, IsdB, CIfA, CIfB, Coa, HIa, IsdC, SasF, vWbp, or vWh protein or peptide thereof.
  • the composition comprises a non-staphylococcus bacterium.
  • compositions are formulated in a pharmaceutically acceptable formulation.
  • the staphylococci for which a subject is being treated may be Staphylococcus aureus.
  • Methods of the invention also include SpA variant compositions that contain 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or more secreted virulence factors and/or cell surface proteins, such as Eap, Ebh, Emp, EsaC, EsxA, EsxB, SdrC, SdrD, SdrE, IsdA, IsdB, CIfA, CIfB, Coa, HIa, IsdC, SasF, vWbp, or vWh in various combinations.
  • a vaccine formulation includes Eap, Ebh, Emp, EsaC, EsxA, EsxB, SdrC, SdrD, SdrE, IsdA, IsdB, CIfA, CIfB, Coa, HIa, IsdC, SasF, vWbp, and vWh.
  • an antigen combination can include (1) a SpA variant and IsdA; (2) SpA variant and CIfB; (3) SpA variant and SdrD; (4) SpA variant and HIa or HIa variant; (5) SpA variant and CIfB, SdrD, and HIa or HIa variant; (6) SpA variant, IsdA, SdrD, and HIa or HIa variant; (7) SpA variant, IsdA, CIfB, and HIa or HIa variant; (8) SpA variant, IsdA, CIfB, and SdrD; (9) SpA variant, IsdA, CIfB, SdrD and HIa or HIa variant; (10) SpA variant, IsdA, CIfB, and SdrD; (11) SpA variant, IsdA, SdrD, and HIa or HIa variant; (12) SpA variant, IsdA, and HIa or HIa variant; (13) SpA variant,
  • a bacterium delivering a composition of the invention will be limited or attenuated with respect to prolonged or persistent growth or abscess formation.
  • SpA variant(s) can be overexpressed in an attenuated bacterium to further enhance or supplement an immune response or vaccine formulation.
  • Certain embodiments are directed to methods for eliciting an immune response against a staphylococcus bacterium in a subject comprising providing to the subject an effective amount of a peptide comprising a coagulase polypeptide or an immunogenic segment thereof having an amino acid sequence that is at least 80, 85, 90, 95, 98, to 100% identical to SEQ ID NO:27 or a segment thereof or at least 80, 85, 90, 95, 98, to 100% identical to amino acids 27-508 of SEQ ID NO:32 or a segment thereof.
  • the subject is provided with an effective amount of an coagulase polypeptide by administering to the subject a composition
  • a composition comprising: (i) an isolated coagulase polypeptide or segment thereof having an amino acid sequence that is at least 90% identical to SEQ ID NO:27 or a segment thereof or is at least 90% identical to amino acids 27-508 of SEQ ID NO:32 or a segment thereof; or (ii) at least one isolated recombinant nucleic acid molecule encoding a coagulase polypeptide or a segment thereof having an amino acid sequence that is at least 90% identical to SEQ ID NO:27 or a segment thereof or is at least 90% identical to amino acids 27-508 of SEQ ID NO: 32 or a segment thereof.
  • the composition comprises an isolated coagulase polypeptide having the amino acid sequence of SEQ ID NO:27 or the amino acid sequence of amino acids 27-508 of SEQ ID NO:32.
  • Certain embodiments are directed to methods for treating a staphylococcal infection in a subject comprising providing to a subject having or suspected of having or at risk of developing a staphylococcal infection an effective amount of an isolated peptide comprising a coagulase polypeptide having an amino acid sequence that is at least 80, 85, 90, 95, 98, to 100% identical to SEQ ID NO:27 or is at least 80, 85, 90, 95, 98, to 100% identical to amino acids 27-508 of SEQ ID NO:32.
  • the coagulase polypeptide has an amino acid sequence of SEQ ID NO:27 or has an amino acid identical to amino acids 27-508 of SEQ ID NO:32.
  • the subject is diagnosed with a persistent staphylococcal infection.
  • the coagulase polypeptide elicits production of an antibody that binds Coa or vWbpvWh in the subject.
  • Embodiments include methods of preventing or treating staphylococcal infection comprising the step of administering an immunogenic composition comprising a Staphylococcal coagulase or an immunogenic segment thereof.
  • Certain embodiments are directed to methods of preparing an immunoglobulin for use in prevention or treatment of staphylococcal infection comprising the steps of immunizing a recipient with a coagulase polypeptide and isolating immunoglobulin from the recipient.
  • a further embodiment is directed to an immunoglobulin prepared by the method described herein.
  • a further embodiment is directed to methods for treatment or prevention of staphylococcal infection comprising a step of administering to a patient an effective amount of pharmaceutical preparation of immunoglobulin that binds a coagulase.
  • Other embodiments are directed to a use of the pharmaceutical preparation of coagulase immunoglobulins in the manufacture of a medicament for the treatment or prevention of staphylococcal infection.
  • inventions include vaccines comprising a pharmaceutically acceptable composition having an isolated coagulase polypeptide, or any other combination or permutation of protein(s) or peptide(s) described herein, wherein the composition is capable of stimulating an immune response against a staphylococcus bacterium.
  • the vaccine may comprise an isolated coagulase polypeptide, or any other combination or permutation of protein(s) or peptide(s) described.
  • the isolated coagulase polypeptide, or any other combination or permutation of protein(s) or peptide(s) described are multimerized, e.g., dimerized or concatamerized.
  • the vaccine composition is contaminated by less than about 10, 9, 8, 7, 6, 5, 4, 3, 2, 1, 0.5, 0.25, 0.05% (or any range derivable therein) of other Staphylococcal proteins.
  • a composition may further comprise an isolated non-coagulase polypeptide.
  • the vaccine comprises an adjuvant.
  • a protein or peptide of the invention is linked (covalently or non-covalently) to the adjuvant, preferably the adjuvant is chemically conjugated to the protein.
  • a vaccine composition is a pharmaceutically acceptable composition having a recombinant nucleic acid encoding all or part of a coagulase polypeptide, or any other combination or permutation of protein(s) or peptide(s) described herein, wherein the composition is capable of stimulating an immune response against a staphylococcus bacterium.
  • the vaccine composition may comprise a recombinant nucleic acid encoding all or part of a coagulase polypeptide, or any other combination or permutation of protein(s) or peptide(s) described herein.
  • the recombinant nucleic acid contains a heterologous promoter.
  • the recombinant nucleic acid is a vector. More preferably the vector is a plasmid or a viral vector.
  • the vaccine includes a recombinant, non-staphylococcus bacterium containing the nucleic acid.
  • the recombinant non-staphylococci may be Salmonella or another gram- positive bacteria.
  • the vaccine may comprise a pharmaceutically acceptable excipient, more preferably an adjuvant.
  • Still further embodiments include methods for stimulating in a subject a protective or therapeutic immune response against a staphylococcus bacterium comprising administering to the subject an effective amount of a composition of a coagulase polypeptide or segment/fragment thereof and further comprising one or more of a Eap, Ebh, Emp, EsaB, EsaC, EsxA, EsxB, SdrC, SdrD, SdrE, IsdA, IsdB, CIfA, CIfB, Coa, HIa, IsdC, SasF, vWbp, or vWh protein or peptide thereof.
  • the composition comprises a non-staphylococcus bacterium.
  • compositions are formulated in a pharmaceutically acceptable formulation.
  • the staphylococci for which a subject is being treated may be Staphylococcus aureus.
  • Methods of the invention also include coagulase compositions that contain one or more of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or more secreted virulence factors and/or cell surface proteins, such as Eap, Ebh, Emp, EsaC, EsxA, EsxB, SdrC, SdrD, SdrE, IsdA, IsdB, CIfA, CIfB, Coa, HIa, IsdC, SasF, SpA and variants thereof, vWbp, or vWh in various combinations.
  • a vaccine formulation includes Eap, Ebh, Emp, EsaC, EsxA, EsxB, SdrC, SdrD, SdrE, IsdA, IsdB, CIfA, CIfB, Coa, HIa, IsdC, SasF, vWbp, and vWh.
  • an antigen combination can include (1) a Coa and/or vWbp, and IsdA; (2) a Coa and/or vWbp, and CIfB; (3) a Coa and/or vWbp, and SdrD; (4) a Coa and/or vWbp, and HIa or HIa variant; (5) a Coa and/or vWbp, and CIfB, SdrD, and HIa or HIa variant; (6) a Coa and/or vWbp, and IsdA, SdrD, and HIa or HIa variant; (7) a Coa and/or vWbp, and IsdA, CIfB, and HIa or HIa variant; (8) a Coa and/or vWbp, and IsdA, CIfB, and SdrD; (9) a Coa and/or vWbp, and IsdA, CIfB, and S
  • EsxA protein refers to a protein that includes isolated wild- type EsxA polypeptides from staphylococcus bacteria and segments thereof, as well as variants that stimulate an immune response against staphylococcus bacteria EsxA proteins.
  • EsxB protein refers to a protein that includes isolated wild- type EsxB polypeptides from staphylococcus bacteria and segments thereof, as well as variants that stimulate an immune response against staphylococcus bacteria EsxB proteins.
  • SdrD protein refers to a protein that includes isolated wild-type SdrD polypeptides from staphylococcus bacteria and segments thereof, as well as variants that stimulate an immune response against staphylococcus bacteria SdrD proteins.
  • SdrE protein refers to a protein that includes isolated wild-type SdrE polypeptides from staphylococcus bacteria and segments thereof, as well as variants that stimulate an immune response against staphylococcus bacteria SdrE proteins.
  • IsdA protein refers to a protein that includes isolated wild-type IsdA polypeptides from staphylococcus bacteria and segments thereof, as well as variants that stimulate an immune response against staphylococcus bacteria IsdA proteins.
  • IsdB protein refers to a protein that includes isolated wild-type IsdB polypeptides from staphylococcus bacteria and segments thereof, as well as variants that stimulate an immune response against staphylococcus bacteria IsdB proteins.
  • Ep protein refers to a protein that includes isolated wild-type Eap polypeptides from staphylococcus bacteria and segments thereof, as well as variants that stimulate an immune response against staphylococcus bacteria Eap proteins.
  • Ebh protein refers to a protein that includes isolated wild-type Ebh polypeptides from staphylococcus bacteria and segments thereof, as well as variants that stimulate an immune response against staphylococcus bacteria Ebh proteins.
  • Emp protein refers to a protein that includes isolated wild-type Emp polypeptides from staphylococcus bacteria and segments thereof, as well as variants that stimulate an immune response against staphylococcus bacteria Emp proteins.
  • EsaB protein refers to a protein that includes isolated wild-type EsaB polypeptides from staphylococcus bacteria and segments thereof, as well as variants that stimulate an immune response against staphylococcus bacteria EsaB proteins.
  • EsaC protein refers to a protein that includes isolated wild-type EsaC polypeptides from staphylococcus bacteria and segments thereof, as well as variants that stimulate an immune response against staphylococcus bacteria EsaC proteins.
  • SdrC protein refers to a protein that includes isolated wild-type SdrC polypeptides from staphylococcus bacteria and segments thereof, as well as variants that stimulate an immune response against staphylococcus bacteria SdrC proteins.
  • CIfA protein refers to a protein that includes isolated wild-type CIfA polypeptides from staphylococcus bacteria and segments thereof, as well as variants that stimulate an immune response against staphylococcus bacteria CIfA proteins.
  • CIfB protein refers to a protein that includes isolated wild-type CIfB polypeptides from staphylococcus bacteria and segments thereof, as well as variants that stimulate an immune response against staphylococcus bacteria CIfB proteins.
  • Coa protein refers to a protein that includes isolated wild-type Coa polypeptides from staphylococcus bacteria and segments thereof, as well as variants that stimulate an immune response against staphylococcus bacteria Coa proteins.
  • HIa protein refers to a protein that includes isolated wild-type HIa polypeptides from staphylococcus bacteria and segments thereof, as well as variants that stimulate an immune response against staphylococcus bacteria HIa proteins.
  • IsdC protein refers to a protein that includes isolated wild-type IsdC polypeptides from staphylococcus bacteria and segments thereof, as well as variants that stimulate an immune response against staphylococcus bacteria IsdC proteins.
  • SasF protein refers to a protein that includes isolated wild-type SasF polypeptides from staphylococcus bacteria and segments thereof, as well as variants that stimulate an immune response against staphylococcus bacteria SasF proteins.
  • vWbp protein refers to a protein that includes isolated wild- type vWbp (von Willebrand factor binding protein) polypeptides from staphylococcus bacteria and segments thereof, as well as variants that stimulate an immune response against staphylococcus bacteria vWbp proteins.
  • vWbp von Willebrand factor binding protein
  • vWh protein refers to a protein that includes isolated wild-type vWh (von Willebrand factor binding protein homolog) polypeptides from staphylococcus bacteria and segments thereof, as well as variants that stimulate an immune response against staphylococcus bacteria vWh proteins.
  • vWh von Willebrand factor binding protein homolog
  • An immune response refers to a humoral response, a cellular response, or both a humoral and cellular response in an organism.
  • An immune response can be measured by assays that include, but are not limited to, assays measuring the presence or amount of antibodies that specifically recognize a protein or cell surface protein, assays measuring T-cell activation or proliferation, and/or assays that measure modulation in terms of activity or expression of one or more cytokines.
  • a composition may include a polypeptide, peptide, or protein that is or is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical or similar to an EsxA protein.
  • EsxA protein will have all or part of the amino acid sequence of SEQ ID NO: 11.
  • a composition may include a polypeptide, peptide, or protein that is or is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical or similar to an EsxB protein.
  • EsxB protein will have all or part of the amino acid sequence of SEQ ID NO: 12.
  • a composition may include a polypeptide, peptide, or protein that is or is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical or similar to an SdrD protein.
  • the SdrD protein will have all or part of the amino acid sequence of SEQ ID NO:13.
  • a composition may include a polypeptide, peptide, or protein that is or is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical or similar to an SdrE protein.
  • the SdrE protein will have all or part of the amino acid sequence of SEQ ID NO: 14.
  • a composition may include a polypeptide, peptide, or protein that is or is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical or similar to an IsdA protein.
  • the IsdA protein will have all or part of the amino acid sequence of SEQ ID NO: 15.
  • a composition may include a polypeptide, peptide, or protein that is or is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical or similar to an IsdB protein.
  • the IsdB protein will have all or part of the amino acid sequence of SEQ ID NO:16.
  • Embodiments of the invention include compositions that include a polypeptide, peptide, or protein that is or is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical or similar to a EsaB protein.
  • the EsaB protein will have all or part of the amino acid sequence of SEQ ID NO: 17.
  • a composition may include a polypeptide, peptide, or protein that is or is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical or similar to a CIfB protein.
  • the CIfB protein will have all or part of the amino acid sequence of SEQ ID NO: 18.
  • a composition may include a polypeptide, peptide, or protein that is or is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical or similar to an IsdC protein.
  • the IsdC protein will have all or part of the amino acid sequence of SEQ ID NO: 19.
  • a composition may include a polypeptide, peptide, or protein that is or is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical or similar to a SasF protein.
  • the SasF protein will have all or part of the amino acid sequence of SEQ ID NO:20.
  • a composition may include a polypeptide, peptide, or protein that is or is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical or similar to a SdrC protein.
  • the SdrC protein will have all or part of the amino acid sequence of SEQ ID NO:21.
  • a composition may include a polypeptide, peptide, or protein that is or is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical or similar to a CIfA protein.
  • the CIfA protein will have all or part of the amino acid sequence of SEQ ID NO: 1
  • a composition may include a polypeptide, peptide, or protein that is or is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical or similar to an Eap protein.
  • the Eap protein will have all or part of the amino acid sequence of SEQ ID NO:23.
  • a composition may include a polypeptide, peptide, or protein that is or is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical or similar to an Ebh protein.
  • the Ebh protein will have all or part of the amino acid sequence of SEQ ID NO:24.
  • a composition may include a polypeptide, peptide, or protein that is or is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical or similar to an Emp protein.
  • the Emp protein will have all or part of the amino acid sequence of SEQ ID NO:25.
  • a composition may include a polypeptide, peptide, or protein that is or is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical or similar to an EsaC protein.
  • EsaC protein will have all or part of the amino acid sequence of SEQ ID NO:26. Sequence of EsaC polypeptides can be found in the protein databases and include, but are not limited to accession numbers ZP 02760162 (GI: 168727885), NP_645081.1 (GL21281993), and NP_370813.1 (GI: 15923279), each of which is incorporated herein by reference as of the priority date of this application.
  • a composition may include a polypeptide, peptide, or protein that is or is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical or similar to a Coa protein.
  • the Coa protein will have all or part of the amino acid sequence of SEQ ID NO: 1
  • a composition may include a polypeptide, peptide, or protein that is or is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical or similar to a HIa protein.
  • the HIa protein will have all or part of the amino acid sequence of SEQ ID NO:28.
  • a composition may include a polypeptide, peptide, or protein that is or is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical or similar to a vWa protein.
  • the vWa protein will have all or part of the amino acid sequence of SEQ ID NO:29.
  • a composition may include a polypeptide, peptide, or protein that is or is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical or similar to a vWbp protein.
  • the vWbp protein will have all or part of the amino acid sequence of SEQ ID NO:32.
  • a polypeptide or segment/fragment can have a sequence that is at least 85%, at least 90%, at least 95%, at least 98%, or at least 99% or more identical to the amino acid sequence of the reference polypeptide.
  • similarity refers to a polypeptide that has a sequence that has a certain percentage of amino acids that are either identical with the reference polypeptide or constitute conservative substitutions with the reference polypeptides.
  • the polypeptides described herein may include 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or more variant amino acids within at least, or at most 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105,
  • a polypeptide segment as described herein may include 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115
  • compositions may be formulated in a pharmaceutically acceptable composition.
  • the staphylococcus bacterium is an S. aureus bacterium.
  • a composition may be administered more than one time to the subject, and may be administered 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20 or more times.
  • the administration of the compositions include, but is not limited to oral, parenteral, subcutaneous, intramuscular, intravenous, or various combinations thereof, including inhalation or aspiration.
  • a composition comprises a recombinant nucleic acid molecule encoding a polypeptide described herein or segments/fragments thereof.
  • a recombinant nucleic acid molecule encoding a polypeptide described herein contains a heterologous promoter.
  • a recombinant nucleic acid molecule of the invention is a vector, in still other aspects the vector is a plasmid. In certain embodiments the vector is a viral vector.
  • a composition includes a recombinant, non-staphylococcus bacterium containing or expressing a polypeptide described herein.
  • the recombinant non- staphylococcus bacteria is Salmonella or another gram-positive bacteria.
  • a composition is typically administered to mammals, such as human subjects, but administration to other animals that are capable of eliciting an immune response is contemplated.
  • the staphylococcus bacterium containing or expressing the polypeptide is Staphylococcus aureus.
  • the immune response is a protective immune response.
  • a composition comprises a recombinant nucleic acid molecule encoding all or part of one or more of a Eap, Ebh, Emp, EsaB, EsaC, EsxA, EsxB, SdrC, SdrD, SdrE, IsdA, IsdB, CIfA, CIfB, Coa, HIa, IsdC, SasF, SpA, vWbp, or vWh protein or peptide or variant thereof.
  • Additional staphylococcal antigens that can be used in combination with the polypeptides described herein include, but are not limited to 52kDa vitronectin binding protein (WO 01/60852), Aaa, Aap, Ant, autolysin glucosaminidase, autolysin amidase, Cna, collagen binding protein (US6288214), EFB (FIB), Elastin binding protein (EbpS), EPB, FbpA, fibrinogen binding protein (US6008341), Fibronectin binding protein (US5840846), FnbA, FnbB, GehD (US 2002/0169288), HarA, HBP, Immunodominant ABC transporter, IsaA/PisA, laminin receptor, Lipase GehD, MAP, Mg2+ transporter, MHC II analogue (US5648240), MRPII, Npase, RNA III activating protein (RAP), SasA, SasB, SasC, Sas
  • compositions of the invention are typically administered to human subjects, but administration to other animals that are capable of eliciting an immune response to a staphylococcus bacterium is contemplated, particularly cattle, horses, goats, sheep and other domestic animals, i.e., mammals.
  • the staphylococcus bacterium is a Staphylococcus aureus.
  • the immune response is a protective immune response.
  • the methods and compositions of the invention can be used to prevent, ameliorate, reduce, or treat infection of tissues or glands, e.g., mammary glands, particularly mastitis and other infections.
  • Other methods include, but are not limited to prophylactically reducing bacterial burden in a subject not exhibiting signs of infection, particularly those subjects suspected of or at risk of being colonized by a target bacteria, e.g., patients that are or will be at risk or susceptible to infection during a hospital stay, treatment, and/or recovery.
  • any embodiment discussed with respect to one aspect of the invention applies to other aspects of the invention as well.
  • any embodiment discussed in the context of a SpA variant polypeptide or peptide or nucleic acid may be implemented with respect to other antigens, such as Eap, Ebh, Emp, EsaC, EsxA, EsxB, SdrC, SdrD, SdrE, IsdA, IsdB, CIfA, CIfB, Coa, HIa, IsdC, SasF, vWbp, vWh, 52kDa vitronectin binding protein (WO 01/60852), Aaa, Aap, Ant, autolysin glucosaminidase, autolysin amidase, Cna, collagen binding protein (US6288214), EFB (FIB), Elastin binding protein (EbpS), EPB, FbpA, fibrinogen binding protein (US6008341), Fibronectin binding protein (US5840), Eap
  • Embodiments of the invention include compositions that contain or do not contain a bacterium.
  • a composition may or may not include an attenuated or viable or intact staphylococcal bacterium.
  • the composition comprises a bacterium that is not a staphylococcal bacterium or does not contain staphylococcal bacteria.
  • a bacterial composition comprises an isolated or recombinantly expressed staphylococcal Protein A variant or a nucleotide encoding the same.
  • the composition may be or include a recombinantly engineered staphylococcus bacterium that has been altered in a way that comprises specifically altering the bacterium with respect to a secreted virulence factor or cell surface protein.
  • the bacteria may be recombinantly modified to express more of the virulence factor or cell surface protein than it would express if unmodified.
  • isolated can refer to a nucleic acid or polypeptide that is substantially free of cellular material, bacterial material, viral material, or culture medium (when produced by recombinant DNA techniques) of their source of origin, or chemical precursors or other chemicals (when chemically synthesized).
  • an isolated compound refers to one that can be administered to a subject as an isolated compound; in other words, the compound may not simply be considered “isolated” if it is adhered to a column or embedded in an agarose gel.
  • an "isolated nucleic acid fragment” or “isolated peptide” is a nucleic acid or protein fragment that is not naturally occurring as a fragment and/or is not typically in the functional state.
  • Moieties of the invention such as polypeptides, peptides, antigens, or immunogens, may be conjugated or linked covalently or noncovalently to other moieties such as adjuvants, proteins, peptides, supports, fluorescence moieties, or labels.
  • the term "conjugate” or “immunoconjugate” is broadly used to define the operative association of one moiety with another agent and is not intended to refer solely to any type of operative association, and is particularly not limited to chemical "conjugation.” Recombinant fusion proteins are particularly contemplated.
  • Compositions of the invention may further comprise an adjuvant or a pharmaceutically acceptable excipient.
  • An adjuvant may be covalently or non- covalently coupled to a polypeptide or peptide of the invention.
  • the adjuvant is chemically conjugated to a protein, polypeptide, or peptide.
  • the term "providing” is used according to its ordinary meaning to indicate "to supply or furnish for use.”
  • the protein is provided directly by administering the protein, while in other embodiments, the protein is effectively provided by administering a nucleic acid that encodes the protein.
  • the invention contemplates compositions comprising various combinations of nucleic acid, antigens, peptides, and/or epitopes.
  • compositions of the present invention include immunogenic compositions wherein the antigen(s) or epitope(s) are contained in an amount effective to achieve the intended purpose. More specifically, an effective amount means an amount of active ingredients necessary to stimulate or elicit an immune response, or provide resistance to, amelioration of, or mitigation of infection. In more specific aspects, an effective amount prevents, alleviates or ameliorates symptoms of disease or infection, or prolongs the survival of the subject being treated. Determination of the effective amount is well within the capability of those skilled in the art, especially in light of the detailed disclosure provided herein.
  • an effective amount or dose can be estimated initially from in vitro studies, cell culture, and/or animal model assays.
  • a dose can be formulated in animal models to achieve a desired immune response or circulating antibody concentration or titer. Such information can be used to more accurately determine useful doses in humans.
  • FIG. IB Amino acid sequence of the five IgBDs as well as nontoxigenic SpA-D K ⁇ AA, with the positions of triple ⁇ -helical bundles (Hl, H2 and H3) as well as glutamine (Q) 9, 10 and aspartate (D) 36, 37 indicated.
  • FIG. ID ELISA examining the association of immobilized SpA, SpA-D or SpA-D K ⁇ AA with human IgG as well as its Fc or F(ab) 2 fragments and von Willebrand factor (vWF).
  • FIG. IE CD 19+ B lymphocytes in splenic tissue of BALB/c mice that had been mock immunized or treated with SpA-D or SpA-D ⁇ AA were quantified by FACS.
  • FIG. 2 Non-toxigenic protein A vaccine prevents abscess formation. Histopathology of renal tissue isolated during necropsy of BALB/c mice that had been mock immunized (PBS) or vaccinated with SpA, SpA-D as well as SpA-D ⁇ AA and challenged with S. aureus Newman. Thin sectioned tissues were stained with hematoxylin-eosin. White arrows identify polymorphonuclear leukocyte (PMN) infiltrates. Dark arrows identify staphylococcal abscess communities.
  • PMN polymorphonuclear leukocyte
  • FIGs. 3A-C Antibodies raised by the non-toxigenic protein A vaccine block the B cell superantigen function of SpA.
  • FIG 3A Rabbit antibodies raised against SpA-D ⁇ AA were purified on a matrix with immobilized antigen and analyzed by Coomassie Blue-stained SDS-PAGE. Antibodies were cleaved with pepsin and F(ab)2 fragments were purified by a second round of affinity chromatography on SpA-D K ⁇ AA matrix.
  • FIG 3B SpA-D ⁇ AA specific F(ab)2 interfere with the binding of SpA or SpA-D to human immunoglobulin (hlgG) or, FIG 3 C, to von Willebrand Factor (vWF).
  • hlgG human immunoglobulin
  • vWF von Willebrand Factor
  • FIGs. 4A-D Full-length non-toxigenic protein A generates improved immune responses.
  • FIG 4 A Full-length SpA K ⁇ AA was purified on Ni-NTA sepharose and analyzed by Coomassie-Blue stained SDS-PAGE.
  • FIG 4B CD 19+ B lymphocytes in splenic tissue of BALB/c mice that had been mock immunized or treated with SpA or SPA KKAA were quantified by FACS.
  • FIG 4C ELISA examining the association of immobilized SpA or SpA K ⁇ AA with human IgG as well as its Fc or F(ab)2 fragments or von Willebrand factor (vWF).
  • vWF von Willebrand factor
  • FIGs. 6A-B Antibodies against protein A protect mice against lethal S. aureus infections.
  • FIG. 7 SpA K ⁇ AA immunization protects mice against challenge with the vancomycin-resistant MRSA isolated Mu50.
  • Each animal was subsequently infected by intravenous injection with a suspension of 3 x 10 7 CFU S. aureus Mu50.
  • Staphylococcal load calculated as loglO CFU g "1 , was determined in homogenized renal tissues 4 days following infection. Statistical significance was calculated with the unpaired two-tailed Students t-test and P-value recorded.
  • FIGs. 8A-B Lack of protective immune responses to staphylococcal infections.
  • FIG 8A Staphylococcal infection does not generate protective immunity.
  • FIG 8B IsdB immunization does not protect mice against S. aureus USA300 (LAC) challenge.
  • IsdB 100 ⁇ g IsdB emulsified in CFA followed by IFA/IsdB booster on day 11
  • retro-orbital injection 5 ⁇ 10 6 CFU S. aureus US A300 (LAC) on day 21.
  • kidneys were removed during necropsy and staphylococcal load per gram of homogenized tissue enumerated by colony formation on agar plates.
  • FIG. 9 Comparison of abscess formation in mice treated with PBS, SpA, SpA-D and SpA-D ⁇ AA-
  • FIGs. 10A-10H Localization of prothrombin, fibrinogen, coagulase (Coa), and von Willebrand factor binding protein (vWbp) in staphylococcal abscesses.
  • FIG. 1OF, 10H Displayed images are representative of three sampled kidneys.
  • Panels FIG. 1OC, 10D, 1OG, and 1OH illustrate antibody staining within a single abscess analyzed as four sequential sections, enlarged from an area in panels FIG. 1OA, 1OB, 1OE, and 1OF that is defined by box with white margins.
  • FIGs. 1 IA-11C Staphylococcus aureus coa and vWbp mutants display defects in blood clotting.
  • FIG. 1 IA Diagram illustrating the primary translational product of coa and vWbp including signal peptide (S), the Dl and D2 domain from prothrombin binding, a domain of unknown function, von Willebrand factor (vWF) binding site on vWbp, and the fibrinogen binding repeats (R) of Coa. Numbers indicate amino acid residues.
  • FIG. HB Culture supernatants from S.
  • aureus Newman wild-type or isogenic variants lacking coa (Acoa), vWbp (AvWbp) or both genes (Acoa, AvWbp) were examined by immunob lotting with antibodies specific for Coa ( ⁇ Coa) or vWbp ( ⁇ vWbp).
  • plasmids expressing the wild-type alleles of coa (pco ⁇ ) or vWbp (pvWbp) were electroporated into staphylococcal strains and subsequently analyzed by immunob lotting.
  • FIG. HC Lepirudin-treated mouse blood was mock treated or infected with S. aureus Newman or its isogenic coagulase variants and incubated for up to 48 hours at 25°C. Tubes were tilted to assess for coagulation. Data are representative of four independent determinations.
  • FIGs. 12A-12R Contributions of coa and vWbp to bacterial survival in blood and S. aureus induced lethal bacteremia of mice.
  • FIG. 12A Staphylococcal strains Newman, ⁇ coa, ⁇ vWbp or ⁇ coa, ⁇ vWbp and the complemented variants were incubated with lepirudin anticoagulated mouse blood for 30 minutes and bacterial survival assessed by colony formation on agar plates. Data were generated from three separate trials.
  • FIG. 12B Cohorts of 10 mice were injected into the retro-orbital plexus with Ix IO 8 CFU of S.
  • mice were given IxIO 7 CFU of staphylococcal strains Newman (FIG. 12C, E and K, M), ⁇ vWbp (FIG. 14D, F and M, L), ⁇ coa (FIG. 14G, I and O, Q) or ⁇ coa, ⁇ vWbp (FIG. 12H, J and P, R), harvested on days 5 (FIG. 12C-J) or 15 (FIG. 12K-R) and assessed for bacterial load in the renal tissue (Table 7) and histopathological abscess formation. All animal data are representative of two independent experiments.
  • FIGs. 13A-13D Antibodies against Coa and vWbp block the clotting of blood by staphylococcal coagulases.
  • FIG. 13A His6-Coa and His ⁇ -vWbp were purified by affinity chromatography from E. coli and analyzed on Coomassie-stained SDS-PAGE.
  • FIG. 13B Rabbit antibodies raised against His 6 -Coa or His 6 -vWbp were affinity purified and analyzed by ELISA for immune reactivity with purified coagulases. Data are averaged from three independent experimental determinations.
  • FIG. 13A His6-Coa and His ⁇ -vWbp were purified by affinity chromatography from E. coli and analyzed on Coomassie-stained SDS-PAGE.
  • FIG. 13B Rabbit antibodies raised against His 6 -Coa or His 6 -vWbp were affinity purified and analyzed by ELISA for immune reactivity with purified coagulases. Data are averaged from three independent experimental
  • Lepirudin-treated mouse blood was treated with PBS (mock), irrelevant antibodies ( ⁇ VIO) or antibodies directed against Coa ( ⁇ Coa), vWbp ( ⁇ vWbp) or both coagulases ( ⁇ Coa/ ⁇ vWbp) prior to infection with S. aureus Newman and incubation for 48 hours at 25°C.
  • FIG. 13D Lepirudin-treated mouse blood was treated with antibodies as above. Blood samples were then incubated with functionally active Coa or vWbp and coagulation time recorded.
  • FIGs. 14A-14F Biological effects of antibodies directed against staphylococcal coagulases.
  • Response differences upon addition of coagulase (Coa) to either prothrombin (FIG. 14A) or fibrinogen (FIG. 14B) were compared to response differences in the presence of increasing amounts of antibodies ( ⁇ Coa - 1 :1, 1 :2, 1 :4, 1 :8).
  • FIG. 14E, F Purified active Coa or vWbp was incubated in a 1 :1 molar ratio with human prothrombin. The enzymatic ability of the complex was assessed by monitoring the rate of S-2238 cleavage (fibrinogen substitute chromogenic substrate, given in excess). The assay was repeated in presence of specific or cross antibodies added in 3M excess and the data was normalized to the % average activity without inhibition. Data are an average of three independent trials.
  • FIGs. 16A-16H Passive transfer of coagulase antibodies confers protection against S. aureus abscess formation.
  • An experimental mock PBS, FIG. 18A and 18C
  • purified rabbit antibodies directed against vWbp ⁇ vWbp, FIG. 18B and 18D
  • Coa ⁇ Coa
  • FIG. 18E and 18G both coagulases
  • ⁇ Coa / ⁇ vWbp FIG. 18F and 18H
  • FIG. 17s A-H Immunization with coagulases protects mice against S. aureus abscess formation.
  • animals were challenged by injecting 1 x 10 7 CFU S. aureus Newman into the retro-orbital plexus. Bacterial load and abscess formation were determined following necropsy in the kidneys of animals that had been killed five days following infection. Renal tissues were fixed with paraformaldehyde, embedded in paraffin, thin sectioned, stained with hematoxylin-eosin and histopathology images acquired by light microscopy. Data are representative of two separate experiments.
  • Staphylococcus aureus is a commensal of the human skin and nares, and the leading cause of bloodstream, skin and soft tissue infections (Klevens et al, 2007). Recent dramatic increases in the mortality of staphylococcal diseases are attributed to the spread of methicillin-resistant S. aureus (MRSA) strains often not susceptible to antibiotics (Kennedy et al., 2008). In a large retrospective study, the incidence of MRSA infections was 4.6% of all hospital admissions in the United States (Klevens et al., 2007). The annual health care costs for 94,300 MRSA infected individuals in the United States exceed $2.4 billion (Klevens et al., 2007). The current MRSA epidemic has precipitated a public health crisis that needs to be addressed by development of a preventive vaccine (Boucher and Corey, 2008). To date, an FDA licensed vaccine that prevents S. aureus diseases is not available.
  • the inventors describe here the use of Protein A, a cell wall anchored surface protein of staphylococci, for the generation of variants that can serve as subunit vaccines.
  • the pathogenesis of staphylococcal infections is initiated as bacteria invade the skin or blood stream via trauma, surgical wounds, or medical devices (Lowy, 1998). Although the invading pathogen may be phagocytosed and killed, staphylococci can also escape innate immune defenses and seed infections in organ tissues, inducing inflammatory responses that attract macrophages, neutrophils, and other phagocytes (Lowy, 1998).
  • necrotic tissue debris The responsive invasion of immune cells to the site of infection is accompanied by liquefaction necrosis as the host seeks to prevent staphylococcal spread and allow for removal of necrotic tissue debris (Lam et al. , 1963). Such lesions can be observed by microscopy as hypercellular areas containing necrotic tissue, leukocytes, and a central nidus of bacteria (Lam et al., 1963). Unless staphylococcal abscesses are surgically drained and treated with antibiotics, disseminated infection and septicemia produce a lethal outcome (Sheagren, 1984).
  • SpA Staphylcoccal Protein A
  • All Staphylococcus aureus strains express the structural gene for Protein A (spa) (Jensen, 1958 ; Said-Salim et al., 2003), a well characterized virulence factor whose cell wall anchored surface protein product (SpA) encompasses five highly homologous immunoglobulin binding domains designated E, D, A, B, and C (Sjodahl, 1977). These domains display ⁇ 80% identity at the amino acid level, are 56 to 61 residues in length, and are organized as tandem repeats (UhI en et al., 1984).
  • SpA is synthesized as a precursor protein with an N-terminal YSIRK/GS signal peptide and a C-terminal LPXTG motif sorting signal (DeDent et al., 2008; Schneewind et al., 1992). Cell wall anchored Protein A is displayed in great abundance on the staphylococcal surface (DeDent et al., 2007; Sjoquist et al., 1972).
  • Each of its immunoglobulin binding domains is composed of anti-parallel ⁇ -helices that assemble into a three helix bundle and bind the Fc domain of immunoglobulin G (IgG) (Deisenhofer, 1981; Deisenhofer et al., 1978), the VH3 heavy chain (Fab) of IgM (i.e., the B cell receptor) (Graille et al., 2000), the von Willebrand factor at its Al domain [vWF AI is a ligand for platelets] (O'Seaghdha et al., 2006) and the tumor necrosis factor ⁇ (TNF- ⁇ ) receptor I (TNFRI) (Gomez et al., 2006), which is displayed on surfaces of airway epithelia (Gomez et al., 2004; Gomez et al., 2007).
  • IgG immunoglobulin G
  • Fab VH3 heavy chain
  • vWF AI is a ligand for platelets
  • SpA impedes neutrophil phagocytosis of staphylococci through its attribute of binding the Fc component of IgG (Jensen, 1958; Uhlen et al., 1984). Moreover, SpA is able to activate intravascular clotting via its binding to von Willebrand factor AI domains (Hartleib et al., 2000).
  • Plasma proteins such as fibrinogen and fibronectin act as bridges between staphylococci (CIfA and CIfB) and the platelet integrin GPIIb/IIIa (O'Brien et al., 2002), an activity that is supplemented through Protein A association with vWF AI, which allows staphylococci to capture platelets via the GPIb- ⁇ platelet receptor (Foster, 2005; O'Seaghdha et al., 2006).
  • SpA also binds TNFRI and this interaction contributes to the pathogenesis of staphylococcal pneumonia (Gomez et al, 2004).
  • SpA activates proinflammatory signaling through TNFRl mediated activation of TRAF2, the p38/c-Jun kinase, mitogen activate protein kinase (MAPK) and the Rel-transcription factor NF-KB.
  • SpA binding further induces TNFRl shedding, an activity that appears to require the TNF-converting enzyme (TACE)(Gomez et al, 2007). All of the aforementioned SpA activities are mediated through its five IgG binding domains and can be perturbed by the same amino acid substitutions, initially defined by their requirement for the interaction between Protein A and human IgGl (Cedergren et al, 1993.
  • SpA also functions as a B cell superantigen by capturing the Fab region of VH3 bearing IgM, the B cell receptor (Gomez et al, 2007; Goodyear et al, 2003; Goodyear and Silverman, 2004; Roben et al, 1995).
  • Stphylococcal Protein A (SpA) mutations show a reduction in staphylococcal load in organ tissues and dramatically diminished ability to form abscesses (described herein). During infection with wildtype S.
  • abscesses are formed within forty-eight hours and are detectable by light microscopy of hematoxylin-eosin stained, thin-sectioned kidney tissue, initially marked by an influx of polymorphonuclear leukocytes (PMNs).
  • PMNs polymorphonuclear leukocytes
  • abscesses increase in size and enclosed a central population of staphylococci, surrounded by a layer of eosinophilic, amorphous material and a large cuff of PMNs. Histopathology revealed massive necrosis of PMNs in proximity to the staphylococcal nidus at the center of abscess lesions as well as a mantle of healthy phagocytes.
  • the inventors also observed a rim of necrotic PMNs at the periphery of abscess lesions, bordering the eosinophilic pseudocapsule that separated healthy renal tissue from the infectious lesion. Staphylococcal variants lacking Protein A are unable to establish the histopathology features of abscesses and are cleared during infection.
  • Brown et al. also report that L21H and F17H substitutions decrease the binding affinity by five-fold and a hundred-fold respectively.
  • Graille et al. (2000) describe a crystal structure of domain D of SpA and the Fab fragment of a human IgM antibody.
  • Graille et al. define by analysis of a crystal structure the D domain amino acid residues that interact with the Fab fragment as residues Q26, G29, F30, Q32, S33, D36, D37, Q40, N43, E47, or L51, as well as the amino acid residues that form the interface between the domain D sub-domains.
  • Graille et al. define the molecular interactions of these two proteins, but is silent in regard to any use of substitutions in the interacting residues in producing a vaccine antigen.
  • Gomez et al. (2006) describe the identifcation of residues responsible for activation of the TNFRl by using single mutations of F5A, F13A, Y14A, L17A, N21A, BlA, Q32A, and K35A. Gomez et al is silent in regard to any use of substitutions in the interacting residues in producing a vaccine antigen.
  • Recombinant affinity tagged Protein A a polypeptide encompassing the five IgG domains (EDCAB) (Sjodahl, 1977) but lacking the C-terminal Region X (Guss et al, 1984), was purified from recombinant E. coli and used as a vaccine antigen (Stranger- Jones et al, 2006). Because of the attributes of SpA in binding the Fc portion of IgG, a specific humoral immune response to Protein A could not be measured (Stranger- Jones et al, 2006). The inventors have overcome this obstacle through the generation of SpA-DQ9,10K;D36,37A.
  • SpA Protein A
  • Each of the five SpA domains i.e., domains formed from three helix bundles designated E, D, A, B, and C
  • E, D, A, B, and C exerts similar binding properties (Jansson et al, 1998).
  • the solution and crystal structure of the domain D has been solved both with and without the Fc and VH3 (Fab) ligands, which bind Protein A in a non-competitive manner at distinct sites (Graille et al, 2000).
  • SpA specifically targets a subset of B cells that express VH3 family related IgM on their surface, i.e., VH3 type B cell receptors (Roben et al, 1995). Upon interaction with SpA, these B cells proliferate and commit to apoptosis, leading to preferential and prolonged deletion of innate-like B lymphocytes (i.e., marginal zone B cells and follicular B2 cells)(Goodyear et al, 2003; Goodyear et al, 2004).
  • innate-like B lymphocytes i.e., marginal zone B cells and follicular B2 cells
  • Protein A is synthesized as a precursor in the bacterial cytoplasm and secreted via its YSIRK signal peptide at the cross wall, i.e.
  • Protein A is anchored to bacterial peptidoglycan crossbridges by sortase A (Mazmanian et al, 1999; Schneewind et al, 1995; Mazmanian et al, 2000). Protein A is the most abundant surface protein of staphylococci; the molecule is expressed by virtually all S. aureus strains (Cespedes et al, 2005; Kennedy et al, 2008; Said-Salim et al, 2003).
  • Staphylococci turn over 15-20% of their cell wall per division cycle (Navarre and Schneewind, 1999).
  • Murine hydrolases cleave the glycan strands and wall peptides of peptidoglycan, thereby releasing Protein A with its attached C-terminal cell wall disaccharide tetrapeptide into the extracellular medium (Ton-That et al, 1999).
  • Protein A is both anchored to the cell wall and displayed on the bacterial surface but also released into surrounding tissues during host infection (Marraffini et al, 2006).
  • Protein A captures immunoglobulins on the bacterial surface and this biochemical activity enables staphylococcal escape from host innate and acquired immune responses (Jensen, 1958; Goodyear et al, 2004).
  • region X of Protein A (Guss et al, 1984), a repeat domain that tethers the IgG binding domains to the LPXTG sorting signal / cell wall anchor, is perhaps the most variable portion of the staphylococcal genome (Said-Salim, 2003; Schneewind et al, 1992).
  • Each of the five immunoglobulin binding domains of Protein A (SpA), formed from three helix bundles and designated E, D, A, B, and C, exerts similar structural and functional properties (Sjodahl, 1977; Jansson et al, 1998).
  • the solution and crystal structure of the domain D has been solved both with and without the Fc and V H 3 (Fab) ligands, which bind Protein A in a non-competitive manner at distinct sites (Graille 2000).
  • the Fab interacts with helix II and helix III of domain D via a surface composed of four VH region ⁇ -strands (Graille 2000).
  • the major axis of helix II of domain D is approximately 50° to the orientation of the strands, and the interhelical portion of domain D is most proximal to the CO strand.
  • the site of interaction on Fab is remote from the Ig light chain and the heavy chain constant region. The interaction involves the following domain D residues: Asp-36 of helix II, Asp-37 and Gln-40 in the loop between helix II and helix III and several other residues (Graille 2000).
  • Both interacting surfaces are composed predominantly of polar side chains, with three negatively charged residues on domain D and two positively charged residues on the 2A2 Fab buried by the interaction, providing an overall electrostatic attraction between the two molecules. Of the five polar interactions identified between Fab and domain D, three are between side chains. A salt bridge is formed between Arg-H19 and Asp-36 and two hydrogen bonds are made between Tyr-H59 and Asp-37 and between Asn-H82a and Ser-33. Because of the conservation of Asp-36 and Asp-37 in all five IgG binding domains of Protein A, the inventors mutated these residues.
  • the SpA-D sites responsible for Fab binding are structurally separate from the domain surface that mediates Fc ⁇ binding.
  • the interaction of Fc ⁇ with domain D primarily involves residues in helix I with lesser involvement of helix II (Gouda et al. , 1992; Deisenhofer, 1981).
  • the Gln-32 a minor contact in both complexes, none of the residues that mediate the Fc ⁇ interaction are involved in Fab binding.
  • the SpA domains in these complexes have been superimposed to construct a model of a complex between Fab, the SpA-domain D, and the Fc ⁇ molecule.
  • the Protein A immunoglobulin Fab binding activity targets a subset of B cells that express V H 3 family related IgM on their surface, i.e., these molecules function as VH3type B cell receptors (Roben et al., 1995). Upon interaction with SpA, these B cells rapidly proliferate and then commit to apoptosis, leading to preferential and prolonged deletion of innate-like B lymphocytes ⁇ i.e., marginal zone B cells and follicular B2 cells) (Goodyear and Silverman, 2004; Goodyear and Silverman, 2003).
  • Protein A functions analogously to staphylococcal superantigens (Roben et al., 1995), albeit that the latter class of molecules, for example SEB, TSST-I, TSST-2, form complexes with the T cell receptor to inappropriately stimulate host immune responses and thereby precipitating characteristic disease features of staphylococcal infections (Roben et al., 1995; Tiedemann et al., 1995).
  • SEB staphylococcal superantigens
  • TSST-I TSST-2
  • Protein A domains can viewed as displaying two different interfaces for binding with host molecules and any development of Protein A based vaccines must consider the generation of variants that do not perturb host cell signaling, platelet aggregation, sequestration of immunoglobulins or the induction of B cell proliferation and apoptosis.
  • Such Protein A variants should also be useful in analyzing vaccines for the ability of raising antibodies that block the aforementioned SpA activities and occupy the five repeat domains at their dual binding interfaces. This goal is articulated and pursued here for the first time and methods are described in detail for the generation of Protein A variants that can be used as a safe vaccine for humans.
  • glutamine (Q) 9 and 10 [numbering derived from the SpA domain D as described in Uhlen et al., 1984] were mutated, and generated lysine substitutions for both glutamines with the expectation that these abolish the ligand attributes at the first binding interface.
  • aspartate (D) 36 and 37 were mutated, each of which is required for the association with the B cell receptor. D36 and D37 were both substituted with alanine.
  • SpA-DQ9,10K;D36,37A Q9,10K and D36,37A mutations are here combined in the recombinant molecule SpA-DQ9,10K;D36,37A and tested for the binding attributes of Protein A. Further, SpA-D and SpA-DQ9,10K;D36,37A are subjected to immunization studies in mice and rabbits and analyzed for [1] the production of specific antibodies (SpA-D Ab); [2] the ability of SpA-D Ab to block the association between Protein A and its four different ligands; and, [3] the attributes of SpA-D Ab to generate protective immunity against staphylococcal infections. (See Examples section below).
  • Coagulases are enzymes produced by Staphylococcus bacteria that convert fibrinogen to fibrin. Coa and vW h activate prothrombin without proteolysis (Friedrich et al, 2003). The coagulase-prothrombin complex recognizes fibrinogen as a specific substrate, converting it directly into fibrin. The crystal structure of the active complex revealed binding of the Dl and D2 domains to prothrombin and insertion of its Ilel- VaI 2 N-terminus into the He 16 pocket, inducing a functional active site in the zymogen through conformational change (Friedrich et al, 2003).
  • Exosite I of ⁇ -thrombin, the fibrinogen recognition site, and proexosite I on prothrombin are blocked by the D2 of Coa (Friedrich et al, 2003). Nevertheless, association of the tetrameric (Coa-prothrombin) 2 complex binds fibrinogen at a new site with high affinity (Panizzi et al, 2006). This model explains the coagulant properties and efficient fibrinogen conversion by coagulase (Panizzi et al, 2006).
  • Fibrinogen is a large glycoprotein (Mr -340,000), formed by three pairs of Aa-, B ⁇ -, and y-chains covalently linked to form a "dimer of trimers," where A and B designate the fibrinopeptides released by thrombin cleavage (Panizzi et al, 2006).
  • the elongated molecule folds into three separate domains, a central fragment E that contains the N-termini of all six chains and two flanking fragments D formed mainly by the C-termini of the B ⁇ - and y-chains. These globular domains are connected by long triple-helical structures.
  • Coagulase-prothrombin complexes which convert human fibrinogen to the self-polymerizing fibrin, are not targeted by circulating thrombin inhibitors (Panizzi et al, 2006). Thus, staphylococcal coagulases bypass the physiological blood coagulation pathway.
  • aureus Newman a fully virulent clinical isolate (Duthie et al., 1952), it is described herein that coa mutants indeed display virulence defects in a lethal bacteremia and renal abscess model in mice.
  • S. aureus 8325-4 is not fully virulent and it is presumed that mutational lesions in this strain may not be able to reveal virulence defects in vivo.
  • antibodies raised against Coa or vWbp perturb the pathogenesis of S. aureus Newman infections to a degree mirroring the impact of gene deletions.
  • Coa and vWbp contribute to staphylococcal abscess formation and lethal bacteremia and may also function as protective antigens in subunit vaccines.
  • Biochemical studies document the biological value of antibodies against Coa and vWbp. By binding to antigen and blocking its association with clotting factors, the antibodies prevent the formation of Coa-prothrombin and vWbp -prothrombin complexes. Passive transfer studies revealed protection of experimental animals against staphylococcal abscess formation and lethal challenge by Coa and vWbp antibodies. Thus, Coa and vWbp neutralizing antibodies generate immune protection against staphylococcal disease.
  • staphylococcal vaccines are hindered by the multifaceted nature of staphylococcal invasion mechanisms. It is well established that live attenuated micro-organisms are highly effective vaccines; immune responses elicited by such vaccines are often of greater magnitude and of longer duration than those produced by non-replicating immunogens. One explanation for this may be that live attenuated strains establish limited infections in the host and mimic the early stages of natural infection.
  • Embodiments of the invention are directed to compositions and methods including variant SpA polypeptides and peptides, as well as other immunogenic extracellular proteins, polypeptides, and peptides (including both secreted and cell surface proteins or peptides) of gram positive bacteria for the use in mitigating or immunizing against infection.
  • the bacteria is a staphylococcus bacteria.
  • Extracellular proteins, polypeptides, or peptides include, but are not limited to secreted and cell surface proteins of the targeted bacteria.
  • the human pathogen S. aureus secretes EsxA and EsxB, two ESAT-6 like proteins, across the bacterial envelope (Burts et al, 2005, which is incorporated herein by reference).
  • Staphylococcal esxA and esxB are clustered with six other genes in the order of transcription: esxA esaA essA esaB essB essC esaC esxB.
  • Essa stands for ESAT-6 secretion accessory, system, and extracellular, respectively, depending whether the encoded proteins play an accessory (esa) or direct (ess) role for secretion, or are secreted (esx) in the extracellular milieu.
  • the entire cluster of eight genes is herein referred to as the Ess cluster.
  • EsxA, esxB, essA, essB, and essC are all required for synthesis or secretion of EsxA and EsxB. Mutants that fail to produce EsxA, EsxB, and EssC display defects in the pathogenesis of S.
  • the Staphylococcus aureus Ess pathway can be viewed as a secretion module equipped with specialized transport components (Ess), accessory factors (Esa) and cognate secretion substrates (Esx).
  • EssA, EssB and EssC are required for EsxA and EsxB secretion. Because EssA, EssB and EssC are predicted to be transmembrane proteins, it is contemplated that these proteins form a secretion apparatus. Some of the proteins in the ess gene cluster may actively transport secreted substrates (acting as motor) while others may regulate transport (regulator).
  • Regulation may be achieved, but need not be limited to, transcriptional or post- translational mechanisms for secreted polypeptides, sorting of specific substrates to defined locations ⁇ e.g., extracellular medium or host cells), or timing of secretion events during infection. At this point, it is unclear whether all secreted Esx proteins function as toxins or contribute indirectly to pathogenesis.
  • Staphylococci rely on surface protein mediated-adhesion to host cells or invasion of tissues as a strategy for escape from immune defenses. Furthermore, S. aureus utilize surface proteins to sequester iron from the host during infection. The majority of surface proteins involved in staphylococcal pathogenesis carry C-terminal sorting signals, i.e., they are covalently linked to the cell wall envelope by sortase. Further, staphylococcal strains lacking the genes required for surface protein anchoring, i.e., sortase A and B, display a dramatic defect in the virulence in several different mouse models of disease.
  • surface protein antigens represent a validated vaccine target as the corresponding genes are essential for the development of staphylococcal disease and can be exploited in various embodiments of the invention.
  • the sortase enzyme superfamily are Gram-positive transpeptidases responsible for anchoring surface protein virulence factors to the peptidoglycan cell wall layer.
  • Two sortase isoforms have been identified in Staphylococcus aureus, SrtA and SrtB. These enzymes have been shown to recognize a LPXTG motif in substrate proteins.
  • the SrtB isoform appears to be important in heme iron acquisition and iron homeostasis, whereas the SrtA isoform plays a critical role in the pathogenesis of Gram-positive bacteria by modulating the ability of the bacterium to adhere to host tissue via the covalent anchoring of adhesins and other proteins to the cell wall peptidoglycan.
  • the SpA variants described herein can be used in combination with other staphylococcal proteins such as Coa, Eap, Ebh, Emp, EsaC, EsaB, EsxA, EsxB, HIa, SdrC, SdrD, SdrE, IsdA, IsdB, CIfA, CIfB, IsdC, SasF, vWbp, and/or vWh proteins.
  • staphylococcal proteins such as Coa, Eap, Ebh, Emp, EsaC, EsaB, EsxA, EsxB, HIa, SdrC, SdrD, SdrE, IsdA, IsdB, CIfA, CIfB, IsdC, SasF, vWbp, and/or vWh proteins.
  • Certain aspects of the invention include methods and compositions concerning proteinaceous compositions including polypeptides, peptides, or nucleic acid encoding SpA variant(s) and other staphylococcal antigens such as other proteins transported by the Ess pathway, or sortase substrates. These proteins may be modified by deletion, insertion, and/or substitution.
  • the Esx polypeptides include the amino acid sequence of Esx proteins from bacteria in the Staphylococcus genus.
  • the Esx sequence may be from a particular staphylococcus species, such as Staphylococcus aureus, and may be from a particular strain, such as Newman.
  • the EsxA sequence is SAV0282 from strain Mu50 (which is the same amino acid sequence for Newman) and can be accessed using Genbank Accession Number Q99WU4 (gi
  • the EsxB sequence is SAV0290 from strain Mu50 (which is the same amino acid sequence for Newman) and can be accessed using Genbank Accession Number Q99WT7 (gi
  • Genbank Accession Number Q99WT7 gi
  • other polypeptides transported by the Ess pathway may be used, the sequences of which may be identified by one of skill in the art using databases and internet accessible resources.
  • the sortase substrate polypeptides include, but are not limited to the amino acid sequence of SdrC, SdrD, SdrE, IsdA, IsdB, CIfA, CIfB, IsdC or SasF proteins from bacteria in the Staphylococcus genus.
  • the sortase substrate polypeptide sequence may be from a particular staphylococcus species, such as Staphylococcus aureus, and may be from a particular strain, such as Newman.
  • the SdrD sequence is from strain N315 and can be accessed using Genbank Accession Number NP_373773.1 (gi
  • the SdrE sequence is from strain N315 and can be accessed using Genbank Accession Number NP_373774.1 (gi
  • the IsdA sequence is SAVl 130 from strain Mu50 (which is the same amino acid sequence for Newman) and can be accessed using Genbank Accession Number NP_371654.1 (gi
  • the IsdB sequence is SAVl 129 from strain Mu50 (which is the same amino acid sequence for Newman) and can be accessed using Genbank Accession Number NP_371653.1 (gi
  • other polypeptides transported by the Ess pathway or processed by sortase may be used, the sequences of which may be identified by one of skill in the art using databases and internet accessible resources.
  • Examples of various proteins that can be used in the context of the present invention can be identified by analysis of database submissions of bacterial genomes, including but not limited to accession numbers NC 002951 (GL57650036 and GenBank CP000046), NC 002758 (GL57634611 and GenBank BA000017), NC 002745 (GL29165615 and GenBank BA000018), NC 003923 (GL21281729 and GenBank BA000033), NC 002952 (GL49482253 and GenBank BX571856), NC_002953 (GL49484912 and GenBank BX571857), NC_007793 (GL87125858 and GenBank CP000255), NC 007795 (GL87201381 and GenBank CP000253) each of which are incorporated by reference.
  • a "protein” or “polypeptide” refers to a molecule comprising at least ten amino acid residues.
  • a wild-type version of a protein or polypeptide are employed, however, in many embodiments of the invention, a modified protein or polypeptide is employed to generate an immune response.
  • a "modified protein” or “modified polypeptide” or a “variant” refers to a protein or polypeptide whose chemical structure, particularly its amino acid sequence, is altered with respect to the wild-type protein or polypeptide.
  • a modified/variant protein or polypeptide has at least one modified activity or function (recognizing that proteins or polypeptides may have multiple activities or functions). It is specifically contemplated that a modified/variant protein or polypeptide may be altered with respect to one activity or function yet retain a wild-type activity or function in other respects, such as immunogenicity.
  • the size of a protein or polypeptide may comprise, but is not limited to, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210
  • polypeptides may be mutated by truncation, rendering them shorter than their corresponding wild-type form, but also they might be altered by fusing or conjugating a heterologous protein sequence with a particular function (e.g., for targeting or localization, for enhanced immunogenicity, for purification purposes, etc.).
  • an "amino molecule” refers to any amino acid, amino acid derivative, or amino acid mimic known in the art.
  • the residues of the proteinaceous molecule are sequential, without any non-amino molecule interrupting the sequence of amino molecule residues.
  • the sequence may comprise one or more non-amino molecule moieties.
  • the sequence of residues of the proteinaceous molecule may be interrupted by one or more non-amino molecule moieties.
  • proteinaceous composition encompasses amino molecule sequences comprising at least one of the 20 common amino acids in naturally synthesized proteins, or at least one modified or unusual amino acid.
  • Proteinaceous compositions may be made by any technique known to those of skill in the art, including (i) the expression of proteins, polypeptides, or peptides through standard molecular biological techniques, (ii) the isolation of proteinaceous compounds from natural sources, or (iii) the chemical synthesis of proteinaceous materials.
  • the nucleotide as well as the protein, polypeptide, and peptide sequences for various genes have been previously disclosed, and may be found in the recognized computerized databases.
  • Genbank and GenPept databases on the World Wide Web at ncbi.nlm.nih.gov/.
  • Genbank and GenPept databases on the World Wide Web at ncbi.nlm.nih.gov/.
  • the coding regions for these genes may be amplified and/or expressed using the techniques disclosed herein or as would be known to those of ordinary skill in the art.
  • Amino acid sequence variants of SpA, coagulases and other polypeptides of the invention can be substitutional, insertional, or deletion variants.
  • a variation in a polypeptide of the invention may affect 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, or more non-contiguous or contiguous amino acids of the polypeptide, as compared to wild-type.
  • a variant can comprise an amino acid sequence that is at least 50%, 60%, 70%, 80%, or 90%, including all values and ranges there between, identical to any sequence provided or referenced herein, e.g., SEQ ID NO:2-8 or SEQ ID NO: 11-30, A variant can include 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more substitute amino acids.
  • a polypeptide processed or secreted by the Ess pathway or other surface proteins (see Table 1) or sortase substrates from any staphylococcus species and strain are contemplated for use in compositions and methods described herein.
  • Deletion variants typically lack one or more residues of the native or wild- type protein. Individual residues can be deleted or a number of contiguous amino acids can be deleted. A stop codon may be introduced (by substitution or insertion) into an encoding nucleic acid sequence to generate a truncated protein. Insertional mutants typically involve the addition of material at a non-terminal point in the polypeptide. This may include the insertion of one or more residues. Terminal additions, called fusion proteins, may also be generated. These fusion proteins include multimers or concatamers of one or more peptide or polypeptide described or referenced herein.
  • Substitutional variants typically contain the exchange of one amino acid for another at one or more sites within the protein, and may be designed to modulate one or more properties of the polypeptide, with or without the loss of other functions or properties. Substitutions may be conservative, that is, one amino acid is replaced with one of similar shape and charge.
  • Conservative substitutions are well known in the art and include, for example, the changes of: alanine to serine; arginine to lysine; asparagine to glutamine or histidine; aspartate to glutamate; cysteine to serine; glutamine to asparagine; glutamate to aspartate; glycine to proline; histidine to asparagine or glutamine; isoleucine to leucine or valine; leucine to valine or isoleucine; lysine to arginine; methionine to leucine or isoleucine; phenylalanine to tyrosine, leucine or methionine; serine to threonine; threonine to serine; tryptophan to tyrosine; tyrosine to tryptophan or phenylalanine; and valine to isoleucine or leucine.
  • substitutions may be non-conservative such that a function or activity of the polypeptide is affected.
  • Non-conservative changes typically involve substituting a residue with one that is chemically dissimilar, such as a polar or charged amino acid for a nonpolar or uncharged amino acid, and vice versa.
  • Proteins of the invention may be recombinant, or synthesized in vitro.
  • a non-recombinant or recombinant protein may be isolated from bacteria. It is also contemplated that a bacteria containing such a variant may be implemented in compositions and methods of the invention. Consequently, a protein need not be isolated.
  • amino acid and nucleic acid sequences may include additional residues, such as additional N- or C-terminal amino acids, or 5' or 3' sequences, respectively, and yet still be essentially as set forth in one of the sequences disclosed herein, so long as the sequence meets the criteria set forth above, including the maintenance of biological protein activity (e.g., immunogenicity) where protein expression is concerned.
  • the addition of terminal sequences particularly applies to nucleic acid sequences that may, for example, include various non-coding sequences flanking either of the 5 ' or 3' portions of the coding region.
  • amino acids of a protein may be substituted for other amino acids in a protein structure with or without appreciable loss of interactive binding capacity with structures such as, for example, antigen-binding regions of antibodies or binding sites on substrate molecules. Since it is the interactive capacity and nature of a protein that defines that protein's functional activity, certain amino acid substitutions can be made in a protein sequence, and in its underlying DNA coding sequence, and nevertheless produce a protein with a desirable property. It is thus contemplated by the inventors that various changes may be made in the DNA sequences of genes.
  • compositions of the invention there is between about 0.001 mg and about 10 mg of total polypeptide, peptide, and/or protein per ml.
  • concentration of protein in a composition can be about, at least about or at most about 0.001, 0.010, 0.050, 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1.0, 1.5, 2.0, 2.5, 3.0, 3.5, 4.0, 4.5, 5.0, 5.5, 6.0, 6.5, 7.0, 7.5, 8.0, 8.5, 9.0, 9.5, 10.0 mg/ml or more (or any range derivable therein).
  • the present invention contemplates the administration of variant SpA polypeptides or peptides to effect a preventative therapy or therapeutic effect against the development of a disease or condition associated with infection by a staphylococcus pathogen.
  • combinations of staphylococcal antigens are used in the production of an immunogenic composition that is effective at treating or preventing staphylococcal infection.
  • Staphylococcal infections progress through several different stages.
  • the staphylococcal life cycle involves commensal colonization, initiation of infection by accessing adjoining tissues or the bloodstream, and/or anaerobic multiplication in the blood.
  • the interplay between S. aureus virulence determinants and the host defense mechanisms can induce complications such as endocarditis, metastatic abscess formation, and sepsis syndrome.
  • Different molecules on the surface of the bacterium are involved in different steps of the infection cycle.
  • Combinations of certain antigens can elicit an immune response which protects against multiple stages of staphylococcal infection.
  • the effectiveness of the immune response can be measured either in animal model assays and/or using an opsonophagocytic assay.
  • the present invention describes polypeptides, peptides, and proteins and immunogenic fragments thereof for use in various embodiments of the present invention.
  • specific polypeptides are assayed for or used to elicit an immune response.
  • all or part of the proteins of the invention can also be synthesized in solution or on a solid support in accordance with conventional techniques.
  • Various automatic synthesizers are commercially available and can be used in accordance with known protocols. See, for example, Stewart and Young, (1984); Tarn et al, (1983); Merrifield, (1986); and Barany and Merrifield (1979), each incorporated herein by reference.
  • recombinant DNA technology may be employed wherein a nucleotide sequence which encodes a peptide of the invention is inserted into an expression vector, transformed or transfected into an appropriate host cell and cultivated under conditions suitable for expression.
  • One embodiment of the invention includes the use of gene transfer to cells, including microorganisms, for the production and/or presentation of polypeptides or peptides.
  • the gene for the polypeptide or peptide of interest may be transferred into appropriate host cells followed by culture of cells under the appropriate conditions.
  • the generation of recombinant expression vectors, and the elements included therein, are well known in the art and briefly discussed herein.
  • the protein to be produced may be an endogenous protein normally synthesized by the cell that is isolated and purified.
  • Another embodiment of the present invention uses autologous B lymphocyte cell lines, which are transfected with a viral vector that expresses an immunogen product, and more specifically, a protein having immunogenic activity.
  • mammalian host cell lines include, but are not limited to Vera and HeLa cells, other B- and T- cell lines, such as CEM, 721.221, H9, Jurkat, Raji, as well as cell lines of Chinese hamster ovary, W138, BHK, COS-7, 293, HepG2, 3T3, RIN and MDCK cells.
  • a host cell strain may be chosen that modulates the expression of the inserted sequences, or that modifies and processes the gene product in the manner desired. Such modifications (e.g.
  • glycosylation and processing (e.g. , cleavage) of protein products may be important for the function of the protein.
  • Different host cells have characteristic and specific mechanisms for the post- translational processing and modification of proteins. Appropriate cell lines or host systems can be chosen to ensure the correct modification and processing of the foreign protein expressed.
  • a number of selection systems may be used including, but not limited to HSV thymidine kinase, hypoxanthine-guanine phosphoribosyltransferase, and adenine phosphoribosyltransferase genes, in tk-, hgprt- or aprt- cells, respectively.
  • antimetabolite resistance can be used as the basis of selection: for dhfr, which confers resistance to trimethoprim and methotrexate; gpt, which confers resistance to mycophenolic acid; neo, which confers resistance to the aminoglycoside G418; and hygro, which confers resistance to hygromycin.
  • Animal cells can be propagated in vitro in two modes: as non-anchorage- dependent cells growing in suspension throughout the bulk of the culture or as anchorage-dependent cells requiring attachment to a solid substrate for their propagation ⁇ i.e., a monolayer type of cell growth).
  • Non-anchorage dependent or suspension cultures from continuous established cell lines are the most widely used means of large scale production of cells and cell products.
  • suspension cultured cells have limitations, such as tumorigenic potential and lower protein production than adherent cells.
  • a protein is specifically mentioned herein, it is preferably a reference to a native or recombinant protein or optionally a protein in which any signal sequence has been removed.
  • the protein may be isolated directly from the staphylococcal strain or produced by recombinant DNA techniques.
  • Immunogenic fragments of the protein may be incorporated into the immunogenic composition of the invention. These are fragments comprising at least 10 amino acids, 20 amino acids, 30 amino acids, 40 amino acids, 50 amino acids, or 100 amino acids, including all values and ranges there between, taken contiguously from the amino acid sequence of the protein.
  • immunogenic fragments are immunologically reactive with antibodies generated against the Staphylococcal proteins or with antibodies generated by infection of a mammalian host with Staphylococci.
  • Immunogenic fragments also include fragments that when administered at an effective dose, (either alone or as a hapten bound to a carrier), elicit a protective or therapeutic immune response against Staphylococcal infection, in certain aspects it is protective against S. aureus and/or S. epidermidis infection.
  • Such an immunogenic fragment may include, for example, the protein lacking an N-terminal leader sequence, and/or a transmembrane domain and/or a C-terminal anchor domain.
  • the immunogenic fragment according to the invention comprises substantially all of the extracellular domain of a protein which has at least 80% identity, at least 85% identity, at least 90% identity, at least 95% identity, or at least 97-99% identity, including all values and ranges there between, to a sequence selected segment of a polypeptide described or referenced herein.
  • fusion proteins composed of one or more Staphylococcal proteins, or immunogenic fragments of staphylococcal proteins.
  • Such fusion proteins may be made recombinantly and may comprise one portion of at least 1, 2, 3, 4, 5, or 6 staphylococcal proteins or segments.
  • a fusion protein may comprise multiple portions of at least 1, 2, 3, 4 or 5 staphylococcal proteins. These may combine different Staphylococcal proteins and/or multiples of the same protein or proten fragment, or immunogenic fragments in the same protein (forming a multimer or a concatamer).
  • the invention also includes individual fusion proteins of Staphylococcal proteins or immunogenic fragments thereof, as a fusion protein with heterologous sequences such as a provider of T-cell epitopes or purification tags, for example: ⁇ -galactosidase, glutathione-S-transferase, green fluorescent proteins (GFP), epitope tags such as FLAG, myc tag, poly histidine, or viral surface proteins such as influenza virus haemagglutinin, or bacterial proteins such as tetanus toxoid, diphtheria toxoid, or CRM 197.
  • heterologous sequences such as a provider of T-cell epitopes or purification tags, for example: ⁇ -galactosidase, glutathione-S-transferase, green fluorescent proteins (GFP), epitope tags such as FLAG, myc tag, poly histidine, or viral surface proteins such as influenza virus haemagglutinin, or bacterial proteins such as
  • the present invention concerns recombinant polynucleotides encoding the proteins, polypeptides, peptides of the invention.
  • the nucleic acid sequences for SpA, coagulases and other bacterial proteins are included, all of which are incorporated by reference, and can be used to prepare peptides or polypeptides.
  • polynucleotide refers to a nucleic acid molecule that either is recombinant or has been isolated free of total genomic nucleic acid.
  • polynucleotide oligonucleotides (nucleic acids of 100 residues or less in length), recombinant vectors, including, for example, plasmids, cosmids, phage, viruses, and the like.
  • Polynucleotides include, in certain aspects, regulatory sequences, isolated substantially away from their naturally occurring genes or protein encoding sequences.
  • Polynucleotides may be single- stranded (coding or antisense) or double-stranded, and may be RNA, DNA (genomic, cDNA or synthetic), analogs thereof, or a combination thereof. Additional coding or non-coding sequences may, but need not, be present within a polynucleotide.
  • the term “gene,” “polynucleotide,” or “nucleic acid” is used to refer to a nucleic acid that encodes a protein, polypeptide, or peptide (including any sequences required for proper transcription, post-translational modification, or localization). As will be understood by those in the art, this term encompasses genomic sequences, expression cassettes, cDNA sequences, and smaller engineered nucleic acid segments that express, or may be adapted to express, proteins, polypeptides, domains, peptides, fusion proteins, and mutants.
  • a nucleic acid encoding all or part of a polypeptide may contain a contiguous nucleic acid sequence of: 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, 300, 310, 320, 330, 340, 350, 360, 370, 380, 390, 400, 410, 420, 430, 440, 441, 450, 460, 470, 480, 490, 500, 510, 520, 530, 540, 550, 560, 570, 580, 590, 600, 610, 620, 630, 640, 650, 660, 670, 680, 690, 700, 710, 720, 730, 740, 750, 760, 770, 780, 790, 800, 810, 820, 830, 840
  • a particular polypeptide may be encoded by nucleic acids containing variations having slightly different nucleic acid sequences but, nonetheless, encode the same or substantially similar protein (see Table 2 above).
  • the invention concerns isolated nucleic acid segments and recombinant vectors incorporating nucleic acid sequences that encode a variant SpA or coagulase.
  • the term "recombinant" may be used in conjunction with a polynucleotide or polypeptide and generally refers to a polypeptide or polynucleotide produced and/or manipulated in vitro or that is a replication product of such a molecule.
  • the invention concerns isolated nucleic acid segments and recombinant vectors incorporating nucleic acid sequences that encode a variant SpA or coagulase polypeptide or peptide to generate an immune response in a subject.
  • the nucleic acids of the invention may be used in genetic vaccines.
  • nucleic acid segments used in the present invention can be combined with other nucleic acid sequences, such as promoters, polyadenylation signals, additional restriction enzyme sites, multiple cloning sites, other coding segments, and the like, such that their overall length may vary considerably. It is therefore contemplated that a nucleic acid fragment of almost any length may be employed, with the total length preferably being limited by the ease of preparation and use in the intended recombinant nucleic acid protocol.
  • a nucleic acid sequence may encode a polypeptide sequence with additional heterologous coding sequences, for example to allow for purification of the polypeptide, transport, secretion, post- translational modification, or for therapeutic benefits such as targeting or efficacy.
  • a tag or other heterologous polypeptide may be added to the modified polypeptide-encoding sequence, wherein "heterologous" refers to a polypeptide that is not the same as the modified polypeptide.
  • the invention concerns isolated nucleic acid segments and recombinant vectors that include within their sequence a contiguous nucleic acid sequence from SEQ ID NO:1 (SpA domain D) or SEQ ID NO: 3 (SpA) or any other nucleic acid sequences encoding coagulases or other secreted virulence factors and/or surface proteins including proteins transported by the Ess pathway, processed by sortase, or proteins incorporated herein by reference.
  • the present invention provides polynucleotide variants having substantial identity to the sequences disclosed herein; those comprising at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% or higher sequence identity, including all values and ranges there between, compared to a polynucleotide sequence of this invention using the methods described herein (e.g., BLAST analysis using standard parameters).
  • the invention also contemplates the use of polynucleotides which are complementary to all the above described polynucleotides.
  • Polypeptides of the invention may be encoded by a nucleic acid molecule comprised in a vector.
  • vector is used to refer to a carrier nucleic acid molecule into which a heterologous nucleic acid sequence can be inserted for introduction into a cell where it can be replicated and expressed.
  • a nucleic acid sequence can be "heterologous,” which means that it is in a context foreign to the cell in which the vector is being introduced or to the nucleic acid in which is incorporated, which includes a sequence homologous to a sequence in the cell or nucleic acid but in a position within the host cell or nucleic acid where it is ordinarily not found.
  • Vectors include DNAs, RNAs, plasmids, cosmids, viruses (bacteriophage, animal viruses, and plant viruses), and artificial chromosomes (e.g., YACs).
  • viruses bacteriophage, animal viruses, and plant viruses
  • artificial chromosomes e.g., YACs.
  • One of skill in the art would be well equipped to construct a vector through standard recombinant techniques (for example Sambrook et al, 2001; Ausubel et al, 1996, both incorporated herein by reference).
  • the vector can encode other polypeptide sequences such as a one or more other bacterial peptide, a tag, or an immunogenicity enhancing peptide.
  • Useful vectors encoding such fusion proteins include pIN vectors (Inouye et al, 1985), vectors encoding a stretch of histidines, and pGEX vectors, for use in generating glutathione S-transferase (GST) soluble fusion proteins for later purification and separation or cleavage.
  • GST glutathione S-transferase
  • expression vector refers to a vector containing a nucleic acid sequence coding for at least part of a gene product capable of being transcribed. In some cases, RNA molecules are then translated into a protein, polypeptide, or peptide.
  • Expression vectors can contain a variety of "control sequences,” which refer to nucleic acid sequences necessary for the transcription and possibly translation of an operably linked coding sequence in a particular host organism. In addition to control sequences that govern transcription and translation, vectors and expression vectors may contain nucleic acid sequences that serve other functions as well and are described herein.
  • a “promoter” is a control sequence.
  • the promoter is typically a region of a nucleic acid sequence at which initiation and rate of transcription are controlled. It may contain genetic elements at which regulatory proteins and molecules may bind such as RNA polymerase and other transcription factors.
  • the phrases "operatively positioned,” “operatively linked,” “under control,” and “under transcriptional control” mean that a promoter is in a correct functional location and/or orientation in relation to a nucleic acid sequence to control transcriptional initiation and expression of that sequence.
  • a promoter may or may not be used in conjunction with an “enhancer,” which refers to a cis-acting regulatory sequence involved in the transcriptional activation of a nucleic acid sequence.
  • promoter and/or enhancer that effectively directs the expression of the DNA segment in the cell type or organism chosen for expression.
  • Those of skill in the art of molecular biology generally know the use of promoters, enhancers, and cell type combinations for protein expression (see Sambrook et al, 2001, incorporated herein by reference).
  • the promoters employed may be constitutive, tissue-specific, or inducible and in certain embodiments may direct high level expression of the introduced DNA segment under specified conditions, such as large-scale production of recombinant proteins or peptides.
  • Various elements/promoters may be employed in the context of the present invention to regulate the expression of a gene.
  • inducible elements which are regions of a nucleic acid sequence that can be activated in response to a specific stimulus, include but are not limited to Immunoglobulin Heavy Chain (Banerji et al, 1983; Gilles et al, 1983; Grosschedl et al, 1985; Atchinson et al, 1986, 1987; Imler et al, 1987; Weinberger et al, 1984; Kiledjian et al, 1988; Porton et al; 1990), Immunoglobulin Light Chain (Queen et al, 1983; Picard et al, 1984), T Cell Receptor (Luria et al, 1987; Winoto et al, 1989; Redondo et al; 1990), HLA DQ ⁇ and/or DQ ⁇ (Sullivan et al, 1987), ⁇ Interferon (Goodbourn et
  • Inducible elements include, but are not limited to MT II - Phorbol Ester (TFA)/Heavy metals (Palmiter et al, 1982; Haslinger et al, 1985; Searle et al, 1985; Stuart et al, 1985; Imagawa et al, 1987, Karin et al, 1987; Angel et al, 1987b; McNeall et al, 1989); MMTV (mouse mammary tumor virus) - Glucocorticoids (Huang et al, 1981; Lee et al, 1981; Majors et al, 1983; Chandler et al, 1983; Lee et al, 1984; Ponta et al, 1985; Sakai et al, 1988); ⁇ -Interferon - poly(rl)x/poly(rc) (Tavernier et al, 1983); Adenovirus 5 E2 - ElA (Imperiale et al, 1984); Collagenase
  • the particular promoter that is employed to control the expression of peptide or protein encoding polynucleotide of the invention is not believed to be critical, so long as it is capable of expressing the polynucleotide in a targeted cell, preferably a bacterial cell. Where a human cell is targeted, it is preferable to position the polynucleotide coding region adjacent to and under the control of a promoter that is capable of being expressed in a human cell. Generally speaking, such a promoter might include either a bacterial, human or viral promoter.
  • a desirable promoter for use with the vector is one that is not down-regulated by cytokines or one that is strong enough that even if down-regulated, it produces an effective amount of a variant SpA for eliciting an immune response.
  • cytokines CMV IE and RSV LTR.
  • Tissue specific promoters can be used, particularly if expression is in cells in which expression of an antigen is desirable, such as dendritic cells or macrophages.
  • the mammalian MHC I and MHC II promoters are examples of such tissue-specific promoters.
  • a specific initiation signal also may be required for efficient translation of coding sequences. These signals include the ATG initiation codon or adjacent sequences. Exogenous translational control signals, including the ATG initiation codon, may need to be provided. One of ordinary skill in the art would readily be capable of determining this and providing the necessary signals.
  • IRES elements are used to create multigene, or polycistronic, messages.
  • IRES elements are able to bypass the ribosome scanning model of 5' methylated Cap dependent translation and begin translation at internal sites (Pelletier and Sonenberg, 1988; Macejak and Sarnow, 1991).
  • IRES elements can be linked to heterologous open reading frames. Multiple open reading frames can be transcribed together, each separated by an IRES, creating polycistronic messages. Multiple genes can be efficiently expressed using a single promoter/enhancer to transcribe a single message (see U.S. Patents 5,925,565 and 5,935,819, herein incorporated by reference).
  • cells containing a nucleic acid construct of the present invention may be identified in vitro or in vivo by encoding a screenable or selectable marker in the expression vector.
  • a marker When transcribed and translated, a marker confers an identifiable change to the cell permitting easy identification of cells containing the expression vector.
  • a selectable marker is one that confers a property that allows for selection.
  • a positive selectable marker is one in which the presence of the marker allows for its selection, while a negative selectable marker is one in which its presence prevents its selection.
  • An example of a positive selectable marker is a drug resistance marker.
  • the terms "cell,” “cell line,” and “cell culture” may be used interchangeably. All of these terms also include their progeny, which is any and all subsequent generations. It is understood that all progeny may not be identical due to deliberate or inadvertent mutations.
  • "host cell” refers to a prokaryotic or eukaryotic cell, and it includes any transformable organism that is capable of replicating a vector or expressing a heterologous gene encoded by a vector. A host cell can, and has been, used as a recipient for vectors or viruses.
  • a host cell may be "transfected” or “transformed,” which refers to a process by which exogenous nucleic acid, such as a recombinant protein-encoding sequence, is transferred or introduced into the host cell.
  • a transformed cell includes the primary subject cell and its progeny.
  • Host cells may be derived from prokaryotes or eukaryotes, including bacteria, yeast cells, insect cells, and mammalian cells for replication of the vector or expression of part or all of the nucleic acid sequence(s). Numerous cell lines and cultures are available for use as a host cell, and they can be obtained through the American Type Culture Collection (ATCC), which is an organization that serves as an archive for living cultures and genetic materials (www.atcc.org).
  • ATCC American Type Culture Collection
  • compositions discussed above Numerous expression systems exist that comprise at least a part or all of the compositions discussed above.
  • Prokaryote- and/or eukaryote -based systems can be employed for use with the present invention to produce nucleic acid sequences, or their cognate polypeptides, proteins and peptides. Many such systems are commercially and widely available.
  • the insect cell/baculovirus system can produce a high level of protein expression of a heterologous nucleic acid segment, such as described in U.S. Patents 5,871,986, 4,879,236, both herein incorporated by reference, and which can be bought, for example, under the name M AXB AC® 2.0 from INVITROGEN® and BACPACKTM BACULOVIRUS EXPRESSION SYSTEM FROM CLONTECH®.
  • a heterologous nucleic acid segment such as described in U.S. Patents 5,871,986, 4,879,236, both herein incorporated by reference, and which can be bought, for example, under the name M AXB AC® 2.0 from INVITROGEN® and BACPACKTM BACULOVIRUS EXPRESSION SYSTEM FROM CLONTECH®.
  • expression systems include STRATAGENE®'s COMPLETE CONTROLTM Inducible Mammalian Expression System, which involves a synthetic ecdysone-inducible receptor, or its pET Expression System, an E. coli expression system.
  • STRATAGENE® COMPLETE CONTROLTM Inducible Mammalian Expression System
  • pET Expression System an E. coli expression system.
  • an inducible expression system is available from INVITROGEN®, which carries the T-REXTM (tetracycline-regulated expression) System, an inducible mammalian expression system that uses the full-length CMV promoter.
  • INVITROGEN® also provides a yeast expression system called the Pichia methanolica Expression System, which is designed for high-level production of recombinant proteins in the methylotrophic yeast Pichia methanolica.
  • a vector such as an expression construct, to produce a nucleic acid sequence or its cognate polypeptide, protein, or peptide.
  • the immunogenic compositions of the invention may further comprise capsular polysaccharides including one or more of PIA (also known as PNAG) and/or S. aureus Type V and/or type VIII capsular polysaccharide and/or S. epidermidis Type I, and/or Type Il and/or Type III capsular polysaccharide.
  • PIA also known as PNAG
  • S. aureus Type V and/or type VIII capsular polysaccharide and/or S. epidermidis Type I, and/or Type Il and/or Type III capsular polysaccharide may further comprise capsular polysaccharides including one or more of PIA (also known as PNAG) and/or S. aureus Type V and/or type VIII capsular polysaccharide and/or S. epidermidis Type I, and/or Type Il and/or Type III capsular polysaccharide.
  • PIA is a polysaccharide intercellular adhesin and is composed of a polymer of ⁇ -(l ⁇ 6)-linked glucosamine substituted with N-acetyl and O-succinyl constituents.
  • This polysaccharide is present in both S. aureus and S. epidermidis and can be isolated from either source (Joyce et al., 2003; Maira-Litran et al., 2002).
  • PNAG may be isolated from S. aureus strain MN8m (WO04/43407).
  • PIA isolated from S. epidermidis is a integral constituent of biofilm.
  • PNSG poly-N- succinyl- ⁇ -(l ⁇ 6)-glucosamine
  • PIA may be of different sizes varying from over 40OkDa to between 75 and 40OkDa to between 10 and 75kDa to oligosaccharides composed of up to 30 repeat units (of ⁇ -(l ⁇ 6)-linked glucosamine substituted with N-acetyl and O-succinyl constituents). Any size of PIA polysaccharide or oligosaccharide may be use in an immunogenic composition of the invention, in one aspect the polysaccharide is over 4OkDa.
  • PIA is at least or at most 40- 40OkDa, 40-30OkDa, 50-35OkDa, 60-30OkDa, 50-25OkDa and 60-20OkDa.
  • PIA can have different degree of acetylation due to substitution on the amino groups by acetate. PIA produced in vitro is almost fully substituted on amino groups (95- 100%).
  • a deacetylated PIA PNAG
  • PNAG can be used having less than 60%, 50%, 40%, 30%, 20%, 10% acetylation.
  • Use of a deacetylated PIA (PNAG) is preferred since non-acetylated epitopes of PNAG are efficient at mediating opsonic killing of Gram positive bacteria, preferably S. aureus and/or S. epidermidis.
  • the PIA (PNAG) has a size between 4OkDa and 30OkDa and is deacetylated so that less than 60%, 50%, 40%, 30% or 20% of amino groups are acetylated.
  • deacetylated PNAG refers to a PNAG polysaccharide or oligosaccharide in which less than 60%, 50%, 40%, 30%, 20% or 10% of the amino agroups are acetylated.
  • PNAG is deaceylated to form dPNAG by chemically treating the native polysaccharide.
  • the native PNAG is treated with a basic solution such that the pH rises to above 10.
  • the PNAG is treated with 0.1-5 M, 0.2-4 M, 0.3-3 M, 0.5-2 M, 0.75-1.5 M or 1 M NaOH , KOH or NH 4 OH. Treatment is for at least 10 to 30 minutes, or 1, 2, 3, 4, 5, 10, 15 or 20 hours at a temperature of 20-100, 25-80, 30-60 or 30-50 or 35-45 0 C.
  • dPNAG may be prepared as described in WO 04/43405.
  • the polysaccharide(s) can be conjugated or unconjugated to a carrier protein.
  • Type 5 and Type 8 capsular polysaccharide antigens are described in Moreau et al., (1990) and Fournier et al., (1984). Both have FucNAcp in their repeat unit as well as ManNAcA which can be used to introduce a sulfhydryl group. The structures are:
  • Polysaccharides may be extracted from the appropriate strain of S. aureus using method well known to of skill in the art, See U.S. Patent 6,294,177.
  • ATCC 12902 is a Type 5 S. aureus strain
  • ATCC 12605 is a Type 8 S. aureus strain.
  • Polysaccharides are of native size or alternatively may be sized, for instance by micro fluidisation, ultrasonic irradiation, or by chemical treatment.
  • the invention also covers oligosaccharides derived from the type 5 and 8 polysaccharides from S. aureus.
  • the type 5 and 8 polysaccharides included in the immunogenic composition of the invention are preferably conjugated to a carrier protein as described below or are alternatively unconjugated.
  • the immunogenic compositions of the invention alternatively contains either type 5 or type 8 polysaccharide.
  • the immunogenic composition of the invention comprises the S. aureus 336 antigen described in U.S. Patent 6,294,177.
  • the 336 antigen comprises ⁇ -linked hexosamine, contains no O-acetyl groups, and specifically binds to antibodies to S. aureus Type 336 deposited under ATCC 55804.
  • the 336 antigen is a polysaccharide which is of native size or alternatively may be sized, for instance by microfluidisation, ultrasonic irradiation, or by chemical treatment.
  • the invention also covers oligosaccharides derived from the 336 antigen.
  • the 336 antigen can be unconjugated or conjugated to a carrier protein.
  • polysaccharides per se are poor immunogens. It is preferred that the polysaccharides utilized in the invention are linked to a protein carrier which provide bystander T-cell help to improve immunogenicity.
  • Examples of such carriers which may be conjugated to polysaccharide immunogens include the Diphtheria and Tetanus toxoids (DT, DT CRM197 and TT respectively), Keyhole Limpet Haemocyanin (KLH), and the purified protein derivative of Tuberculin (PPD), Pseudomonas aeruginosa exoprotein A (rEPA), protein D from Haemophilus influenzae, pneumolysin or fragments of any of the above. Fragments suitable for use include fragments encompassing T-helper epitopes. In particular the protein D fragment from H. influenza will preferably contain the N-terminal 1/3 of the protein.
  • Protein D is an IgD-binding protein from Haemophilus influenzae (EP 0 594 610 Bl) and is a potential immunogen.
  • staphylococcal proteins may be used as a carrier protein in the polysaccharide conjugates of the invention.
  • a carrier protein that would be particularly advantageous to use in the context of a staphylococcal vaccine is staphylococcal alpha toxoid.
  • the native form may be conjugated to a polysaccharide since the process of conjugation reduces toxicity.
  • genetically detoxified alpha toxins such as the His35Leu or His35Arg variants are used as carriers since residual toxicity is lower.
  • the alpha toxin is chemically detoxified by treatment with a cross-linking reagent, formaldehyde or glutaraldehyde.
  • a genetically detoxified alpha toxin is optionally chemically detoxified, preferably by treatment with a cross-linking reagent, formaldehyde or glutaraldehyde to further reduce toxicity.
  • the polysaccharides may be linked to the carrier protein(s) by any known method (for example those methods described in U.S. Patents 4,372,945, 4,474,757, and 4,356,170).
  • CDAP conjugation chemistry is carried out (see WO95/08348).
  • CDAP the cyanylating reagent 1-cyano-dimethylaminopyridinium tetrafluoroborate (CDAP) is preferably used for the synthesis of polysaccharide- protein conjugates.
  • CDAP cyanylating reagent 1-cyano-dimethylaminopyridinium tetrafluoroborate
  • the cyanilation reaction can be performed under relatively mild conditions, which avoids hydrolysis of the alkaline sensitive polysaccharides. This synthesis allows direct coupling to a carrier protein.
  • Conjugation preferably involves producing a direct linkage between the carrier protein and polysaccharide.
  • a spacer such as adipic dihydride (ADH)
  • ADH adipic dihydride
  • the invention concerns evoking or inducing an immune response in a subject against a variant SpA or coagulase peptide.
  • the immune response can protect against or treat a subject having, suspected of having, or at risk of developing an infection or related disease, particularly those related to staphylococci.
  • One use of the immunogenic compositions of the invention is to prevent nosocomial infections by inoculating a subject prior to undergoing procedures in a hospital or other environment having an increased risk of infection.
  • the present invention includes the implementation of serological assays to evaluate whether and to what extent an immune response is induced or evoked by compositions of the invention.
  • immunoassays There are many types of immunoassays that can be implemented. Immunoassays encompassed by the present invention include, but are not limited to, those described in U.S. Patent 4,367,110 (double monoclonal antibody sandwich assay) and U.S. Patent 4,452,901 (western blot). Other assays include immunoprecipitation of labeled ligands and immunocytochemistry, both in vitro and in vivo.
  • Immunoassays generally are binding assays. Certain preferred immunoassays are the various types of enzyme linked immunosorbent assays (ELISAs) and radioimmunoassays (RIA) known in the art. Immunohistochemical detection using tissue sections is also particularly useful.
  • ELISAs enzyme linked immunosorbent assays
  • RIA radioimmunoassays
  • Immunohistochemical detection using tissue sections is also particularly useful.
  • antibodies or antigens are immobilized on a selected surface, such as a well in a polystyrene microtiter plate, dipstick, or column support. Then, a test composition suspected of containing the desired antigen or antibody, such as a clinical sample, is added to the wells. After binding and washing to remove non specifically bound immune complexes, the bound antigen or antibody may be detected.
  • Detection is generally achieved by the addition of another antibody, specific for the desired antigen or antibody, that is linked to a detectable label. This type of ELISA is known as a "sandwich ELISA.” Detection also may be achieved by the addition of a second antibody specific for the desired antigen, followed by the addition of a third antibody that has binding affinity for the second antibody, with the third antibody being linked to a detectable label.
  • Competition ELISAs are also possible implementations in which test samples compete for binding with known amounts of labeled antigens or antibodies.
  • the amount of reactive species in the unknown sample is determined by mixing the sample with the known labeled species before or during incubation with coated wells. The presence of reactive species in the sample acts to reduce the amount of labeled species available for binding to the well and thus reduces the ultimate signal.
  • ELISAs have certain features in common, such as coating, incubating or binding, washing to remove non specifically bound species, and detecting the bound immune complexes.
  • Antigen or antibodies may also be linked to a solid support, such as in the form of plate, beads, dipstick, membrane, or column matrix, and the sample to be analyzed is applied to the immobilized antigen or antibody.
  • a solid support such as in the form of plate, beads, dipstick, membrane, or column matrix
  • the sample to be analyzed is applied to the immobilized antigen or antibody.
  • a plate with either antigen or antibody one will generally incubate the wells of the plate with a solution of the antigen or antibody, either overnight or for a specified period. The wells of the plate will then be washed to remove incompletely-adsorbed material. Any remaining available surfaces of the wells are then "coated" with a nonspecific protein that is antigenically neutral with regard to the test antisera.
  • nonspecific protein that is antigenically neutral with regard to the test antisera.
  • these include bovine serum albumin (BSA), casein, and solutions of milk powder.
  • BSA bovine serum albumin
  • the coating
  • the present invention contemplates the use of these polypeptides, proteins, peptides, and/or antibodies in a variety of ways, including the detection of the presence of Staphylococci to diagnose an infection, whether in a patient or on medical equipment which may also become infected.
  • a preferred method of detecting the presence of infections involves the steps of obtaining a sample suspected of being infected by one or more staphylococcal bacteria species or strains, such as a sample taken from an individual, for example, from one's blood, saliva, tissues, bone, muscle, cartilage, or skin.
  • diagnostic assays utilizing the polypeptides, proteins, peptides, and/or antibodies of the present invention may be carried out to detect the presence of staphylococci, and such assay techniques for determining such presence in a sample are well known to those skilled in the art and include methods such as radioimmunoassay, western blot analysis and ELISA assays.
  • a method of diagnosing an infection wherein a sample suspected of being infected with staphylococci has added to it the polypeptide, protein, peptide, antibody, or monoclonal antibody in accordance with the present invention, and staphylococci are indicated by antibody binding to the polypeptides, proteins, and/or peptides, or polypeptides, proteins, and/or peptides binding to the antibodies in the sample.
  • antibodies in accordance with the invention may be used for the prevention of infection from staphylococcal bacteria (i.e., passive immunization), for the treatment of an ongoing infection, or for use as research tools.
  • the term "antibodies” as used herein includes monoclonal, polyclonal, chimeric, single chain, bispecif ⁇ c, simianized, and humanized or primatized antibodies as well as Fab fragments, such as those fragments which maintain the binding specificity of the antibodies, including the products of an Fab immunoglobulin expression library. Accordingly, the invention contemplates the use of single chains such as the variable heavy and light chains of the antibodies. Generation of any of these types of antibodies or antibody fragments is well known to those skilled in the art. Specific examples of the generation of an antibody to a bacterial protein can be found in U.S. Patent Application Pub. No. 20030153022, which is incorporated herein by reference in its entirety.
  • any of the above described polypeptides, proteins, peptides, and/or antibodies may be labeled directly with a detectable label for identification and quantification of staphylococcal bacteria.
  • Labels for use in immunoassays are generally known to those skilled in the art and include enzymes, radioisotopes, and fluorescent, luminescent and chromogenic substances, including colored particles such as colloidal gold or latex beads.
  • Suitable immunoassays include enzyme-linked immunosorbent assays (ELISA).
  • proteinaceous compositions confer protective immunity to a subject.
  • Protective immunity refers to a body's ability to mount a specific immune response that protects the subject from developing a particular disease or condition that involves the agent against which there is an immune response.
  • An immunogenically effective amount is capable of conferring protective immunity to the subject.
  • polypeptide or peptide refer to a stretch of amino acids covalently linked there amongst via peptide bonds.
  • Different polypeptides have different functionalities according to the present invention. While according to one aspect, a polypeptide is derived from an immunogen designed to induce an active immune response in a recipient, according to another aspect of the invention, a polypeptide is derived from an antibody which results following the elicitation of an active immune response in, for example, an animal, and which can serve to induce a passive immune response in the recipient. In both cases, however, the polypeptide is encoded by a polynucleotide according to any possible codon usage.
  • immune response refers to the development of a humoral (antibody mediated), cellular (mediated by antigen-specific T cells or their secretion products) or both humoral and cellular response directed against a protein, peptide, carbohydrate, or polypeptide of the invention in a recipient patient.
  • a humoral antibody mediated
  • cellular mediated by antigen-specific T cells or their secretion products
  • humoral and cellular response directed against a protein, peptide, carbohydrate, or polypeptide of the invention in a recipient patient.
  • Such a response can be an active response induced by administration of immunogen or a passive response induced by administration of antibody, antibody containing material, or primed T-cells.
  • a cellular immune response is elicited by the presentation of polypeptide epitopes in association with Class I or Class II MHC molecules, to activate antigen-specific CD4 (+) T helper cells and/or CD8 (+) cytotoxic T cells.
  • the response may also involve activation of monocytes, macrophages, NK cells, basophils, dendritic cells, astrocytes, microglia cells, eosinophils or other components of innate immunity.
  • active immunity refers to any immunity conferred upon a subject by administration of an antigen.
  • Passive immunity refers to any immunity conferred upon a subject without administration of an antigen to the subject.
  • Passive immunity therefore includes, but is not limited to, administration of activated immune effectors including cellular mediators or protein mediators (e.g., monoclonal and/or polyclonal antibodies) of an immune response.
  • a monoclonal or polyclonal antibody composition may be used in passive immunization for the prevention or treatment of infection by organisms that carry the antigen recognized by the antibody.
  • An antibody composition may include antibodies that bind to a variety of antigens that may in turn be associated with various organisms.
  • the antibody component can be a polyclonal antiserum.
  • the antibody or antibodies are affinity purified from an animal or second subject that has been challenged with an antigen(s).
  • an antibody mixture may be used, which is a mixture of monoclonal and/or polyclonal antibodies to antigens present in the same, related, or different microbes or organisms, such as gram-positive bacteria, gram-negative bacteria, including but not limited to staphylococcus bacteria.
  • Passive immunity may be imparted to a patient or subject by administering to the patient immunoglobulins (Ig) and/or other immune factors obtained from a donor or other non-patient source having a known immunoreactivity.
  • an antigenic composition of the present invention can be administered to a subject who then acts as a source or donor for globulin, produced in response to challenge with the antigenic composition ("hyperimmune globulin"), that contains antibodies directed against Staphylococcus or other organism.
  • a subject thus treated would donate plasma from which hyperimmune globulin would then be obtained, via conventional plasma- fractionation methodology, and administered to another subject in order to impart resistance against or to treat staphylococcus infection.
  • Hyperimmune globulins according to the invention are particularly useful for immune-compromised individuals, for individuals undergoing invasive procedures or where time does not permit the individual to produce their own antibodies in response to vaccination. See U.S.
  • epitopes and “antigenic determinant” are used interchangeably to refer to a site on an antigen to which B and/or T cells respond or recognize.
  • B-cell epitopes can be formed both from contiguous amino acids or noncontiguous amino acids juxtaposed by tertiary folding of a protein. Epitopes formed from contiguous amino acids are typically retained on exposure to denaturing solvents whereas epitopes formed by tertiary folding are typically lost on treatment with denaturing solvents.
  • An epitope typically includes at least 3, and more usually, at least 5 or 8-10 amino acids in a unique spatial conformation.
  • Methods of determining spatial conformation of epitopes include, for example, x-ray crystallography and 2-dimensional nuclear magnetic resonance. See, e.g., Epitope Mapping Protocols (1996).
  • Antibodies that recognize the same epitope can be identified in a simple immunoassay showing the ability of one antibody to block the binding of another antibody to a target antigen.
  • T- cells recognize continuous epitopes of about nine amino acids for CD8 cells or about 13-15 amino acids for CD4 cells.
  • T cells that recognize the epitope can be identified by in vitro assays that measure antigen-dependent proliferation, as determined by 3 H- thymidine incorporation by primed T cells in response to an epitope (Burke et al., 1994), by antigen-dependent killing (cytotoxic T lymphocyte assay, Tigges et al., 1996) or by cytokine secretion.
  • the presence of a cell-mediated immunological response can be determined by proliferation assays (CD4 (+) T cells) or CTL (cytotoxic T lymphocyte) assays.
  • proliferation assays CD4 (+) T cells
  • CTL cytotoxic T lymphocyte
  • the relative contributions of humoral and cellular responses to the protective or therapeutic effect of an immunogen can be distinguished by separately isolating IgG and T-cells from an immunized syngeneic animal and measuring protective or therapeutic effect in a second subject.
  • antibody or “immunoglobulin” are used interchangeably and refer to any of several classes of structurally related proteins that function as part of the immune response of an animal or recipient, which proteins include IgG, IgD, IgE, IgA, IgM and related proteins.
  • Antibodies of the IgG class are made up of four polypeptide chains linked together by disulfide bonds.
  • the four chains of intact IgG molecules are two identical heavy chains referred to as H-chains and two identical light chains referred to as L-chains.
  • a host such as a rabbit or goat
  • the antigen or antigen fragment generally with an adjuvant and, if necessary, coupled to a carrier.
  • Antibodies to the antigen are subsequently collected from the sera of the host.
  • the polyclonal antibody can be affinity purified against the antigen rendering it monospecific.
  • Monoclonal antibodies can be produced by hyperimmunization of an appropriate donor with the antigen or ex-vivo by use of primary cultures of splenic cells or cell lines derived from spleen (Anavi, 1998; Huston et al., 1991; Johnson et al., 1991; Mernaugh et al, 1995).
  • an immunological portion of an antibody includes a Fab fragment of an antibody, a Fv fragment of an antibody, a heavy chain of an antibody, a light chain of an antibody, a heterodimer consisting of a heavy chain and a light chain of an antibody, a variable fragment of a light chain of an antibody, a variable fragment of a heavy chain of an antibody, and a single chain variant of an antibody, which is also known as scFv.
  • the term includes chimeric immunoglobulins which are the expression products of fused genes derived from different species, one of the species can be a human, in which case a chimeric immunoglobulin is said to be humanized.
  • an immunological portion of an antibody competes with the intact antibody from which it was derived for specific binding to an antigen.
  • an antibody or preferably an immunological portion of an antibody can be chemically conjugated to, or expressed as, a fusion protein with other proteins.
  • a fusion protein with other proteins.
  • immunological agent or “immunogen” or “antigen” are used interchangeably to describe a molecule capable of inducing an immunological response against itself on administration to a recipient, either alone, in conjunction with an adjuvant, or presented on a display vehicle.
  • a method of the present invention includes treatment for a disease or condition caused by a staphylococcus pathogen.
  • An immunogenic polypeptide of the invention can be given to induce an immune response in a person infected with staphylococcus or suspected of having been exposed to staphylococcus. Methods may be employed with respect to individuals who have tested positive for exposure to staphylococcus or who are deemed to be at risk for infection based on possible exposure.
  • the invention encompasses a method of treatment for staphylococcal infection, particularly hospital acquired nosocomial infections.
  • the immunogenic compositions and vaccines of the invention are particularly advantageous to use in cases of elective surgery. Such patients will know the date of surgery in advance and could be inoculated in advance.
  • the immunogenic compositions and vaccines of the invention are also advantageous to use to inoculate health care workers.
  • the treatment is administered in the presence of adjuvants or carriers or other staphylococcal antigens.
  • treatment comprises administration of other agents commonly used against bacterial infection, such as one or more antibiotics.
  • peptides for vaccination can require, but not necessarily, conjugation of the peptide to an immunogenic carrier protein, such as hepatitis B surface antigen, keyhole limpet hemocyanin, or bovine serum albumin. Methods for performing this conjugation are well known in the art.
  • the present invention includes methods for preventing or ameliorating staphylococcal infections, particularly hospital acquired nosocomial infections.
  • the invention contemplates vaccines for use in both active and passive immunization embodiments.
  • Immunogenic compositions proposed to be suitable for use as a vaccine, may be prepared from immunogenic SpA polypeptide(s), such as a SpA domain D variant, or immunogenic coagulases.
  • SpA or coagulases can be used in combination with other secreted virulence proteins, surface proteins or immunogenic fragments thereof.
  • antigenic material is extensively dialyzed to remove undesired small molecular weight molecules and/or lyophilized for more ready formulation into a desired vehicle.
  • Suitable excipients are, for example, water, saline, dextrose, glycerol, ethanol, or the like and combinations thereof.
  • the vaccine may contain amounts of auxiliary substances such as wetting or emulsifying agents, pH buffering agents, or adjuvants that enhance the effectiveness of the vaccines.
  • vaccines are formulated with a combination of substances, as described in U.S. Patents 6,793,923 and 6,733,754, which are incorporated herein by reference.
  • Vaccines may be conventionally administered parenterally, by injection, for example, either subcutaneously or intramuscularly. Additional formulations which are suitable for other modes of administration include suppositories and, in some cases, oral formulations.
  • traditional binders and carriers may include, for example, polyalkalene glycols or triglycerides: such suppositories may be formed from mixtures containing the active ingredient in the range of about 0.5% to about 10%, preferably about 1% to about 2%.
  • Oral formulations include such normally employed excipients as, for example, pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate and the like. These compositions take the form of solutions, suspensions, tablets, pills, capsules, sustained release formulations or powders and contain about 10% to about 95% of active ingredient, preferably about 25% to about 70%.
  • polypeptides and polypeptide-encoding DNA constructs may be formulated into a vaccine as neutral or salt forms.
  • Pharmaceutically-acceptable salts include the acid addition salts (formed with the free amino groups of the peptide) and those that are formed with inorganic acids such as, for example, hydrochloric or phosphoric acids, or such organic acids as acetic, oxalic, tartaric, mandelic, and the like.
  • vaccines are administered in a manner compatible with the dosage formulation, and in such amount as will be therapeutically effective and immunogenic.
  • the quantity to be administered depends on the subject to be treated, including the capacity of the individual's immune system to synthesize antibodies and the degree of protection desired. Precise amounts of active ingredient required to be administered depend on the judgment of the practitioner. However, suitable dosage ranges are of the order of several hundred micrograms of active ingredient per vaccination. Suitable regimes for initial administration and booster shots are also variable, but are typified by an initial administration followed by subsequent inoculations or other administrations.
  • the manner of application may be varied widely. Any of the conventional methods for administration of a vaccine are applicable. These are believed to include oral application within a solid physiologically acceptable base or in a physiologically acceptable dispersion, parenterally, by injection and the like. The dosage of the vaccine will depend on the route of administration and will vary according to the size and health of the subject.
  • the vaccine in certain instances, it will be desirable to have multiple administrations of the vaccine, e.g., 2, 3, 4, 5, 6 or more administrations.
  • the vaccinations can be at 1, 2, 3, 4, 5, 6, 7, 8, to 5, 6, 7, 8, 9 ,10, 11, 12 twelve week intervals, including all ranges there between. Periodic boosters at intervals of 1-5 years will be desirable to maintain protective levels of the antibodies.
  • the course of the immunization may be followed by assays for antibodies against the antigens, as described in U.S. Patents 3,791,932; 4,174,384 and 3,949,064.
  • a given composition may vary in its immunogenicity. It is often necessary therefore to boost the host immune system, as may be achieved by coupling a peptide or polypeptide to a carrier.
  • exemplary and preferred carriers are keyhole limpet hemocyanin (KLH) and bovine serum albumin (BSA). Other albumins such as ovalbumin, mouse serum albumin, or rabbit serum albumin can also be used as carriers.
  • KLH keyhole limpet hemocyanin
  • BSA bovine serum albumin
  • Other albumins such as ovalbumin, mouse serum albumin, or rabbit serum albumin can also be used as carriers.
  • Means for conjugating a polypeptide to a carrier protein are well known in the art and include glutaraldehyde, m-maleimidobencoyl-N-hydroxysuccinimide ester, carbodiimyde, and bis-biazotized benzidine.
  • the immunogenicity of polypeptide or peptide compositions can be enhanced by the use of non-specific stimulators of the immune response, known as adjuvants.
  • Suitable adjuvants include all acceptable immunostimulatory compounds, such as cytokines, toxins, or synthetic compositions.
  • a number of adjuvants can be used to enhance an antibody response against a variant SpA polypeptide or coagulase, or any other bacterial protein or combination contemplated herein.
  • Adjuvants can (1) trap the antigen in the body to cause a slow release; (2) attract cells involved in the immune response to the site of administration; (3) induce proliferation or activation of immune system cells; or (4) improve the spread of the antigen throughout the subject's body.
  • Adjuvants include, but are not limited to, oil-in-water emulsions, water-in- oil emulsions, mineral salts, polynucleotides, and natural substances. Specific adjuvants that may be used include IL-I, IL-2, IL-4, IL-7, IL- 12, ⁇ -interferon, GMCSP, BCG, aluminum salts, such as aluminum hydroxide or other aluminum compound, MDP compounds, such as thur-MDP and nor-MDP, CGP (MTP-PE), lipid A, and monophosphoryl lipid A (MPL).
  • RIBI which contains three components extracted from bacteria, MPL, trehalose dimycolate (TDM), and cell wall skeleton (CWS) in a 2% squalene/Tween 80 emulsion. MHC antigens may even be used.
  • Others adjuvants or methods are exemplified in U.S. Patents 6,814,971, 5,084,269, 6,656,462, each of which is incorporated herein by reference).
  • Various methods of achieving adjuvant affect for the vaccine includes use of agents such as aluminum hydroxide or phosphate (alum), commonly used as about 0.05 to about 0.1% solution in phosphate buffered saline, admixture with synthetic polymers of sugars (Carbopol®) used as an about 0.25% solution, aggregation of the protein in the vaccine by heat treatment with temperatures ranging between about 70° to about 101 0 C for a 30-second to 2-minute period, respectively. Aggregation by reactivating with pepsin-treated (Fab) antibodies to albumin; mixture with bacterial cells (e.g., C.
  • Fab pepsin-treated
  • parvuni endotoxins or lipopolysaccharide components of Gram- negative bacteria
  • emulsion in physiologically acceptable oil vehicles ⁇ e.g., mannide mono-oleate (Aracel A)
  • emulsion with a 20% solution of a perfluorocarbon (Fluosol-DA®) used as a block substitute may also be employed to produce an adjuvant effect.
  • Examples of and often preferred adjuvants include complete Freund's adjuvant (a non-specific stimulator of the immune response containing killed Mycobacterium tuberculosis), incomplete Freund's adjuvants, and aluminum hydroxide.
  • the adjuvant be selected to be a preferential inducer of either a ThI or a Th2 type of response.
  • a ThI- type cytokines tend to favor the induction of cell mediated immune responses to a given antigen, while high levels of Th2-type cytokines tend to favor the induction of humoral immune responses to the antigen.
  • ThI and Th2-type immune response are not absolute. In reality an individual will support an immune response which is described as being predominantly ThI or predominantly Th2. However, it is often convenient to consider the families of cytokines in terms of that described in murine CD4+ T cell clones by Mosmann and Coffman (Mosmann, and Coffman, 1989). Traditionally, ThI -type responses are associated with the production of the INF- ⁇ and IL-2 cytokines by T-lymphocytes. Other cytokines often directly associated with the induction of Thl-type immune responses are not produced by T-cells, such as IL-12. In contrast, Th2-type responses are associated with the secretion of IL- 4, IL-5, IL-6, IL-10.
  • BRM biologic response modifiers
  • BRMs have been shown to upregulate T cell immunity or downregulate suppresser cell activity.
  • BRMs include, but are not limited to, Cimetidine (CIM; 1200 mg/d) (Smith/Kline, PA); or low-dose Cyclophosphamide (CYP; 300 mg/m 2 ) (Johnson/ Mead, NJ) and cytokines such as ⁇ -interferon, IL-2, or IL- 12 or genes encoding proteins involved in immune helper functions, such as B-7.
  • the present invention concerns compositions comprising one or more lipids associated with a nucleic acid or a polypeptide/peptide.
  • a lipid is a substance that is insoluble in water and extractable with an organic solvent. Compounds other than those specifically described herein are understood by one of skill in the art as lipids, and are encompassed by the compositions and methods of the present invention.
  • a lipid component and a non-lipid may be attached to one another, either covalently or non-covalently.
  • a lipid may be a naturally occurring lipid or a synthetic lipid.
  • a lipid is usually a biological substance.
  • Biological lipids are well known in the art, and include for example, neutral fats, phospholipids, phosphoglycerides, steroids, terpenes, lysolipids, glycosphingolipids, glucolipids, sulphatides, lipids with ether and ester-linked fatty acids and polymerizable lipids, and combinations thereof.
  • a nucleic acid molecule or a polypeptide/peptide, associated with a lipid may be dispersed in a solution containing a lipid, dissolved with a lipid, emulsified with a lipid, mixed with a lipid, combined with a lipid, covalently bonded to a lipid, contained as a suspension in a lipid or otherwise associated with a lipid.
  • a lipid or lipid-poxvirus-associated composition of the present invention is not limited to any particular structure. For example, they may also simply be interspersed in a solution, possibly forming aggregates which are not uniform in either size or shape.
  • they may be present in a bilayer structure, as micelles, or with a "collapsed" structure.
  • a lipofectamine(Gibco BRL)-poxvirus or Superfect (Qiagen)-poxvirus complex is also contemplated.
  • a composition may comprise about 1%, about 2%, about 3%, about 4% about 5%, about 6%, about 7%, about 8%, about 9%, about 10%, about 11%, about 12%, about 13%, about 14%, about 15%, about 16%, about 17%, about 18%, about 19%, about 20%, about 21%, about 22%, about 23%, about 24%, about 25%, about 26%, about 27%, about 28%, about 29%, about 30%, about 31%, about 32%, about 33%, about 34%, about 35%, about 36%, about 37%, about 38%, about 39%, about 40%, about 41%, about 42%, about 43%, about 44%, about 45%, about 46%, about 47%, about 48%, about 49%, about 50%, about 51%, about 52%, about 53%, about 54%, about 55%, about 56%, about 57%, about 58%, about 59%, about 60%, about 61%, about 62%, about
  • a composition may comprise about 10% to about 20% neutral lipids, and about 33% to about 34% of a cerebroside, and about 1% cholesterol.
  • a liposome may comprise about 4% to about 12% terpenes, wherein about 1% of the micelle is specifically lycopene, leaving about 3% to about 11% of the liposome as comprising other terpenes; and about 10% to about 35% phosphatidyl choline, and about 1% of a non-lipid component.
  • compositions of the present invention may comprise any of the lipids, lipid types or other components in any combination or percentage range.
  • compositions and related methods of the present invention may also be used in combination with the administration of traditional therapies.
  • antibiotics such as streptomycin, ciprofloxacin, doxycycline, gentamycin, chloramphenicol, trimethoprim, sulfamethoxazole, ampicillin, tetracycline or various combinations of antibiotics.
  • a polypeptide vaccine and/or therapy is used in conjunction with antibacterial treatment.
  • the therapy may precede or follow the other agent treatment by intervals ranging from minutes to weeks.
  • the other agents and/or a proteins or polynucleotides are administered separately, one would generally ensure that a significant period of time did not expire between the time of each delivery, such that the agent and antigenic composition would still be able to exert an advantageously combined effect on the subject.
  • one may administer both modalities within about 12-24 h of each other or within about 6-12 h of each other.
  • antibiotic therapy is "A” and the immunogenic molecule given as part of an immune therapy regime, such as an antigen, is "B”:
  • compositions are administered to a subject.
  • Different aspects of the present invention involve administering an effective amount of a composition to a subject.
  • staphylococcal antigens, members of the Ess pathway, including polypeptides or peptides of the Esa or Esx class, and/or members of sortase substrates may be administered to the patient to protect against infection by one or more staphylococcus pathogens.
  • an expression vector encoding one or more such polypeptides or peptides may be given to a patient as a preventative treatment.
  • such compounds can be administered in combination with an antibiotic or an antibacterial.
  • Such compositions will generally be dissolved or dispersed in a pharmaceutically acceptable carrier or aqueous medium.
  • other pharmaceutically acceptable forms include, e.g., tablets or other solids for oral administration; time release capsules; and any other form currently used, including creams, lotions, mouthwashes, inhalants and the like.
  • the active compounds of the present invention can be formulated for parenteral administration, e.g., formulated for injection via the intravenous, intramuscular, sub-cutaneous, or even intraperitoneal routes.
  • parenteral administration e.g., formulated for injection via the intravenous, intramuscular, sub-cutaneous, or even intraperitoneal routes.
  • the preparation of an aqueous composition that contains a compound or compounds that increase the expression of an MHC class I molecule will be known to those of skill in the art in light of the present disclosure.
  • such compositions can be prepared as injectables, either as liquid solutions or suspensions; solid forms suitable for use to prepare solutions or suspensions upon the addition of a liquid prior to injection can also be prepared; and, the preparations can also be emulsified.
  • Solutions of the active compounds as free base or pharmacologically acceptable salts can be prepared in water suitably mixed with a surfactant, such as hydroxypropylcellulose. Dispersions can also be prepared in glycerol, liquid polyethylene glycols, and mixtures thereof and in oils. Under ordinary conditions of storage and use, these preparations contain a preservative to prevent the growth of microorganisms .
  • the pharmaceutical forms suitable for injectable use include sterile aqueous solutions or dispersions; formulations including sesame oil, peanut oil, or aqueous propylene glycol; and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions.
  • the form must be sterile and must be fluid to the extent that it may be easily injected. It also should be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms, such as bacteria and fungi.
  • the proteinaceous compositions may be formulated into a neutral or salt form.
  • Pharmaceutically acceptable salts include the acid addition salts (formed with the free amino groups of the protein) and which are formed with inorganic acids such as, for example, hydrochloric or phosphoric acids, or such organic acids as acetic, oxalic, tartaric, mandelic, and the like. Salts formed with the free carboxyl groups can also be derived from inorganic bases such as, for example, sodium, potassium, ammonium, calcium, or ferric hydroxides, and such organic bases as isopropylamine, trimethylamine, histidine, procaine and the like.
  • the carrier also can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), suitable mixtures thereof, and vegetable oils.
  • the proper fluidity can be maintained, for example, by the use of a coating, such as lecithin, by the maintenance of the required particle size in the case of dispersion, and by the use of surfactants.
  • the prevention of the action of microorganisms can be brought about by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, thimerosal, and the like.
  • isotonic agents for example, sugars or sodium chloride.
  • Prolonged absorption of the injectable compositions can be brought about by the use in the compositions of agents delaying absorption, for example, aluminum monostearate and gelatin.
  • Sterile injectable solutions are prepared by incorporating the active compounds in the required amount in the appropriate solvent with various of the other ingredients enumerated above, as required, followed by filtered sterilization.
  • dispersions are prepared by incorporating the various sterilized active ingredients into a sterile vehicle which contains the basic dispersion medium and the required other ingredients from those enumerated above.
  • the preferred methods of preparation are vacuum-drying and freeze-drying techniques, which yield a powder of the active ingredient, plus any additional desired ingredient from a previously sterile- filtered solution thereof.
  • Administration of the compositions according to the present invention will typically be via any common route.
  • a vaccine composition may be inhaled (e.g., U.S. Patent 6,651,655, which is specifically incorporated by reference). Such compositions would normally be administered as pharmaceutically acceptable compositions that include physiologically acceptable carriers, buffers or other excipients.
  • the term “pharmaceutically acceptable” refers to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem complications commensurate with a reasonable benefit/risk ratio.
  • pharmaceutically acceptable carrier means a pharmaceutically acceptable material, composition or vehicle, such as a liquid or solid filler, diluent, excipient, solvent or encapsulating material, involved in carrying or transporting a chemical agent.
  • aqueous solutions for parenteral administration in an aqueous solution
  • the solution should be suitably buffered, if necessary, and the liquid diluent first rendered isotonic with sufficient saline or glucose.
  • aqueous solutions are especially suitable for intravenous, intramuscular, subcutaneous, and intraperitoneal administration.
  • sterile aqueous media which can be employed will be known to those of skill in the art in light of the present disclosure.
  • one dosage could be dissolved in isotonic NaCl solution and either added to hypodermoclysis fluid or injected at the proposed site of infusion, (see for example, Remington's Pharmaceutical Sciences, 1990). Some variation in dosage will necessarily occur depending on the condition of the subject. The person responsible for administration will, in any event, determine the appropriate dose for the individual subject.
  • unit dose or “dosage” refers to physically discrete units suitable for use in a subject, each unit containing a predetermined quantity of the composition calculated to produce the desired responses discussed above in association with its administration, i.e., the appropriate route and regimen.
  • Precise amounts of the composition also depend on the judgment of the practitioner and are peculiar to each individual. Factors affecting dose include physical and clinical state of the subject, route of administration, intended goal of treatment (alleviation of symptoms versus cure), and potency, stability, and toxicity of the particular composition.
  • solutions Upon formulation, solutions will be administered in a manner compatible with the dosage formulation and in such amount as is therapeutically or prophylactically effective.
  • the formulations are easily administered in a variety of dosage forms, such as the type of injectable solutions described above.
  • in vitro administration refers to manipulations performed on cells removed from or outside of a subject, including, but not limited to cells in culture.
  • ex vivo administration refers to cells which have been manipulated in vitro, and are subsequently administered to a subject.
  • in vivo administration includes all manipulations performed within a subject.
  • the compositions may be administered either in vitro, ex vivo, or in vivo.
  • autologous B-lymphocyte cell lines are incubated with a virus vector of the instant invention for 24 to 48 hours or with a variant SpA and/or cogaulase and/or any other composition described herein for two hours.
  • the transduced cells can then be used for in vitro analysis, or alternatively for ex vivo administration.
  • U.S. Patents 4,690,915 and 5,199,942 both incorporated herein by reference, disclose methods for ex vivo manipulation of blood mononuclear cells and bone marrow cells for use in therapeutic applications.
  • Another aspect of the invention is a method of preparing an immunoglobulin for use in prevention or treatment of staphylococcal infection comprising the steps of immunizing a recipient or donor with the vaccine of the invention and isolating immunoglobulin from the recipient or donor.
  • An immunoglobulin prepared by this method is a further aspect of the invention.
  • a pharmaceutical composition comprising the immunoglobulin of the invention and a pharmaceutically acceptable carrier is a further aspect of the invention which could be used in the manufacture of a medicament for the treatment or prevention of staphylococcal disease.
  • a method for treatment or prevention of staphylococcal infection comprising a step of administering to a patient an effective amount of the pharmaceutical preparation of the invention is a further aspect of the invention.
  • Inocula for polyclonal antibody production are typically prepared by dispersing the antigenic composition in a physiologically tolerable diluent such as saline or other adjuvants suitable for human use to form an aqueous composition.
  • a physiologically tolerable diluent such as saline or other adjuvants suitable for human use to form an aqueous composition.
  • An immunostimulatory amount of inoculum is administered to a mammal and the inoculated mammal is then maintained for a time sufficient for the antigenic composition to induce protective antibodies.
  • the antibodies can be isolated to the extent desired by well known techniques such as affinity chromatography (Harlow and Lane, 1988).
  • Antibodies can include antiserum preparations from a variety of commonly used animals, e.g. goats, primates, donkeys, swine, horses, guinea pigs, rats or man.
  • An immunoglobulin produced in accordance with the present invention can include whole antibodies, antibody fragments or subfragments.
  • Antibodies can be whole immunoglobulins of any class (e.g., IgG, IgM, IgA, IgD or IgE), chimeric antibodies or hybrid antibodies with dual specificity to two or more antigens of the invention. They may also be fragments (e.g., F(ab')2, Fab', Fab, Fv and the like) including hybrid fragments.
  • An immunoglobulin also includes natural, synthetic, or genetically engineered proteins that act like an antibody by binding to specific antigens to form a complex.
  • a vaccine of the present invention can be administered to a recipient who then acts as a source of immunoglobulin, produced in response to challenge from the specific vaccine.
  • a subject thus treated would donate plasma from which hyperimmune globulin would be obtained via conventional plasma fractionation methodology.
  • the hyperimmune globulin would be administered to another subject in order to impart resistance against or treat staphylococcal infection.
  • Hyperimmune globulins of the invention are particularly useful for treatment or prevention of staphylococcal disease in infants, immune compromised individuals, or where treatment is required and there is no time for the individual to produce antibodies in response to vaccination.
  • An additional aspect of the invention is a pharmaceutical composition
  • a pharmaceutical composition comprising two of more monoclonal antibodies (or fragments thereof; preferably human or humanised) reactive against at least two constituents of the immunogenic composition of the invention, which could be used to treat or prevent infection by Gram positive bacteria, preferably staphylococci, more preferably S. aureus or S. epidermidis.
  • Such pharmaceutical compositions comprise monoclonal antibodies that can be whole immunoglobulins of any class, chimeric antibodies, or hybrid antibodies with specificity to two or more antigens of the invention. They may also be fragments ⁇ e.g., F(ab')2, Fab', Fab, Fv and the like) including hybrid fragments.
  • monoclonal antibodies are well known in the art and can include the fusion of splenocytes with myeloma cells (Kohler and Milstein, 1975; Harlow and Lane, 1988). Alternatively, monoclonal Fv fragments can be obtained by screening a suitable phage display library (Vaughan et ah, 1998). Monoclonal antibodies may be humanized or part humanized by known methods.
  • mice developed disseminated abscesses in multiple organs, detectable by light microscopy of hematoxylin-eosin stained, thin-sectioned kidney tissue.
  • the initial abscess diameter was 524 ⁇ M ( ⁇ 65 ⁇ M); lesions were initially marked by an influx of polymorphonuclear leukocytes (PMNs) and harbored no discernable organization of staphylococci, most of which appeared to reside within PMNs.
  • PRNs polymorphonuclear leukocytes
  • abscesses increased in size and enclosed a central population of staphylococci, surrounded by a layer of eosinophilic, amorphous material and a large cuff of PMNs.
  • Peripheral lesions were prone to rupture, thereby releasing necrotic material and staphylococci into the peritoneal cavity or the retroperitoneal space. These events resulted in bacteremia as well as a secondary wave of abscesses, eventually precipitating a lethal outcome.
  • S. aureus Newman When examined by scanning electron microscopy, S. aureus Newman was located in tightly associated lawns at the center of abscesses. Staphylococci were contained by an amorphous pseudocapsule that separated bacteria from the cuff of abscesses leukocytes. No immune cells were observed in these central nests of staphylococci, however occasional red blood cells were located among the bacteria. Bacterial populations at the abscess center, designated staphylococcal abscess communities (SAC), appeared homogenous and coated by an electron-dense, granular material. The kinetics of the appearance of infectious lesions and the morphological attributes of abscesses formed by S. aureus Newman were similar to those observed following mouse infection with S. aureus USA300 (LAC), the current epidemic community-acquired methicillin-resistant S. aureus (CA-MRSA) clone in the United States (Diep et al., 2006).
  • LAC S. aureus USA300
  • Sortase A is a transpeptidase that immobilizes nineteen surface proteins in the envelope of S. aureus strain Newman (Mazmanian et al., 1999; Mazmanian et al, 2000). Earlier work identified sortase A as a virulence factor in multiple animal model systems, however the contributions of this enzyme and its anchored surface proteins to abscess formation or persistence have not yet been revealed (Jonsson et al, 2002; Weiss et al, 2004).
  • sortase A anchored surface proteins enable the formation of abscess lesions and the persistence of bacteria in host tissues, wherein staphylococci replicate as communities embedded in an extracellular matrix and shielded from surrounding leukocytes by an amorphous pseudocapsule.
  • Sortase A anchors a large spectrum of proteins with LPXTG motif sorting signals to the cell wall envelope, thereby providing for the surface display of many virulence factors (Mazmanian et al, 2002).
  • the inventors demonstrate for the first time that Protein A variants no longer able to bind to immunoglobulins, vWF and TNFR-I are removed of their toxigenic potential and are able to stimulate humoral immune responses that protect against staphylococcal disease.
  • Protein A is synthesized as a precursor in the bacterial cytoplasm and secreted via its YSIRK signal peptide at the cross wall, i.e., the cell division septum of staphylococci (FIG. IA). (DeDent et al., 2007; DeDent et al., 2008). Following cleavage of the C- terminal LPXTG sorting signal, Protein A is anchored to bacterial peptidoglycan crossbridges by sortase A (Schneewind et al., 1995; Mazmanian et al., 1999; Mazmanian et al., 2000).
  • Protein A is the most abundant surface protein of staphylococci; the molecule is expressed by virtually all S. aureus strains (Sa ⁇ d-Salim et al., 2003; Cespedes et al., 2005; Kennedy et al., 2008). Staphylococci turn over 15-20% of their cell wall per division cycle (Navarre and Schneewind 1999). Murine hydrolases cleave the glycan strands and wall peptides of peptidoglycan, thereby releasing Protein A with its attached C-terminal cell wall disaccharide tetrapeptide into the extracellular medium (Ton-That et al., 1999). Thus, by physiological design, Protein A is both anchored to the cell wall and displayed on the bacterial surface but also released into surrounding tissues during host infection (Marraffini et al., 2006).
  • Protein A captures immunoglobulins on the bacterial surface and this biochemical activity enables staphylococcal escape from host innate and acquired immune responses (Jensen 1958; Goodyear and Silverman 2004).
  • region X of Protein A (Guss et al, 1984), a repeat domain that tethers the IgG binding domains to the LPXTG sorting signal/cell wall anchor, is perhaps the most variable portion of the staphylococcal genome (Schneewind et al, 1992; Sa ⁇ d-Salim et al, 2003).
  • Each of the five immunoglobulin binding domains of Protein A (SpA), formed from three helix bundles and designated E, D, A, B, and C, exerts similar structural and functional properties (Sj ⁇ dahl 1977; Jansson et al, 1998).
  • the solution and crystal structure of domain D has been solved both with and without the Fc and V H 3 (Fab) ligands, which bind Protein A in a non-competitive manner at distinct sites (Graille et ⁇ /., 2000).
  • the Fab interacts with helix II and helix III of domain D via a surface composed of four VH region ⁇ -strands (Graille et al, 2000).
  • the major axis of helix II of domain D is approximately 50° to the orientation of the strands, and the interhelical portion of domain D is most proximal to the CO strand.
  • the site of interaction on Fab is remote from the Ig light chain and the heavy chain constant region. The interaction involves the following domain D residues: Asp-36 of helix II as well as Asp-37 and Gln-40 in the loop between helix II and helix III, in addition to several other residues with SpA-D (Graille et al, 2000).
  • Both interacting surfaces are composed predominantly of polar side chains, with three negatively charged residues on domain D and two positively charged residues on the 2A2 Fab buried by the interaction, providing an overall electrostatic attraction between the two molecules. Of the five polar interactions identified between Fab and domain D, three are between side chains. A salt bridge is formed between Arg-H19 and Asp-36 and two hydrogen bonds are made between Tyr-H59 and Asp-37 and between Asn-H82a and Ser-33. Because of the conservation of Asp-36 and Asp-37 in all five IgG binding domains of Protein A, these residues were selected for mutagenesis.
  • the SpA-D sites responsible for Fab binding are structurally separate from the domain surface that mediates Fc ⁇ binding.
  • the interaction of Fc ⁇ with domain B primarily involves residues in helix I with lesser involvement of helix II (Deisenhofer 1981; Gouda et al, 1992).
  • the Gln-32 a minor contact in both complexes, none of the residues that mediate the Fc ⁇ interaction are involved in Fab binding.
  • the SpA domains in these complexes have been superimposed to construct a model of a complex between Fab, the SpA-domain D, and the Fc ⁇ molecule.
  • Protein A functions analogously to staphylococcal superantigens (Roben et al., 1995), albeit that the latter class of molecules, for example SEB, TSST-I, TSST-2, form complexes with the T cell receptor to inappropriately stimulate host immune responses and thereby precipitating characteristic disease features of staphylococcal infections (Roben et al., 1995; Tiedemann et al., 1995).
  • SEB staphylococcal superantigens
  • TSST-I TSST-2
  • the inventors have developed a non- toxigenic variant of staphylococcal Protein A and, with this reagent in hand, aimed for the first time to measure the immune response of animals to Protein A immunization. Further, the inventors address whether immunization of animals with a non-toxigenic variant of Protein A could generate immune responses that raise protective immunity against staphylococcal infection.
  • glutamine (Q) residues 9 and 10 [the numbering here is derived from that established for the SpA domain D] were modified generating lysine or glycine substitutions for both glutamines with the expectation that these substitutions abolish the ion bonds formed between wild-type Protein A and its ligands.
  • the added effect of the dual lysine substitutions may be that these positively charged residues institute a repellent charge for immunoglobulins.
  • the inventors selected the aspartate (D) residues 36 and 37 of SpA-D, each of which is required for the association of Protein A with the B cell receptor.
  • D36 and D37 were both substituted with alanine.
  • the Q9,10K and D36,37A mutations were combined in the recombinant molecule SpA-DQ9jo ⁇ ;D36,37A and examined for the binding attributes of Protein A.
  • SpA-D The domain D of SpA (SpA-D) was PCR amplified with a pair of specific primers (AACATATGTTCAACAAAGATCAACAAAGC [5' primer](SEQ ID NO:38) and AAGGATCCAGATTCGTTTAATTTTTTAGC [3' primer] (SEQ ID NO:39)), sub- cloned into the pET15b vector (pHANl, spa codons 212-261) and recombinant plasmid transformed into E.
  • Protein samples were eluted with 2 ml elution buffer (500 mM imidazole in column buffer), fractions collected and aliquots subjected to SDS-PAGE gel electrophoresis, followed by Coomassie-Blue staining.
  • wild-type Protein A SpA
  • SpA-domain D both retained immunogobulin during chromatography.
  • the SpA-DQ9jo ⁇ ; D36,37A variant did not bind to immunoglobulin.
  • SpA-D for hF(ab) 2 When compared with the reduced binding power of SpA-D for hF(ab) 2 , of the two variants only SpA-DQ9,io ⁇ ;D36,37A displayed a significant reduction in the ability to bind the VH3 domain of immunoglobulin.
  • purified proteins were injected into mice, which were sacrificed after 4 hours to remove their spleens.
  • Non-toxigenic Protein A variants elicit vaccine protection.
  • SpA, SpA- D, SpA-DQ9,io ⁇ ;D36,37A, and SpA-DQ9,iOK;D36,37A were emulsified with complete or incomplete Freund's adjuvant and immunized 4 week old BALB/c mice on day 1 and day 11 with 50 ⁇ g of purified protein.
  • mice generated only a modest humoral immune response directed at wild-type Protein A or its SpA-D module, whereas the amount of antibody raised following immunization with SpA-DQ9jo ⁇ ;D36,37A or SpA-DQ9jo ⁇ ;D36,37A was increased four to five fold.
  • animals were killed on day 4, their kidneys removed and either analyzed for staphylococcal load (by plating tissue homogenate on agar plates and enumerating colony forming units, CFU) or histopathology.
  • aMeans of staphylococcal load calculated as logio CFU g " in homogenized renal tissues 4 days following infection in cohorts of 18 to 20 BALB/c mice. Standard error of the means ( ⁇ SEM) is indicated.
  • SpA-Dl and SpA-D2 represent SpA-D Q9il o ⁇ ,D36,37A and SpA-D Q9il oG,D36,37A , respectively.
  • Vaccine protection in murine abscess, murine lethal infection, and murine pneumonia models Three animal models have been established for the study of S. aureus infectious disease. These models are used here to examine the level of protective immunity provided via the generation of Protein A specific antibodies.
  • Murine abscess - BALB/c mice (24-day-old female, 8-10 mice per group, Charles River Laboratories, Wilmington, MA) are immunized by intramuscular injection into the hind leg with purified protein (Chang et al., 2003; Schneewind et al, 1992).
  • Purified SpA, SpA-D or SpA-DQ9,10K;D36,37A (50 ⁇ g protein) is administered on days 0 (emulsified 1 :1 with complete Freund's adjuvant) and 11 (emulsified 1 :1 with incomplete Freund's adjuvant). Blood samples are drawn by retroorbital bleeding on days 0, 11, and 20.
  • Sera are examined by ELISA for IgG titers for specific SpA-D and SpA-DQ9,10K;D36,37A binding activity.
  • Immunized animals are challenged on day 21 by retroorbital injection of 100 ⁇ l of S. aureus Newman or S. aureus USA300 suspension (1 x 10 7 cfu). For this, overnight cultures of S. aureus Newman are diluted 1 :100 into fresh tryptic soy broth and grown for 3 h at 37°C. Staphylococci are centrifuged, washed twice, and diluted in PBS to yield an A 6 OO of 0.4 (1 x 10 cfu per ml). Dilutions are verified experimentally by agar plating and colony formation.
  • mice are anesthetized by intraperitoneal injection of 80-120 mg of ketamine and 3-6 mg of xylazine per kilogram of body weight and infected by retroorbital injection. On day 5 or 15 following challenge, mice are euthanized by compressed CO 2 inhalation. Kidneys are removed and homogenized in 1% Triton X- 100. Aliquots are diluted and plated on agar medium for triplicate determination of cfu. For histology, kidney tissue is incubated at room temperature in 10% formalin for 24 h. Tissues are embedded in paraffin, thin-sectioned, stained with hematoxylinleosin, and examined by microscopy.
  • Murine lethal infection - BALB/c mice (24-day-old female, 8-10 mice per group, Charles River Laboratories, Wilmington, MA) are immunized by intramuscular injection into the hind leg with purified SpA, SpA-D or SpA- D Q9 , IOK;D36 , 37A (50 ⁇ g protein).
  • Vaccine is administered on days 0 (emulsified 1 :1 with complete Freund's adjuvant) and 11 (emulsified 1 :1 with incomplete Freund's adjuvant). Blood samples are drawn by retroorbital bleeding on days 0, 11, and 20.
  • Sera are examined by ELISA for IgG titers with specific SpA-D and SpA- D Q9 , IOK;D36 , 37A binding activity.
  • Immunized animals are challenged on day 21 by retroorbital injection of 100 ⁇ l of S. aureus Newman or S. aureus US A300 suspension (15 x 10 7 cfu) (34). For this, overnight cultures of S. aureus Newman are diluted 1 :100 into fresh tryptic soy broth and grown for 3 h at 37°C. Staphylococci are centrifuged, washed twice, diluted in PBS to yield an A 6 oo of 0.4 (1 x 10 8 cfu per ml) and concentrated.
  • mice are anesthetized by intraperitoneal injection of 80-120 mg of ketamine and 3-6 mg of xylazine per kilogram of body weight.
  • Immunized animals are challenged on day 21 by intraperitoneal inject with 2 x 10 10 cfu of S. aureus Newman or 3-10 x 10 9 cfu of clinical S. aureus isolates. Animals are monitored for 14 days, and lethal disease is recorded.
  • Murine pneumonia model - S. aureus strains Newman or USA300 are grown at 37°C in tryptic soy broth/agar to OD 66 o 0.5. 50-ml culture aliquots are centrifuged, washed in PBS, and suspended in 750 ⁇ l PBS for mortality studies (3-4 x 10 8 CFU per 30- ⁇ l volume), or 1,250 ⁇ l PBS (2 x 10 8 CFU per 30- ⁇ l volume) for bacterial load and histopathology experiments (2, 3).
  • 7-wk-old C57BL/6J mice (The Jackson Laboratory) are anesthetized before inoculation of 30 ⁇ l of S. aureus suspension into the left nare.
  • mice For active immunization, 4-wk-old mice receive 20 ⁇ g SpA-D or SPA-D Q9 J OK;D36,37A in CFA on day 0 via the i.m. route, followed by a boost with 20 ⁇ g SpA-D or SPA-D Q9 J OK;D36,37A in incomplete Freund's adjuvant (IFA) on day 10. Animals are challenged with S. aureus on day 21. Sera are collected before immunization and on day 20 to assess specific antibody production.
  • IFA incomplete Freund's adjuvant
  • mice receive 100 ⁇ l of either NRS (normal rabbit serum) or SpA-D-specific rabbit antisera via i.p. injection 24 h before challenge.
  • NRS normal rabbit serum
  • SpA-D-specific rabbit antisera via i.p. injection 24 h before challenge.
  • infected animals are killed via forced CO 2 inhalation before removal of both lungs.
  • the right lung is homogenized for enumeration of lung bacterial load.
  • the left lung is placed in 1% formalin and paraffin embedded, thin sectioned, stained with hematoxylin-eosin, and analyzed by microscopy.
  • Rabbit antibodies - Purified 200 ⁇ g SpA-D or SPA-DQ9 )10 K;D36,37A is used as an immunogen for the production of rabbit antisera.
  • 200 ⁇ g protein is emulsified with CFA for injection at day 0, followed by booster injections with 200 ⁇ g protein emulsified with IFA on days 21 and 42.
  • Rabbit antibody titers are determined by ELISA.
  • Purified antibodies are obtained by affinity chromatography of rabbit serum on SpA-D or SpA-DQ 9 jo ⁇ ; D36,37A sepharose. The concentration of eluted antibodies is measured by absorbance at A 2 8o and specific antibody titers are determined by ELISA.
  • any reduction in bacterial load (murine abscess and pneumonia), histopathology evidence of staphylococcal disease (murine abscess and pneumonia) and protection from lethal disease (murine lethal challenge and pneumonia) is measured.
  • mice Passive immunization with affinity purified rabbit polyclonal antibodies generated against SpA-domain D variants.
  • mice are passively immunized with 5 mg/kg of purified SpA-D or SpA-DQ 9 jo ⁇ ; D36,37A derived rabbit antibodies. Both of these antibody preparations are purified by affinity chromatography using immobilized SpA-D or SpA-DQ9,io ⁇ ;D36,37A.
  • animals are passively immunized with rVIO antibodies (a plague protective antigen that has no impact on the outcome of staphylococcal infections).
  • Antibody titers against all Protein A preparations are determined using SpA-DQ 9J0 K ; D36,37A as an antigen, as this variant cannot bind the Fc or Fab portion of IgG.
  • the infectious disease models described above the reduction in bacterial load (murine abscess and pneumonia), histopathology evidence of staphylococcal disease (murine abscess and pneumonia), and the protection from lethal disease (murine lethal challenge and pneumonia) is measured.
  • the inventors distinguish between Fc domain and B cell receptor activation of Igs and measured association of human Fc ⁇ and F(ab) 2 fragments, both of which bound to full-length SpA or SpA-D, but not to SpA-D ⁇ AA (FIG. ID).
  • Injection of SpA-D into the peritoneal cavity of mice resulted in B cell expansion followed by apoptotic collapse of CD 19+ lymphocytes in spleen tissue of BALB/c mice (Goodyear and Silverman, 2003)(FIG. IE).
  • Immunized mice were challenged by intravenous inoculation with S. aureus Newman and the ability of staphylococci to seed abscesses in renal tissues was examined by necropsy four days after challenge.
  • SpA-D ⁇ AA antibodies prevent immunoglobulin-protein A interaction.
  • SpA-D K ⁇ AA affinity column followed by SDS-PAGE (FIG. 3).
  • SpA-D K ⁇ AA specific IgG was cleaved with pepsin to generate Fc ⁇ and F(ab) 2 fragments, the latter of which were purified by chromatography on SpA-D ⁇ AA column (FIG. 3).
  • Binding of human IgG or vWF to SpA or SpA-D was perturbed by SpA-D ⁇ AA specific F(ab) 2 , indicating that SpA-D ⁇ AA derived antibodies neutralize the B cell superantigen function of protein A as well as its interactions with Ig (FIG. 3).
  • SpA K ⁇ AA generates improved protective immune responses.
  • the inventors generated SpA ⁇ AA 5 which includes all five IgBDs with four amino acid substitutions - substitutions corresponding to Gln9Lys, GlnlOLys, Asp36Ala and Asp37Ala of domain D - in each of its five domains (E, D, A, B and C).
  • Polyhistidine tagged SpA K ⁇ AA was purified by affinity chromatography and analyzed by Coomassie Blue- stained SDS-PAGE (FIG. 4).
  • SpA KK AA did not bind human IgG, Fc and F(ab) 2 or vWF (FIG. 4).
  • SPA KKAA failed to display B cell superantigen activity, as injection of the variant into BALB/c mice did not cause a depletion of CD 19+ B cells in splenic tissue (FIG. 4).
  • SPA KKAA vaccination generated higher specific antibody titers than SpA-D ⁇ AA immunization and provided mice with elevated protection against S. aureus USA300 challenge (Table 5).
  • the inventors also sought to ascertain whether protein A-specific antibodies can protect animals against lethal challenge.
  • BALB/c mice were actively or passively immunized to raise antibodies against SPA KKAA and then challenged by intraperitoneal injection with lethal doses of S. aureus Newman (FIG. 6).
  • dMeans of five randomly chosen serum IgG titers were measured prior to staphylococcal infection by ELISA.
  • bMeans of staphylococcal load calculated as logio CFU g "1 in homogenized renal tissues 4 days following infection in cohorts of fifteen BALB/c mice per immunization. A representative of two independent and reproducible animal experiments is shown.
  • eMeans of five randomly chosen serum IgG titers were measured prior to staphylococcal infection by ELISA.
  • the minimal concentration of protein A-specif ⁇ c IgG required for disease protection in SpA K ⁇ AA or SpA-D ⁇ AA vaccinated animals was calculated as 4.05 ⁇ g ml "1 ( ⁇ 0.88).
  • Average serum concentration of SpA-specific IgG in adult healthy human volunteers was 0.21 ⁇ g ml "1 ( ⁇ 0.02).
  • Clinical S. aureus isolates express protein A, an essential virulence factor whose B cell surperantigen activity and evasive attributes towards opsono-phagocytic clearance are absolutely required for staphylococcal abscess formation (Palmqvist et al., 2005; Cheng et al., 2009; Silverman and Goodyear, 2006).
  • Protein A can thus be thought of as a toxin, essential for pathogenesis, whose molecular attributes must be neutralized in order to achieve protective immunity.
  • the inventors measure here for the first time protein A neutralizing immune responses as a correlate for protective immunity against S.
  • Staphylococcus aureus strains Newman and USA300 were grown in tryptic soy broth (TSB) at 37°C.
  • Escherichia coli strains DH5 ⁇ and BL21 (DE3) were grown in Luria-Bertani (LB) broth with 100 ⁇ g ml "1 ampicillin at 37 0 C.
  • SpA-D was PCR-amplif ⁇ ed with two primers, aacatatgttcaacaagatcaacaagc (SEQ ID NO: 38) and aaggatccagattcgtttaattttttagc (SEQ ID NO:39).
  • the sequence for SpA-D K ⁇ AA was mutagenized with two sets of primers catatgttcaacaaagataaaaaaagcgccttctatgaaatc (SEQ ID NO:42) and gatttcatagaaggcgcttttttatctttgttgaacatatg (SEQ ID NO:43) for for Q9K, QlOK as well as cttcattcaaagtctttaaagccgcccaagccaaagcactaac (SEQ ID NO:40) and gttagtgcttttggcttggggcggctttaagactttgaatgaag (SEQ ID NO:41) for D36A,D37A.
  • SPA KKAA The sequence of SPA KKAA was synthesized by Integrated DNA Technologies, Inc. PCR products were cloned into pET-15b generating N-terminal HiS 6 tagged recombinant protein. Plasmids were transformed into BL21(DE3). Overnight cultures of transformants were diluted 1 :100 into fresh media and grown at 37°C to an OD6000.5, at which point cultures were induced with 1 mM isopropyl ⁇ -D-1- thiogalatopyranoside (IPTG) and grown for an additional three hours.
  • IPTG isopropyl ⁇ -D-1- thiogalatopyranoside
  • Bacterial cells were sedimented by centrifugation, suspended in column buffer (50 mM Tris-HCl, pH 7.5, 150 mM NaCl) and disrupted with a French pressure cell at 14,000 psi. Lysates were cleared of membrane and insoluble components by ultracentrifugation at 40,000 xg. Proteins in the soluble lysate were subjected to nickel-nitrilotriacetic acid (Ni- NTA, Qiagen) affinity chromatography. Proteins were eluted in column buffer containing successively higher concentrations of imidazole (100-500 mM). Protein concentrations were determined by bicinchonic acid (BCA) assay (Thermo Scientific).
  • BCA bicinchonic acid
  • rabbits (6 month old New-Zealand white, female, Charles River Laboratories) were immunized with 500 ⁇ g protein emulsified in Complete Freund's Adjuvant (Difco) by subscapular injection.
  • proteins emulsified in Incomplete Freund's Adjuvant were injected 24 or 48 days following the initial immunization.
  • rabbits were bled and serum recovered.
  • Antibody Isolation Purified antigen (5 mg protein) was covalently linked to HiTrap NHS-activated HP columns (GE Healthcare). Antigen-matrix was used for affinity chromatography of 10-20 ml of rabbit serum at 4°C. Charged matrix was washed with 50 column volumes of PBS, antibodies eluted with elution buffer (1 M glycine, pH 2.5, 0.5 M NaCl) and immediately neutralized with IM Tris-HCl, pH 8.5. Purified antibodies were dialyzed overnight against PBS at 4°C.
  • F(ab) 2 fragments Affinity purified antibodies were mixed with 3 mg of pepsin at 37°C for 30 minutes. The reaction was quenched with 1 M Tris-HCl, pH 8.5 and F(ab) 2 fragments were affinity purified with specific antigen-conjugated HiTrap NHS-activated HP columns. Purified antibodies were dialyzed overnight against PBS at 4°C, loaded onto SDS-PAGE gel and visualized with Coomassie Blue staining.
  • mice (week old, female, Charles River Laboratories) were immunized with 50 ⁇ g protein emulsified in Complete Freund's Adjuvant (Difco) by intramuscular injection.
  • proteins were emulsified in Incomplete Freund's Adjuvant and injected 11 days following the initial immunization.
  • ELISA enzyme- linked immunosorbent assay
  • mice were immunized by intramuscular injection and boosted with the same antigen in Alum after 11 and 25 days. On day 34, mice were bled to obtain serum for specific antibody titers. Affinity purified antibodies were injected into the peritoneal cavity of BALB/c mice either 24 hours or 4 hours prior to sublethal or lethal challenge, respectively. Animal blood was collected via periorbital vein puncture and antigen specific serum antibody titers measured by ELISA.
  • mice were infected by retro- obital injection with 1 x 10 7 CFU of S. aureus Newman or 5 x 10 6 CFU of S. aureus USA300.
  • mice were killed by CO 2 inhalation.
  • Both kidneys were removed, and the staphylococcal load in one organ was analyzed by homogenizing renal tissue with PBS, 1% Triton X-IOO. Serial dilutions of homogenate were spread on TSA and incubated for colony formation. The remaining organ was examined by histopathology. Briefly, kidneys were fixed in 10% formalin for 24 hours at room temperature.
  • Tissues were embedded in paraffin, thin-sectioned, stained with hematoxylin-eosin, and inspected by light microscopy to enumerate abscess lesions. All mouse experiments were performed in accordance with the institutional guidelines following experimental protocol review and approval by the Institutional Biosafety Committee (IBC) and the Institutional Animal Care and Use Committee (IACUC) at the University of Chicago.
  • IBC Institutional Biosafety Committee
  • IACUC Institutional Animal Care and Use Committee
  • mice were used to infect anesthetized mice by retro-orbital injection (1 x 10 7 CFU of S. aureus Newman, 5 x 10 6 CFU of S. aureus USA300 or 3 x 10 7 CFU of S. aureus Mu50).
  • mice were killed, kidneys removed, and homogenized tissue spread on agar for colony formation.
  • Organ tissue was also thin-sectioned, stained with hematoxylin-eosin, and viewed by microscopy.
  • Animal experiments were performed in accordance with the institutional guidelines following experimental protocol review and approval by the Institutional Biosafety Committee (IBC) and the Institutional Animal Care and Use Committee (IACUC) at the University of Chicago.
  • IBC Institutional Biosafety Committee
  • IACUC Institutional Animal Care and Use Committee
  • mice (cohorts of 8-10 animals per experiment) were injected with a suspension of 2-6 x 10 CFU of S. aureus Newman or its isogenic ⁇ spa variant into the peritoneal cavity. Animal survival was monitored over a period of 15 days and statistical significance of survival data analyzed with the log-rank test.
  • Protein A binding For human IgG binding, Ni-NTA affinity columns were pre-charged with 200 ⁇ g of purified proteins (SpA, SpA-D, SpA-D ⁇ AA, and SrtA) in column buffer. After washing, 200 ⁇ g of human IgG (Sigma) was loaded onto the column. Protein samples were collected from washes and elutions and subjected to SDS-PAGE gel electrophoresis, followed by Coomassie Blue staining.
  • Purified proteins (SpA, SPAKKAA, SpA-D and SPA-D K KAA) were coated onto MaxiSorp ELISA plates (NUNC) in 0.1M carbonate buffer (pH 9.5) at 1 ⁇ g ml "1 concentration overnight at 4°C. Plates were next blocked with 5% whole milk followed by incubation with serial dilutions of peroxidase-conjugated human IgG, Fc or F(ab) 2 fragments for one hour. Plates were washed and developed using OptEIA ELISA reagents (BD). Reactions were quenched with 1 M phosphoric acid and A450 readings were used to calculate half maximal titer and percent binding.
  • NUNC MaxiSorp ELISA plates
  • BD OptEIA ELISA reagents
  • Splenocyte apoptosis Affinity purified proteins (150 ⁇ g of SpA, SpA-D, SPAKKAA, and SPA-DKKAA) were injected into the peritoneal cavity of BALB/c mice (6 week old, female, Charles River Laboratories). Four hours following injection, animals were killed by CO 2 inhalation. Their spleens were removed and homogenized. Cell debris were removed using cell strainer and suspended cells were transferred to ACK lysis buffer (0.15 M NH 4 Cl, 10 mM KHCO 3 , 0.1 mM EDTA) to lyse red blood cells.
  • ACK lysis buffer (0.15 M NH 4 Cl, 10 mM KHCO 3 , 0.1 mM EDTA
  • White blood cells were sedimented by centrifugation, suspended in PBS and stained with 1 :250 diluted R-PE conjugated anti-CD 19 monoclonal antibody (Invitrogen) on ice and in the dark for one hour. Cells were washed with 1% FBS and fixed with 4% formalin overnight at 4°C. The following day, cells were diluted in PBS and analyzed by flow cytometry. The remaining organ was examined for histopathology. Briefly, spleens were fixed in 10% formalin for 24 hours at room temperature. Tissues were embedded in paraffin, thin-sectioned, stained with the Apoptosis detection kit (Millipore), and inspected by light microscopy. [00348] Antibody quantification.
  • abscesses increase in size and enclose a central population of staphylococci (staphylococcal abscess community - SAC), surrounded by a layer of eosinophilic, amorphous material (the pseudocapsule) and a large cuff of PMNs (Cheng et al., 2009). Histopathology reveals massive necrosis of PMNs in proximity to the staphylococcal nidus at the center of abscess lesions as well as a mantle of healthy phagocytes. At later time intervals, SACs increase and abscesses rupture, releasing necrotic material and staphylococci into the bloodstream. A new round of abscess formation is initiated, eventually precipitating a lethal outcome of infections (Cheng et al., 2009).
  • Prothrombin specific antibodies revealed staining of the zymogen in the pseudocapsule and in the periphery, whereas fibrinogen/fibrin specific staining occurred throughout abscess lesions. Together these data indicate that the eosinophilic pseudocapsule of staphylococcal abscesses harbors prothrombin and fibrinogen, which co-localize with Coa. At the periphery of abscess lesions, Coa, vWbp, prothrombin and fibrinogen/fibrin are co-localized. These observations prompted further investigation in to whether Coa and vWbp are crucial contributors to the establishment of abscesses by triggering prothombin- mediated conversion of fibrinogen to fibrin.
  • Staphylococcus aureus coa and vWbp contribute to the clotting of mouse blood.
  • the coa and/or vWbp genes on the chromosome of S. aureus Newman were deleted by allelic replacement using pKORl technology (Bae and Schneewind, 2005).
  • Two complementing plasmids, pcoa and pvWbp, were generated by cloning coa or vWbp structural genes as well as their upstream promoter sequences into pOSl (Schneewind et al., 1993).
  • Plasmids were electroporated into staphylococci and their continued replication selected on media supplemented with chloramphenicol (Schneewind et al., 1992).
  • the inventors When probed for coagulases with specific antibodies, the inventors observed Coa secretion by the wild-type as well as the AvWbp strain, but not by Acoa or Acoa/AvWbp variants (FIG. 11).
  • the phenotypic defect of Acoa and Acoal AvWbp mutants was restored by electroporation with pco ⁇ but not by pvWbp (FIG. 11).
  • secretion of vWbp was observed in S.
  • aureus Newman wild- type
  • Acoa mutant cultures but not in AvWbp or Acoal AvWbp variants (FIG. 11).
  • This defect was restored by electroporation with pvWbp, but not by pco ⁇ .
  • Coa and vWbp are required for staphylococcal survival in blood, abscess formation and lethal bacteremia in mice.
  • the inventors first examined staphylococcal survival in lepirudin-treated blood. Wild-type strain S. aureus Newman was not killed in mouse blood, however isogenic variants lacking Coa, i.e. Acoa and Acoal AvWbp, each displayed a significant reduction in CFU after 30 min incubation. This defect in survival was restored by pco ⁇ , but not by pvWbp, suggesting that only Coa is required for staphylococcal survival in mouse blood.
  • Staphylococcal bacteremia is a frequent cause of human mortality in hospital settings (Klevens et al., 2007).
  • the inventors sought to ascertain whether coagulases are required for lethal challenge of BALB/c mice, following intravenous injection of 1 x 10 CFU S. aureus Newman. All animals infected with the wild-type parent strain Newman succumbed to infection within 24 hours (FIG. 12B). Animals infected with single mutants, Acoa or AvWbp, each displayed a short but statistically significant delay in time-to-death (FIG. 12B). The double mutant strain was significantly more impaired than mutants with single deletions and animals infected with the Acoa/AvWbp strain displayed the largest reduction in virulence as compared to the wild-type (FIG. 12B).
  • Newman or mutants thereof Five or fifteen days later, animals were killed and both kidneys removed. One kidney was fixed in formaldehyde, embedded in paraffin, thin sectioned, hemaotoxylin-eosin stained and four saggital sections per kidney were analyzed for abscess formation. The other kidney was homogenized in PBS buffer, homogenate spread on agar medium for colony formation, and staphylococcal load enumerated as CFU.
  • aMeans of staphylococcal load calculated as logio CFU g "1 in homogenized renal tissues 4 days following infection in cohorts of eighteen to twenty BALB/c mice per immunization. Standard error of the means ( ⁇ SEM) is indicated.
  • cAbscess formation in kidney tissues four days following infection was measured by macroscopic inspection (% positive) f Histopathology of hematoxylene-eosin stained, thin sectioned kidneys from ten animals; the average number of abscesses per kidney was recorded and averaged again for the final mean ( ⁇ SEM).
  • Antibodies against coagulases provide protection against staphylococcal disease.
  • IgG type antibodies specific for Coa or vWbp were isolated from rabbit serum by chromatography over an affinity column, generated by covalent crosslinking of the antigen to CNBr sepharose.
  • the inventors attempted to perturb staphylococcal pathogenesis by administration of neutralizing antibodies, directed against Coa and/or vWbp.
  • Mice were administered rabbit antibodies and challenged with a lethal dose of S. aureus strain Newman. Injection of Coa or vWbp specific antibodies significantly prolonged murine survival (FIG. 15).
  • affinity purified IgG 5 mg kg "1 body weight) were injected into the peritoneal cavity of mice. Twenty- four hours later, animals were injected with a suspension of 1 x 10 CFU S. aureus Newman in PBS into the retro-orbital plexus. Monitoring animals over time, the inventors observed that antibodies directed against vWbp ( ⁇ vWbp) led to increased time-to-death and to 10% survival, as compared to animals that had received irrelevant ⁇ VIO antibodies and died within 12-48 hours (FIG. 15). Antibodies against Coa ( ⁇ Coa) further increased the time-to-death of passively immunized mice (FIG. 15). A mixture of both antibodies ( ⁇ Coa/ ⁇ vWbp) did not generate a statistically significant improvement in survival or time-to-death over ⁇ Coa antibodies.
  • affinity purified rabbit antibodies against vWbp ⁇ - vWbp
  • Coa ⁇ -Coa
  • vWbp/Coa Coa
  • ⁇ -vWbp/Coa Coa
  • kidney was fixed in formaldehyde, embedded in paraffin, thin sectioned, hemaotoxylin-eosin stained and four saggital sections per kidney were analyzed for abscess formation.
  • the other kidney was homogenized in PBS buffer, homogenate spread on agar medium for colony formation, and staphylococcal load enumerated as
  • aMeans of staphylococcal load calculated as logio CFU g "1 in homogenized renal tissues 4 days following infection in cohorts of eighteen to twenty BALB/c mice per immunization. Standard error of the means ( ⁇ SEM) is indicated.
  • eAbscess formation in kidney tissues four days following infection was measured by macroscopic inspection (% positive) f Histopathology of hematoxylene-eosin stained, thin sectioned kidneys from ten animals; the average number of abscesses per kidney was recorded and averaged again for the final mean ( ⁇ SEM).
  • Coagulases function as protective antigens for staphylococcal infections.
  • Poly-histidine tagged CoA and vWbp were purified from E. coli and used as subunit vaccine antigens.
  • Proteins 100 ⁇ g emulisified in CFA or IFA
  • CFA CFA
  • IFA IFA
  • Animals were challenged on day 21 by intravenous inoculation of S. aureus Newman.
  • Five control animals were bled at the time of challenge and serum antibody titers against vaccine antigens were determined by ELISA (Table 9).
  • animals were examined for IgG antibody titers and on day 21 animals were challenged by intravenous inoculation with either IxIO 7 colony forming units (CFU) S. aureus Newman.
  • CFU colony forming units
  • animals were killed and both kidneys removed.
  • One kidney was fixed in formaldehyde, embedded in paraffin, thin sectioned, hemaotoxylin-eosin stained and four saggital sections per kidney were analyzed for abscess formation.
  • the other kidney was homogenized in PBS buffer, homogenate spread on agar medium for colony formation, and staphylococcal load enumerated as CFU.
  • aMeans of staphylococcal load calculated as log 10 CFU g ⁇ in homogenized renal tissues 4 days following infection in cohorts of eighteen to twenty BALB/c mice per immunization. Standard error of the means ( ⁇ SEM) is indicated.
  • dMeans of five randomly chosen serum IgG titers were measured prior to staphylococcal infection by ELISA with SpA-D KKAA antigen e Abscess formation in kidney tissues four days following infection was measured by macroscopic inspection (% positive) f Histopathology of hematoxylene-eosin stained, thin sectioned kidneys from ten animals; the average number of abscesses per kidney was recorded and averaged again for the final mean ( ⁇ SEM).
  • DNA sequences 1 kb upstream and downstream of coa and vWbp were PCR amplified using the primers attBl Coa, Coal BamHI, Coa2_BamHI, attbB2_Coa and attBl vWF, vWFl Bamffl, vWF2_BamHI, attbB2_vWF (Table 10).
  • the fragments were exchanged onto pKORl using the BP clonase II kit (Invitrogen) (Bae and Schneewind, 2005). These vectors were electroporated into S. aureus Newman and subjected to temperature shift induced allelic exchange to generate the corresponding deletion (Bae and Schneewind, 2005). Mutants were verified by PCR amplification of the gene locus, DNA sequencing, and immunoblot analysis.
  • the primers Coa_promoter_BamHI_F, Coa out PstI R, vWbp_promoter_BamHI_F, vWbp out PstI R were designed to include the upstream promoter region of vWbp or coa and the amplified regions were cloned into pOSl. These plasmids were verified by sequencing and then electroporated into staphylococcal strains. For immunoblot analysis, overnight cultures of staphylococci grown in tryptic soy broth (Difco) were refreshed 1 :100 and grown with shaking at 37°C until they reached OD600 of 0.4.
  • 450 ⁇ L blood was aliquoted into a 1 ml eppendorf tube and mixed with 50 ⁇ l bacterial sample (IxIO 5 CFU/ml). Samples were incubated at 37°C with slow rotation. 100 ⁇ l aliquots were removed at times 0 min and 30 min, mixed 1 :1 with 2% saponin/PBS and incubated on ice for 30 minutes. Five 1 :10 serial dilutions were prepared and 10 ⁇ l aliquots spread on TSA agar for colony formation and enumeration.
  • Triton-X114 was added and the solution was chilled for 5 min, incubated at 37°C for 10 min, and centrifuged at 13,000 ⁇ g. Supernatant was loaded onto a HiTrap desalting column to remove any remnant of Triton-Xl 14. Table 10. Primers used in this study
  • AttbB2_vWF GGGGACCACTTTGTACAAGAAAGCTGGGTgccctggtgtaacaaatttatg (SEQ ID NO:53)
  • Rabbit antibodies Protein concentration was determined using a BCA kit (Thermo Scientific). Purity was verified by SDS page gel analysis and Coomassie Brilliant Blue staining. Six month old New-Zealand white female rabbits (Charles River Laboratories) were immunized with 500 ⁇ g protein emulsified in CFA (Difco) for initial immunization or IFA for booster immunizations on day 24 and 48. On day 60, rabbits were bled and serum recovered for immunoblotting or passive transfer experiments. For antibody purification, recombinant His 6 -Coa or His ⁇ -vWbp (5 mg) was covalently linked to HiTrap NHS-activated HP columns (GE Healthcare).
  • This antigen-matrix was then used for affinity chromatography of 10-20 ml of rabbit serum at 4°C. Charged matrix was washed with 50 column volumes of PBS, antibodies eluted with elution buffer (1 M glycine pH 2.5, 0.5 M NaCl) and immediately neutralized with IM Tris-HCl, pH 8.5. Purified antibodies were dialyzed overnight against PBS at 4°C.
  • Coa was diluted into HBS-P buffer (20 mM HEPES [pH 7.4], 150 mM NaCl, 0.005% [vol/vol] surfactant P20) at concentrations 0 - 75 nM with successive injections of coagulase for 300 seconds followed by 300 seconds for dissociation followed by regeneration with NaOH (50 ⁇ L, 30 seconds).
  • K D and ⁇ 2 were determined using the BiaEvaluation software and best fit was determined with a 1 : 1 binding model with drifting baseline and local R max .
  • the interaction of von Willebrand factor with prothrombin and fibrinogen was measured in the same way. All experiments were repeated in triplicate.
  • IxIO 16 M prothrombin (Innovative Research) was pre -incubated for 20 min with an equimolar amount of functional coagulase or vWbp at room temperature, followed by addition of S-2238 (a chromogenic substrate) to an end concentration of 1 mM in a total reaction buffer of 100 ⁇ l 1 x PBS.
  • S-2238 a chromogenic substrate
  • the slope of the curve (dA/dt) was interpreted to be the rate of S-2238 hydrolysis, and thus reflective of enzymatic function (% coagulase-prothrombin or vWbp- prothrombin complex activity).
  • the assay was repeated in presence of specific or cross antibodies added in 3M excess (3x10 46 M) and the data was normalized to the % average activity without inhibition.
  • the primary antibodies used were 1 :500 rat anti-mouse Prothrombin (Innovative Research), 1 :500 rabbit anti-mouse fibrinogen (Innovative Research), 1 :250 rabbit- anti staphylocoagulase, or 1 :250 rabbit anti-staphylococcus vwbp. Following TBS wash, the slides were incubated with biotinylated secondary antibody (1 :50 dilution of biotinylated anti-rat IgG, BA-4001 from Vector Laboratories; or 1 :200 dilution of biotinylated anti-rabbit IgG, BA- 1000 from Vector), and then ABC reagents (Vector Laboratories).
  • mice were injected with 50 ⁇ g protein each, emulsified in 100 ⁇ l CFA. Cohorts of 15 mice were used, with 5 mice reserved for bleeding and antibody titers. Eleven days post vaccination, these mice were boosted with 50 ⁇ g protein each, emulsified in 100 ⁇ l IFA. On day 21, mice were injected with 1x107 CFU of staphylococci for the renal abscess model or 1x108 CFU for lethal challenge. At the time of infection 5 mice were bled to obtain antibody titers.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Immunology (AREA)
  • Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Microbiology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Epidemiology (AREA)
  • Mycology (AREA)
  • Biomedical Technology (AREA)
  • Zoology (AREA)
  • General Engineering & Computer Science (AREA)
  • Wood Science & Technology (AREA)
  • Biotechnology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Communicable Diseases (AREA)
  • Oncology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
PCT/US2010/029959 2009-04-03 2010-04-05 Compositions and methods related to protein a (spa) variants Ceased WO2011005341A2 (en)

Priority Applications (23)

Application Number Priority Date Filing Date Title
HRP20160274TT HRP20160274T1 (hr) 2009-04-03 2010-04-05 Pripravci i metode vezane za varijante proteina a (spa)
BRPI1010307-4A BRPI1010307B1 (pt) 2009-04-03 2010-04-05 Polipeptídeos variantes de proteína a (spa), composição imunogênica compreendendo os mesmos, vacina, método de produção da referida vacina, bem como uso dos referidos polipeptídeos
AU2010271116A AU2010271116B2 (en) 2009-04-03 2010-04-05 Compositions and methods related to Protein A (SpA) variants
EP17193256.9A EP3281947B1 (en) 2009-04-03 2010-04-05 Compositions and methods related to protein a (spa) variants
CA2757543A CA2757543C (en) 2009-04-03 2010-04-05 Compositions and methods related to protein a (spa) variants
DK10797468.5T DK2414387T3 (en) 2009-04-03 2010-04-05 Compositions and methods related to the Protein A (spa) variants
ES10797468.5T ES2563646T3 (es) 2009-04-03 2010-04-05 Composiciones y métodos relacionados con variantes de la proteína A (SpA)
JP2012503769A JP5789250B2 (ja) 2009-04-03 2010-04-05 プロテインA(SpA)変種に関連する組成物および方法
PL10797468T PL2414387T3 (pl) 2009-04-03 2010-04-05 Kompozycje i sposoby związane z wariantami białka A (SpA)
US13/260,878 US9567379B2 (en) 2009-04-03 2010-04-05 Compositions and methods related to protein A (SpA) variants
SG2011070802A SG174968A1 (en) 2009-04-03 2010-04-05 Compositions and methods related to protein a (spa) variants
PL17193256T PL3281947T3 (pl) 2009-04-03 2010-04-05 Kompozycje i sposoby związane z wariantami białka A (SpA)
EP10797468.5A EP2414387B1 (en) 2009-04-03 2010-04-05 Compositions and methods related to protein a (spa) variants
KR1020177023725A KR20170102039A (ko) 2009-04-03 2010-04-05 단백질 A(SpA) 변이체와 관련된 조성물 및 방법
SI201031085T SI2414387T1 (sl) 2009-04-03 2010-04-05 KOMPOZICIJE IN POSTOPKI, POVEZANI Z VARIANTAMI PROTEINA A (SpA)
HK12102899.4A HK1162533B (en) 2009-04-03 2010-04-05 Compositions and methods related to protein a (spa) variants
CN201080024448.7A CN102612523B (zh) 2009-04-03 2010-04-05 与蛋白a(spa)变体相关的组合物和方法
KR1020117026053A KR101773368B1 (ko) 2009-04-03 2010-04-05 단백질 A(SpA) 변이체와 관련된 조성물 및 방법
ZA2011/07702A ZA201107702B (en) 2009-04-03 2011-10-20 Composition and methods related to protein a(spa)variants
US14/335,411 US9212219B2 (en) 2009-04-03 2014-07-18 Compositions and methods related to protein A (SpA) antibodies as an enhancer of immune response
US14/968,023 US9907850B2 (en) 2009-04-03 2015-12-14 Compositions and methods related to protein A (SpA) antibodies as an enhancer of immune response
SM201600033T SMT201600033B (it) 2009-04-03 2016-02-09 COMPOSIZIONI E METODI RELATIVI A VARIANTI DELLA PROTEINA A (SpA)
CY20201100438T CY1123052T1 (el) 2009-04-03 2020-05-12 Συνθεσεις και μεθοδοι σχετικες με παραλλαγες της πρωτεϊνες α (spa)

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
US16643209P 2009-04-03 2009-04-03
US61/166,432 2009-04-03
US23795609P 2009-08-28 2009-08-28
US61/237,956 2009-08-28
US28799609P 2009-12-18 2009-12-18
US61/287,996 2009-12-18

Related Child Applications (4)

Application Number Title Priority Date Filing Date
US13/260,878 A-371-Of-International US9567379B2 (en) 2009-04-03 2010-04-05 Compositions and methods related to protein A (SpA) variants
US13/639,465 Continuation-In-Part US8808699B2 (en) 2010-04-05 2011-04-05 Compositions and methods related to protein A (SpA) antibodies as an enhancer of immune response
PCT/US2011/031213 Continuation-In-Part WO2011127032A1 (en) 2009-04-03 2011-04-05 Compositions and methods related to protein a (spa) antibodies as an enhancer of immune response
US14/335,411 Continuation-In-Part US9212219B2 (en) 2009-04-03 2014-07-18 Compositions and methods related to protein A (SpA) antibodies as an enhancer of immune response

Publications (2)

Publication Number Publication Date
WO2011005341A2 true WO2011005341A2 (en) 2011-01-13
WO2011005341A3 WO2011005341A3 (en) 2011-06-09

Family

ID=43429726

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2010/029959 Ceased WO2011005341A2 (en) 2009-04-03 2010-04-05 Compositions and methods related to protein a (spa) variants

Country Status (21)

Country Link
US (1) US9567379B2 (https=)
EP (3) EP3002293A1 (https=)
JP (1) JP5789250B2 (https=)
KR (2) KR20170102039A (https=)
CN (1) CN102612523B (https=)
AU (1) AU2010271116B2 (https=)
BR (1) BRPI1010307B1 (https=)
CA (1) CA2757543C (https=)
CY (1) CY1123052T1 (https=)
DK (2) DK2414387T3 (https=)
ES (2) ES2784957T3 (https=)
HR (2) HRP20160274T1 (https=)
HU (2) HUE026855T2 (https=)
LT (1) LT3281947T (https=)
PL (2) PL3281947T3 (https=)
PT (2) PT3281947T (https=)
SG (1) SG174968A1 (https=)
SI (2) SI3281947T1 (https=)
SM (2) SMT202000246T1 (https=)
WO (1) WO2011005341A2 (https=)
ZA (1) ZA201107702B (https=)

Cited By (33)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2012034067A1 (en) * 2010-09-09 2012-03-15 The University Of Chicago Methods and compositions involving protective staphylococcal antigens
WO2013025834A2 (en) 2011-08-15 2013-02-21 The University Of Chicago Compositions and methods related to antibodies to staphylococcal protein a
CN103037885A (zh) * 2010-07-02 2013-04-10 芝加哥大学 与蛋白A(SpA)变体相关的组合物和方法
WO2013142349A1 (en) * 2012-03-23 2013-09-26 University Of Chicago Compositions and methods related to staphylococcal sbi
WO2013162751A1 (en) 2012-04-26 2013-10-31 University Of Chicago Compositions and methods related to antibodies that neutralize coagulase activity during staphylococcus aureus disease
US20140179898A1 (en) * 2011-06-03 2014-06-26 Nat'l Institute Of Advanced Industrial Science And Technology Mutated protein of protein a having reduced affinity in acidic region and antibody-capturing agent
US8840906B2 (en) 2007-08-31 2014-09-23 The University Of Chicago Methods and compositions related to immunizing against Staphylococcal lung disease and conditions
WO2014179744A1 (en) * 2013-05-03 2014-11-06 The University Of Chicago Staphylococcus live cell vaccines
WO2015005862A1 (en) * 2013-07-10 2015-01-15 Ge Healthcare Bio-Sciences Ab Mutated immunoglobulin-binding polypeptides
WO2015144655A1 (en) * 2014-03-26 2015-10-01 Glaxosmithkline Biologicals S.A. Immunising against staphylococcus aureus
US20150273040A1 (en) * 2012-04-26 2015-10-01 University Of Chicago Compositions and methods related to antibodies that neutralize coagulase activity during staphylococcus aureus disease
WO2015144691A1 (en) * 2014-03-26 2015-10-01 Glaxosmithkline Biologicals Sa Compositions for immunising against staphylococcus aureus
US9181329B2 (en) 2007-08-31 2015-11-10 The University Of Chicago Methods and compositions related to immunizing against Staphylococcal lung diseases and conditions
WO2016095832A1 (en) * 2014-12-18 2016-06-23 The University Of Hong Kong Immunotherapeutic targets against staphylococcus aureus
CN106188251A (zh) * 2015-05-06 2016-12-07 上海张江生物技术有限公司 一种免疫球蛋白结合蛋白突变体及其用途
US9567379B2 (en) 2009-04-03 2017-02-14 The University Of Chicago Compositions and methods related to protein A (SpA) variants
US9657295B2 (en) 2010-10-01 2017-05-23 Modernatx, Inc. Modified nucleosides, nucleotides, and nucleic acids, and uses thereof
EP3101027A4 (en) * 2013-12-09 2017-07-19 Olymvax Biopharmaceuticals Inc. Staphylococcus aureus spa5 mutant, composition comprising mutant and preparation method and use thereof
US9782462B2 (en) 2012-04-02 2017-10-10 Modernatx, Inc. Modified polynucleotides for the production of proteins associated with human disease
US9814760B2 (en) 2012-04-02 2017-11-14 Modernatx, Inc. Modified polynucleotides for the production of biologics and proteins associated with human disease
US9827332B2 (en) 2012-04-02 2017-11-28 Modernatx, Inc. Modified polynucleotides for the production of proteins
US9937233B2 (en) 2010-08-06 2018-04-10 Modernatx, Inc. Engineered nucleic acids and methods of use thereof
US9950068B2 (en) 2011-03-31 2018-04-24 Modernatx, Inc. Delivery and formulation of engineered nucleic acids
US10022425B2 (en) 2011-09-12 2018-07-17 Modernatx, Inc. Engineered nucleic acids and methods of use thereof
US10323076B2 (en) 2013-10-03 2019-06-18 Modernatx, Inc. Polynucleotides encoding low density lipoprotein receptor
US10815291B2 (en) 2013-09-30 2020-10-27 Modernatx, Inc. Polynucleotides encoding immune modulating polypeptides
EP3777884A1 (en) 2019-08-15 2021-02-17 GlaxoSmithKline Biologicals S.A. Immunogenic composition
WO2021067785A1 (en) 2019-10-02 2021-04-08 Janssen Vaccines & Prevention B.V Staphylococcus peptides and methods of use
CN112898387A (zh) * 2021-03-24 2021-06-04 成都欧林生物科技股份有限公司 一种重组金黄色葡萄球菌疫苗抗原蛋白的纯化方法
US11214600B2 (en) 2016-02-12 2022-01-04 The University Of Chicago Compositions and methods related to antibodies that neutralize coagulase activity during Staphylococcus aureus disease
CN114605508A (zh) * 2022-05-11 2022-06-10 北京达成生物科技有限公司 能够结合于抗体分子Fc区域的抗体结合蛋白及其应用
US12514914B2 (en) 2019-05-14 2026-01-06 The University Of Chicago Methods and compositions comprising Staphylococcus protein a (SpA) variants
US12528882B2 (en) 2019-09-13 2026-01-20 The University Of Chicago Methods and compositions for treating staphylococcal infections

Families Citing this family (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20120149710A1 (en) * 2009-08-24 2012-06-14 The Regents Of The University Of California Sortase a inhibitors
WO2011118699A1 (ja) * 2010-03-24 2011-09-29 株式会社カネカ 免疫グロブリンに特異的に結合するタンパク質および免疫グロブリン結合性アフィニティーリガンド
EP2555794A4 (en) * 2010-04-05 2014-01-15 Univ Chicago COMPOSITIONS AND METHODS RELATING TO PROTEIN A (SPA) ANTIBODIES AS IMMUNE REACTION AMPLIFIERS
DE19216461T1 (de) 2011-10-03 2021-10-07 Modernatx, Inc. Modifizierte nukleoside, nukleotide und nukleinsäuren und verwendungen davon
CA3018046A1 (en) 2011-12-16 2013-06-20 Moderna Therapeutics, Inc. Modified nucleoside, nucleotide, and nucleic acid compositions
US9572897B2 (en) 2012-04-02 2017-02-21 Modernatx, Inc. Modified polynucleotides for the production of cytoplasmic and cytoskeletal proteins
PL2922554T3 (pl) 2012-11-26 2022-06-20 Modernatx, Inc. Na zmodyfikowany na końcach
US8980864B2 (en) 2013-03-15 2015-03-17 Moderna Therapeutics, Inc. Compositions and methods of altering cholesterol levels
CN103540588B (zh) * 2013-10-08 2016-06-08 杨波 一种基因工程改造的免疫球蛋白-亲和蛋白
US10738338B2 (en) 2016-10-18 2020-08-11 The Research Foundation for the State University Method and composition for biocatalytic protein-oligonucleotide conjugation and protein-oligonucleotide conjugate
CN116218751A (zh) * 2022-10-20 2023-06-06 昆明医科大学 一种金黄色葡萄球菌SdrC蛋白基因敲除的方法
KR102650818B1 (ko) * 2024-01-04 2024-03-27 한국콜마주식회사 황색포도상구균 단백질 a에 대한 항체를 포함하는 피부 진단용 키트

Citations (109)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3791932A (en) 1971-02-10 1974-02-12 Akzona Inc Process for the demonstration and determination of reaction components having specific binding affinity for each other
US3949064A (en) 1973-10-26 1976-04-06 Baxter Laboratories, Inc. Method of detecting antigens or antibodies
US4174384A (en) 1975-06-30 1979-11-13 Syva Company Fluorescence quenching with immunological pairs in immunoassays
US4338298A (en) 1980-04-04 1982-07-06 Endowment And Research Foundation At Montana State University Vaccine for passive immunization against enteric colibacillosis and method of use
US4356170A (en) 1981-05-27 1982-10-26 Canadian Patents & Development Ltd. Immunogenic polysaccharide-protein conjugates
US4367110A (en) 1979-07-02 1983-01-04 Toppan Printing Co. Decorative laminate and a manufacturing method therefor
US4372945A (en) 1979-11-13 1983-02-08 Likhite Vilas V Antigen compounds
US4452901A (en) 1980-03-20 1984-06-05 Ciba-Geigy Corporation Electrophoretically transferring electropherograms to nitrocellulose sheets for immuno-assays
US4474757A (en) 1981-01-13 1984-10-02 Yeda Research & Development Co., Ltd. Synthetic vaccine and process for producing same
US4554101A (en) 1981-01-09 1985-11-19 New York Blood Center, Inc. Identification and preparation of epitopes on antigens and allergens on the basis of hydrophilicity
US4578770A (en) 1982-08-30 1986-03-25 Musashi Engineering Kabushiki Kaisha Method of discriminating sheet
US4596792A (en) 1981-09-04 1986-06-24 The Regents Of The University Of California Safe vaccine for hepatitis containing polymerized serum albumin
US4599230A (en) 1984-03-09 1986-07-08 Scripps Clinic And Research Foundation Synthetic hepatitis B virus vaccine including both T cell and B cell determinants
US4599231A (en) 1984-03-09 1986-07-08 Scripps Clinic And Research Foundation Synthetic hepatitis B virus vaccine including both T cell and B cell determinants
US4601903A (en) 1985-05-01 1986-07-22 The United States Of America As Represented By The Department Of Health And Human Services Vaccine against Neisseria meningitidis Group B serotype 2 invasive disease
US4608251A (en) 1984-11-09 1986-08-26 Pitman-Moore, Inc. LHRH analogues useful in stimulating anti-LHRH antibodies and vaccines containing such analogues
US4683202A (en) 1985-03-28 1987-07-28 Cetus Corporation Process for amplifying nucleic acid sequences
US4683195A (en) 1986-01-30 1987-07-28 Cetus Corporation Process for amplifying, detecting, and/or-cloning nucleic acid sequences
US4684611A (en) 1982-02-11 1987-08-04 Rijksuniversiteit Leiden Process for the in-vitro transformation of plant protoplasts with plasmid DNA
US4690915A (en) 1985-08-08 1987-09-01 The United States Of America As Represented By The Department Of Health And Human Services Adoptive immunotherapy as a treatment modality in humans
US4748018A (en) 1984-02-07 1988-05-31 Stolle Research & Development Corp. Method of passive immunization of mammals using avian antibody
GB2202328A (en) 1987-03-11 1988-09-21 Orion Yhtymae Oy An improved method for assaying of nucleic acids, a reagent combination and a kit therefore
US4800159A (en) 1986-02-07 1989-01-24 Cetus Corporation Process for amplifying, detecting, and/or cloning nucleic acid sequences
US4879236A (en) 1984-05-16 1989-11-07 The Texas A&M University System Method for producing a recombinant baculovirus expression vector
US4952500A (en) 1988-02-01 1990-08-28 University Of Georgia Research Foundation, Inc. Cloning systems for Rhodococcus and related bacteria
US5084269A (en) 1986-11-06 1992-01-28 Kullenberg Fred W Adjuvant for dose treatment with antigens
EP0497524A2 (en) 1991-01-28 1992-08-05 Merck & Co. Inc. Polysaccharide antigens from streptococcus pneumoniae
EP0497525A2 (en) 1991-01-28 1992-08-05 Merck & Co. Inc. Pneumococcal polysaccharide conjugate vaccine
US5199942A (en) 1991-06-07 1993-04-06 Immunex Corporation Method for improving autologous transplantation
US5221605A (en) 1984-10-31 1993-06-22 Igen, Inc. Luminescent metal chelate labels and means for detection
US5238808A (en) 1984-10-31 1993-08-24 Igen, Inc. Luminescent metal chelate labels and means for detection
US5302523A (en) 1989-06-21 1994-04-12 Zeneca Limited Transformation of plant cells
US5310687A (en) 1984-10-31 1994-05-10 Igen, Inc. Luminescent metal chelate labels and means for detection
WO1994009699A1 (en) 1992-10-30 1994-05-11 British Technology Group Limited Investigation of a body
US5322783A (en) 1989-10-17 1994-06-21 Pioneer Hi-Bred International, Inc. Soybean transformation by microparticle bombardment
US5384253A (en) 1990-12-28 1995-01-24 Dekalb Genetics Corporation Genetic transformation of maize cells by electroporation of cells pretreated with pectin degrading enzymes
WO1995006128A2 (en) 1993-08-25 1995-03-02 Dekalb Genetics Corporation Fertile, transgenic maize plants and methods for their production
WO1995008348A1 (en) 1993-09-22 1995-03-30 Henry M. Jackson Foundation For The Advancement Of Military Medicine Method of activating soluble carbohydrate using novel cyanylating reagents for the production of immunogenic constructs
US5512282A (en) 1992-03-26 1996-04-30 Microcarb, Inc. Monospecific polyclonal antibodies to shiga-like toxins
US5538877A (en) 1990-01-22 1996-07-23 Dekalb Genetics Corporation Method for preparing fertile transgenic corn plants
US5548066A (en) 1994-12-02 1996-08-20 Central Biomedia, Inc. Failure of passive transfer immune serum and method of making same
US5550318A (en) 1990-04-17 1996-08-27 Dekalb Genetics Corporation Methods and compositions for the production of stably transformed, fertile monocot plants and cells thereof
US5563055A (en) 1992-07-27 1996-10-08 Pioneer Hi-Bred International, Inc. Method of Agrobacterium-mediated transformation of cultured soybean cells
US5580859A (en) 1989-03-21 1996-12-03 Vical Incorporated Delivery of exogenous DNA sequences in a mammal
US5591616A (en) 1992-07-07 1997-01-07 Japan Tobacco, Inc. Method for transforming monocotyledons
US5610042A (en) 1991-10-07 1997-03-11 Ciba-Geigy Corporation Methods for stable transformation of wheat
US5620896A (en) 1992-03-23 1997-04-15 University Of Massachusetts Medical Center DNA vaccines against rotavirus infections
US5648240A (en) 1994-05-24 1997-07-15 Texas A&M University MHC II analog from Staphylococcus aureus
EP0786519A2 (en) 1996-01-05 1997-07-30 Human Genome Sciences, Inc. Staphylococcus aureus polynucleotides and sequences
US5656610A (en) 1994-06-21 1997-08-12 University Of Southern California Producing a protein in a mammal by injection of a DNA-sequence into the tongue
US5702932A (en) 1992-07-20 1997-12-30 University Of Florida Microinjection methods to transform arthropods with exogenous DNA
US5736524A (en) 1994-11-14 1998-04-07 Merck & Co.,. Inc. Polynucleotide tuberculosis vaccine
US5780448A (en) 1995-11-07 1998-07-14 Ottawa Civic Hospital Loeb Research DNA-based vaccination of fish
US5789215A (en) 1991-08-20 1998-08-04 Genpharm International Gene targeting in animal cells using isogenic DNA constructs
US5801234A (en) 1995-10-16 1998-09-01 Smithkline Beecham P.L.C. Polynucleotide encoding saliva binding protein
EP0594610B1 (en) 1990-05-31 1998-09-02 Arne Forsgren PROTEIN D - AN IgD-BINDING PROTEIN OF HAEMOPHILUS INFLUENZAE
US5840846A (en) 1989-05-11 1998-11-24 Alfa-Laval Agri International Aktiebolag Fibronectin binding protein as well as its preparation
US5843650A (en) 1995-05-01 1998-12-01 Segev; David Nucleic acid detection and amplification by chemical linkage of oligonucleotides
US5846709A (en) 1993-06-15 1998-12-08 Imclone Systems Incorporated Chemical process for amplifying and detecting nucleic acid sequences
US5846783A (en) 1996-01-16 1998-12-08 Gull Laboratories Methods and apparatus for preparing, amplifying, and discriminating multiple analytes
US5849546A (en) 1996-09-13 1998-12-15 Epicentre Technologies Corporation Methods for using mutant RNA polymerases with reduced discrimination between non-canonical and canonical nucleoside triphosphates
US5849497A (en) 1997-04-03 1998-12-15 The Research Foundation Of State University Of New York Specific inhibition of the polymerase chain reaction using a non-extendable oligonucleotide blocker
US5849547A (en) 1993-07-26 1998-12-15 Bio Merieux Method for nucleic acid amplification by transcription using displacement, and reagents and kit therefor
WO1998057994A2 (en) 1997-06-16 1998-12-23 Henry M. Jackson Foundation For The Advancement Of Military Medicine Opsonic and protective monoclonal and chimeric antibodies specific for lipoteichoic acid of gram positive bacteria
US5858652A (en) 1988-08-30 1999-01-12 Abbott Laboratories Detection and amplification of target nucleic acid sequences
US5866366A (en) 1997-07-01 1999-02-02 Smithkline Beecham Corporation gidB
US5871986A (en) 1994-09-23 1999-02-16 The General Hospital Corporation Use of a baculovirus to express and exogenous gene in a mammalian cell
US5916776A (en) 1997-08-27 1999-06-29 Sarnoff Corporation Amplification method for a polynucleotide
US5922574A (en) 1994-05-28 1999-07-13 Tepnel Medical Limited Method for producing copies of a nucleic acid using immobilized oligonucleotides
US5925565A (en) 1994-07-05 1999-07-20 Institut National De La Sante Et De La Recherche Medicale Internal ribosome entry site, vector containing it and therapeutic use
US5928906A (en) 1996-05-09 1999-07-27 Sequenom, Inc. Process for direct sequencing during template amplification
US5928905A (en) 1995-04-18 1999-07-27 Glaxo Group Limited End-complementary polymerase reaction
US5932451A (en) 1997-11-19 1999-08-03 Incyte Pharmaceuticals, Inc. Method for unbiased mRNA amplification
US5935825A (en) 1994-11-18 1999-08-10 Shimadzu Corporation Process and reagent for amplifying nucleic acid sequences
US5935819A (en) 1992-08-27 1999-08-10 Eichner; Wolfram Process for producing a pharmaceutical preparation of PDGF-AB
US5939291A (en) 1996-06-14 1999-08-17 Sarnoff Corporation Microfluidic method for nucleic acid amplification
US5942391A (en) 1994-06-22 1999-08-24 Mount Sinai School Of Medicine Nucleic acid amplification method: ramification-extension amplification method (RAM)
US5945100A (en) 1996-07-31 1999-08-31 Fbp Corporation Tumor delivery vehicles
US5958895A (en) 1996-10-23 1999-09-28 American Home Products Corporation DNA vaccines for herpes simplex virus
US5981274A (en) 1996-09-18 1999-11-09 Tyrrell; D. Lorne J. Recombinant hepatitis virus vectors
US5994624A (en) 1997-10-20 1999-11-30 Cotton Incorporated In planta method for the production of transgenic plants
US6008341A (en) 1994-08-22 1999-12-28 The Provost, Fellows And Scholars Of The College Of The Holy And Undivided Trinity Of Queen Elizabeth Near Dublin S. aureus fibrinogen binding protein gene
WO2000002523A2 (en) 1998-07-10 2000-01-20 U.S. Medical Research Institute Of Infectious Diseases Department Of The Army Vaccine against staphylococcus intoxication
WO2000012689A1 (en) 1998-08-31 2000-03-09 The Provost Fellows And Scholars Of The College Of The Holy And Undivided Trinity Of Queen Elizabeth Near Dublin Polypeptides and polynucleotides from coagulase-negative staphylococci
WO2000012132A1 (en) 1998-08-31 2000-03-09 Inhibitex, Inc. Staphylococcal immunotherapeutics via donor selection and donor stimulation
WO2000015238A1 (en) 1998-09-14 2000-03-23 Nabi COMPOSITIONS OF β-GLUCANS AND SPECIFIC IGIV
WO2001034809A2 (en) 1999-11-09 2001-05-17 Glaxo Group Limited Staphylococcus epidermidis nucleic acids and proteins
WO2001060852A1 (en) 2000-02-17 2001-08-23 Biostapro Ab A 52 kDa PROTEIN FROM COAGULASE NEGATIVE STAPHYLOCOCCI AND FRAGMENTS THEREOF
US6288214B1 (en) 1996-05-16 2001-09-11 Texas A&M University Systems Collagen binding protein compositions and methods of use
US6294177B1 (en) 1996-09-11 2001-09-25 Nabi Staphylococcus aureus antigen-containing whole cell vaccine
WO2001098499A1 (en) 2000-06-20 2001-12-27 University Of Sheffield Antigenic polypeptides
WO2002059148A2 (en) 2001-01-26 2002-08-01 Intercell Ag A method for identification, isolation and production of antigens to a specific pathogen
US20020169288A1 (en) 2001-03-15 2002-11-14 Magnus Hook Collagen-binding adhesin from staphylococcus epidermidis and method of use
WO2002094868A2 (en) 2001-03-27 2002-11-28 Chiron Srl. Staphylococcus aureus proteins and nucleic acids
WO2003053462A2 (en) 2001-12-11 2003-07-03 Merck & Co., Inc. Staphylococcus aureus exopolysaccharide and process
US20030153022A1 (en) 2001-11-05 2003-08-14 Patti Joseph M. Monoclonal antibodies to the fibronectin binding protein and method of use in treating or preventing infections
US6651655B1 (en) 2000-01-18 2003-11-25 Quadrant Technologies Limited Inhaled vaccines
US6656462B2 (en) 1999-12-03 2003-12-02 Richard S. Dondero Interleukin-1 muteins useful as vaccine adjuvants
US6733754B2 (en) 1999-01-29 2004-05-11 Pfizer, Inc. Adjuvants for use in vaccines
WO2004043405A2 (en) 2002-11-12 2004-05-27 The Brigham And Women's Hospital, Inc. Polysaccharide vaccine for staphylococcal infections
WO2004043407A2 (en) 2002-11-12 2004-05-27 The Brigham And Women's Hospital, Inc. Methods and products for treating staphylococcal infections
US6756361B1 (en) 1997-10-14 2004-06-29 Nabi Enterococcus antigens and vaccines
US6770278B1 (en) 1994-12-02 2004-08-03 Central Biomedia, Inc. Methods of making and using immunoglobulin (Ig) compositions
US6793923B2 (en) 2000-11-07 2004-09-21 Immunovaccine Technologies, Inc. Vaccines with enhanced immune response and methods for their preparation
US6936258B1 (en) 1999-03-19 2005-08-30 Nabi Biopharmaceuticals Staphylococcus antigen and vaccine
WO2006032472A2 (en) 2004-09-22 2006-03-30 Glaxosmithkline Biologicals S.A. Immunogenic composition for use in vaccination against staphylococcei
WO2007113223A2 (en) 2006-03-30 2007-10-11 Glaxosmithkline Biologicals S.A. Immunogenic composition
WO2007113222A2 (en) 2006-03-30 2007-10-11 Glaxosmithkline Biologicals S.A. Immunogenic composition
US8901025B2 (en) 2010-03-24 2014-12-02 IFP Energies Nouvelles Catalyst regeneration zone divided into sectors for regenerative catalytic units

Family Cites Families (67)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB1499035A (en) 1975-04-10 1978-01-25 Ts Nii Gematologii I Perelivan Antistaphylococcus human immune globulin and method of preparing same
US4327082A (en) 1979-07-12 1982-04-27 Adcock-Ingram Laboratories Limited Mastitis vaccination
US5151350A (en) 1982-10-27 1992-09-29 Repligen Corporation Cloned genes encoding recombinant protein a
US5189015A (en) 1984-05-30 1993-02-23 Alfa-Laval Agri International Ab Method for prophylactic treatment of the colonization of a Staphylococcus aureus bacterial strain by bacterial cell surface protein with fibronectin and fibrinogen binding ability
US5320951A (en) 1987-06-01 1994-06-14 Hoeoek Magnus Fibronectin binding protein as well as its preparation
FR2619122B1 (fr) 1987-08-03 1990-03-09 Pasteur Institut Procede d'obtention de polyosides capsulaires de staphylocoques, polyosides obtenus, applications de ces polyosides et souches pour la mise en oeuvre du procede
US5258494A (en) * 1988-04-08 1993-11-02 Stryker Corporation Osteogenic proteins
EP0621875B1 (en) 1992-09-21 2002-03-27 Alfa-Laval Agri International Ab Fibrinogen binding protein
US6833253B2 (en) 1996-01-05 2004-12-21 Human Genome Sciences, Inc. Staphylococcus aureus polynucleotides and polypeptides
FR2746398B1 (fr) 1996-03-21 1998-04-30 Bio Merieux Anticorps specifique de staphylococcus aureaus, et utilisations
US6013763A (en) 1996-06-04 2000-01-11 Genentech, Inc. Peptide variants of protein A
US6680195B1 (en) 1997-11-26 2004-01-20 Inhibitex, Inc. Extracellular matrix-binding proteins from staphylococcus aureus
EP1034277B1 (en) 1997-11-26 2012-06-27 Inhibitex, Inc. Extracellular matrix-binding proteins from Staphylococcus aureus
US6692739B1 (en) 1998-08-31 2004-02-17 Inhibitex, Inc. Staphylococcal immunotherapeutics via donor selection and donor stimulation
ES2322409T3 (es) 1998-08-31 2009-06-19 Inhibitex, Inc. Vacunas multicomponentes contra staphylococcus aureus.
US6703025B1 (en) 1998-08-31 2004-03-09 Inhibitex, Inc. Multicomponent vaccines
JP2002525083A (ja) 1998-09-01 2002-08-13 ヒューマン ジノーム サイエンシーズ, インコーポレイテッド Staphylococcusaureus遺伝子およびポリペプチド
AU4810600A (en) 1999-04-28 2000-11-10 Provost, Fellows And Scholars Of The College Of The Holy And Undivided Trinity Of Queen Elizabeth Near Dublin, The Method of inhibiting leukocyte adhesion to fibrinogen
WO2000071585A1 (en) 1999-05-03 2000-11-30 Medarex, Inc. Human antibodies to staphylococcus aureus
WO2000069457A1 (en) 1999-05-15 2000-11-23 University Of California, San Diego Protein a based binding domains with desirable activities
CA2403359A1 (en) 2000-03-17 2001-09-27 Inhibitex, Inc. Cross-reactive displacing antibodies from collagen-binding proteins and method of identification and use
CA2404260A1 (en) 2000-03-21 2001-09-27 Elitra Pharmaceuticals, Inc. Identification of essential genes in prokaryotes
SE0003573D0 (sv) * 2000-10-04 2000-10-04 Bengt Guss Method and means for producing novel von Willebrand factor binding proteins and their use in biotechnology
US6790448B2 (en) 2001-05-08 2004-09-14 The Texas A&M University System University Surface proteins from gram-positive bacteria having highly conserved motifs and antibodies that recognize them
MXPA03011701A (es) 2001-06-15 2004-12-06 Nhibitex Inc Anticuerpos monoclonales y policlonales de reaccion que reconocen las proteinas de superficie a partir de estafilococos coagulasa-negativos y staphylococcus aureus.
CA2351018A1 (en) 2001-07-09 2003-01-09 Universite De Sherbrooke Dna vaccine against staphylococcus aureus
ATE542829T1 (de) 2001-08-02 2012-02-15 Univ Sheffield Impfstoff
US20030113350A1 (en) 2001-09-19 2003-06-19 Fattom Ali I. Glycoconjugate vaccines for use in immune-compromised populations
WO2003041726A1 (en) 2001-11-16 2003-05-22 Biostapro Ab Use of an extracellular adherence protein for the manufacture of an anti-inflammatory drug
EP1481011A4 (en) 2002-03-05 2007-05-30 Inhibitex Inc MONOCLONAL AND POLYCLONAL ANTIBODIES THAT DETECT COAGULASENEGATIVE STAPHYLOKOCKE PROTEINS
US7736652B2 (en) 2002-03-21 2010-06-15 The Regents Of The University Of California Antibody fusion proteins: effective adjuvants of protein vaccination
US6984381B2 (en) 2002-07-05 2006-01-10 The United States Of America As Represented By The Secretary Of Agriculture Vaccine for the prevention of bacterial infection of the bovine mammary gland
EP1540559B1 (en) 2002-09-13 2013-02-27 The Texas A & M University System Bioinformatic method for identifying surface-anchored proteins from gram-positive bacteria and proteins obtained thereby
US20050220788A1 (en) 2002-10-03 2005-10-06 Intercell Ag Use of molecules which interact with the haptoglobin receptor ligand binding
EP1580557A4 (en) * 2002-11-22 2006-09-06 Daiichi Pure Chemicals Co Ltd METHOD FOR THE STUDY OF STAPHYLOCOCCUS AUREUS
CA2520389A1 (en) 2003-03-28 2004-10-14 Elusys Therapeutics, Inc. Method and compositions for conversion of antibody activity
EP1613642A4 (en) 2003-04-16 2008-07-02 Texas A & M Univ Sys EFB PROTEIN OF STAPHYLOCOCCUS AUREUS AND C3 BINDING STAGE THAT INHIBITS COMPLEMENTAL ACTIVATION
WO2005009378A2 (en) 2003-07-24 2005-02-03 Merck & Co., Inc. Polypeptides for inducing a protective immune response against staphylococcus aureus
KR20060065643A (ko) 2003-07-24 2006-06-14 머크 앤드 캄파니 인코포레이티드 스타필로코쿠스 아우레우스에 대한 방어 면역 반응을유도하는 폴리펩타이드
US20080160089A1 (en) 2003-10-14 2008-07-03 Medivas, Llc Vaccine delivery compositions and methods of use
US20070134263A1 (en) 2004-02-18 2007-06-14 Anderson Annaliesa S Polypeptides for inducing a protective immune response against staphyloococcus aureus
US20080095792A1 (en) 2004-09-17 2008-04-24 Anderson Annaliesa S Polypeptides For Inducing A Protective Immune Response Against Staphylococcus Aureus
AU2005310981A1 (en) 2004-10-25 2006-06-08 The University Of Western Ontario Vaccines, compositions and methods based on Staphylococcus aureus iron-regulated surface determinants IsdA, IsdB, and IsdC
JP2008518947A (ja) 2004-10-29 2008-06-05 エルシス セラピューティクス, インク. 免疫応答のクリアランス及び誘導におけるcr1結合分子の使用
US20060134141A1 (en) 2004-12-14 2006-06-22 Nabi Biopharmaceuticals Glycoconjugate vaccines containing peptidoglycan
US8007806B2 (en) 2005-01-20 2011-08-30 Isconova Ab Vaccine composition comprising a fibronectin binding protein or a fibronectin binding peptide
US20060228368A1 (en) 2005-04-07 2006-10-12 Nabi Biopharmaceuticals Method of protecting against staphylococcal infection
US8398991B2 (en) 2005-06-22 2013-03-19 Institut Pasteur Modified ESAT-6 molecules and improved vaccine strains of Mycobacterium bovis BCG
GB0526038D0 (en) 2005-12-21 2006-02-01 Glaxosmithkline Biolog Sa Immunogenic composition
AU2007281934B2 (en) * 2006-01-18 2012-11-15 University Of Chicago Compositions and methods related to Staphylococcal bacterium proteins
CA2637152A1 (en) 2006-01-27 2007-08-09 Merck & Co., Inc. Antigen-binding proteins targeting s. aureus orf0657n
WO2007095057A2 (en) 2006-02-10 2007-08-23 Government Of The United States Of America, Represented By The Secretary, Department Of Health And Human Services Use of eap protein for treating and preventing autoimmune neuroinflammatory diseases
EP1996231A4 (en) 2006-02-22 2010-09-15 Texas A & M Univ Sys ANTIBODIES WITH STRONG EXPRESSED PUTATIVE ANTIGEN DETECTION OF CA-MRSA AND METHOD OF USE
US20080131457A1 (en) 2006-06-12 2008-06-05 Nabi Biopharmaceuticals Use of alpha-toxin for treating and preventing staphylococcus infections
CA2667788A1 (en) 2006-10-30 2008-12-18 The University Of Western Ontario Staphylococcus aureus specific anti-infectives
WO2008140487A2 (en) 2006-11-14 2008-11-20 Elusys Therapeutics, Inc. Improved staphylococcal protein a mono- and bispecific antibodies and methods of their use
US7488807B2 (en) 2006-11-22 2009-02-10 3M Innovative Properties Company Antibody with protein A selectivity
US20100047252A1 (en) 2006-11-22 2010-02-25 3M Innovative Properties Company Antibody with protein a selectivity
GB0700136D0 (en) 2007-01-04 2007-02-14 Glaxosmithkline Biolog Sa Process for manufacturing vaccines
WO2009029132A2 (en) 2007-05-31 2009-03-05 Merck & Co., Inc. Antigen-binding proteins targeting s. aureus orf0657n
EP2291196A4 (en) 2008-05-12 2012-05-30 Strox Biopharmaceuticals Llc FOR STAPHYLOCOCCUS AUREUS SPECIFIC ANTIBODY PREPARATIONS
US8592555B2 (en) 2008-08-11 2013-11-26 Emd Millipore Corporation Immunoglobulin-binding proteins with improved specificity
CA2746330C (en) 2008-12-23 2017-08-29 Genentech, Inc. Immunoglobulin variants with altered binding to protein a
HUE026855T2 (en) 2009-04-03 2016-07-28 Univ Chicago Compositions and methods related to protein a (spa) variants
SA110310528B1 (ar) 2009-06-22 2014-07-02 Wyeth Llc التركيبات المولدة للمناعة لأنتيجينات ستافيلوكوكس أوريس
EP2555794A4 (en) 2010-04-05 2014-01-15 Univ Chicago COMPOSITIONS AND METHODS RELATING TO PROTEIN A (SPA) ANTIBODIES AS IMMUNE REACTION AMPLIFIERS
CA2803298C (en) * 2010-07-02 2020-07-14 The University Of Chicago Compositions and methods related to protein a (spa) variants

Patent Citations (117)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3791932A (en) 1971-02-10 1974-02-12 Akzona Inc Process for the demonstration and determination of reaction components having specific binding affinity for each other
US3949064A (en) 1973-10-26 1976-04-06 Baxter Laboratories, Inc. Method of detecting antigens or antibodies
US4174384A (en) 1975-06-30 1979-11-13 Syva Company Fluorescence quenching with immunological pairs in immunoassays
US4367110A (en) 1979-07-02 1983-01-04 Toppan Printing Co. Decorative laminate and a manufacturing method therefor
US4372945A (en) 1979-11-13 1983-02-08 Likhite Vilas V Antigen compounds
US4452901A (en) 1980-03-20 1984-06-05 Ciba-Geigy Corporation Electrophoretically transferring electropherograms to nitrocellulose sheets for immuno-assays
US4338298A (en) 1980-04-04 1982-07-06 Endowment And Research Foundation At Montana State University Vaccine for passive immunization against enteric colibacillosis and method of use
US4554101A (en) 1981-01-09 1985-11-19 New York Blood Center, Inc. Identification and preparation of epitopes on antigens and allergens on the basis of hydrophilicity
US4474757A (en) 1981-01-13 1984-10-02 Yeda Research & Development Co., Ltd. Synthetic vaccine and process for producing same
US4356170A (en) 1981-05-27 1982-10-26 Canadian Patents & Development Ltd. Immunogenic polysaccharide-protein conjugates
US4596792A (en) 1981-09-04 1986-06-24 The Regents Of The University Of California Safe vaccine for hepatitis containing polymerized serum albumin
US4684611A (en) 1982-02-11 1987-08-04 Rijksuniversiteit Leiden Process for the in-vitro transformation of plant protoplasts with plasmid DNA
US4578770A (en) 1982-08-30 1986-03-25 Musashi Engineering Kabushiki Kaisha Method of discriminating sheet
US4748018A (en) 1984-02-07 1988-05-31 Stolle Research & Development Corp. Method of passive immunization of mammals using avian antibody
US4599231A (en) 1984-03-09 1986-07-08 Scripps Clinic And Research Foundation Synthetic hepatitis B virus vaccine including both T cell and B cell determinants
US4599230A (en) 1984-03-09 1986-07-08 Scripps Clinic And Research Foundation Synthetic hepatitis B virus vaccine including both T cell and B cell determinants
US4879236A (en) 1984-05-16 1989-11-07 The Texas A&M University System Method for producing a recombinant baculovirus expression vector
US5221605A (en) 1984-10-31 1993-06-22 Igen, Inc. Luminescent metal chelate labels and means for detection
US5310687A (en) 1984-10-31 1994-05-10 Igen, Inc. Luminescent metal chelate labels and means for detection
US5238808A (en) 1984-10-31 1993-08-24 Igen, Inc. Luminescent metal chelate labels and means for detection
US4608251A (en) 1984-11-09 1986-08-26 Pitman-Moore, Inc. LHRH analogues useful in stimulating anti-LHRH antibodies and vaccines containing such analogues
US4683202A (en) 1985-03-28 1987-07-28 Cetus Corporation Process for amplifying nucleic acid sequences
US4683202B1 (https=) 1985-03-28 1990-11-27 Cetus Corp
US4601903A (en) 1985-05-01 1986-07-22 The United States Of America As Represented By The Department Of Health And Human Services Vaccine against Neisseria meningitidis Group B serotype 2 invasive disease
US4690915A (en) 1985-08-08 1987-09-01 The United States Of America As Represented By The Department Of Health And Human Services Adoptive immunotherapy as a treatment modality in humans
US4683195A (en) 1986-01-30 1987-07-28 Cetus Corporation Process for amplifying, detecting, and/or-cloning nucleic acid sequences
US4683195B1 (https=) 1986-01-30 1990-11-27 Cetus Corp
US4800159A (en) 1986-02-07 1989-01-24 Cetus Corporation Process for amplifying, detecting, and/or cloning nucleic acid sequences
US5084269A (en) 1986-11-06 1992-01-28 Kullenberg Fred W Adjuvant for dose treatment with antigens
GB2202328A (en) 1987-03-11 1988-09-21 Orion Yhtymae Oy An improved method for assaying of nucleic acids, a reagent combination and a kit therefore
US4952500A (en) 1988-02-01 1990-08-28 University Of Georgia Research Foundation, Inc. Cloning systems for Rhodococcus and related bacteria
US5858652A (en) 1988-08-30 1999-01-12 Abbott Laboratories Detection and amplification of target nucleic acid sequences
US5589466A (en) 1989-03-21 1996-12-31 Vical Incorporated Induction of a protective immune response in a mammal by injecting a DNA sequence
US5580859A (en) 1989-03-21 1996-12-03 Vical Incorporated Delivery of exogenous DNA sequences in a mammal
US5840846A (en) 1989-05-11 1998-11-24 Alfa-Laval Agri International Aktiebolag Fibronectin binding protein as well as its preparation
US5302523A (en) 1989-06-21 1994-04-12 Zeneca Limited Transformation of plant cells
US5464765A (en) 1989-06-21 1995-11-07 Zeneca Limited Transformation of plant cells
US5322783A (en) 1989-10-17 1994-06-21 Pioneer Hi-Bred International, Inc. Soybean transformation by microparticle bombardment
US5538877A (en) 1990-01-22 1996-07-23 Dekalb Genetics Corporation Method for preparing fertile transgenic corn plants
US5538880A (en) 1990-01-22 1996-07-23 Dekalb Genetics Corporation Method for preparing fertile transgenic corn plants
US5550318A (en) 1990-04-17 1996-08-27 Dekalb Genetics Corporation Methods and compositions for the production of stably transformed, fertile monocot plants and cells thereof
EP0594610B1 (en) 1990-05-31 1998-09-02 Arne Forsgren PROTEIN D - AN IgD-BINDING PROTEIN OF HAEMOPHILUS INFLUENZAE
US5384253A (en) 1990-12-28 1995-01-24 Dekalb Genetics Corporation Genetic transformation of maize cells by electroporation of cells pretreated with pectin degrading enzymes
EP0497524A2 (en) 1991-01-28 1992-08-05 Merck & Co. Inc. Polysaccharide antigens from streptococcus pneumoniae
EP0497525A2 (en) 1991-01-28 1992-08-05 Merck & Co. Inc. Pneumococcal polysaccharide conjugate vaccine
US5199942A (en) 1991-06-07 1993-04-06 Immunex Corporation Method for improving autologous transplantation
US5789215A (en) 1991-08-20 1998-08-04 Genpharm International Gene targeting in animal cells using isogenic DNA constructs
US5610042A (en) 1991-10-07 1997-03-11 Ciba-Geigy Corporation Methods for stable transformation of wheat
US5620896A (en) 1992-03-23 1997-04-15 University Of Massachusetts Medical Center DNA vaccines against rotavirus infections
US5512282A (en) 1992-03-26 1996-04-30 Microcarb, Inc. Monospecific polyclonal antibodies to shiga-like toxins
US5591616A (en) 1992-07-07 1997-01-07 Japan Tobacco, Inc. Method for transforming monocotyledons
US5702932A (en) 1992-07-20 1997-12-30 University Of Florida Microinjection methods to transform arthropods with exogenous DNA
US5563055A (en) 1992-07-27 1996-10-08 Pioneer Hi-Bred International, Inc. Method of Agrobacterium-mediated transformation of cultured soybean cells
US5935819A (en) 1992-08-27 1999-08-10 Eichner; Wolfram Process for producing a pharmaceutical preparation of PDGF-AB
WO1994009699A1 (en) 1992-10-30 1994-05-11 British Technology Group Limited Investigation of a body
US5846709A (en) 1993-06-15 1998-12-08 Imclone Systems Incorporated Chemical process for amplifying and detecting nucleic acid sequences
US5849547A (en) 1993-07-26 1998-12-15 Bio Merieux Method for nucleic acid amplification by transcription using displacement, and reagents and kit therefor
WO1995006128A2 (en) 1993-08-25 1995-03-02 Dekalb Genetics Corporation Fertile, transgenic maize plants and methods for their production
WO1995008348A1 (en) 1993-09-22 1995-03-30 Henry M. Jackson Foundation For The Advancement Of Military Medicine Method of activating soluble carbohydrate using novel cyanylating reagents for the production of immunogenic constructs
US5648240A (en) 1994-05-24 1997-07-15 Texas A&M University MHC II analog from Staphylococcus aureus
US5922574A (en) 1994-05-28 1999-07-13 Tepnel Medical Limited Method for producing copies of a nucleic acid using immobilized oligonucleotides
US5656610A (en) 1994-06-21 1997-08-12 University Of Southern California Producing a protein in a mammal by injection of a DNA-sequence into the tongue
US5942391A (en) 1994-06-22 1999-08-24 Mount Sinai School Of Medicine Nucleic acid amplification method: ramification-extension amplification method (RAM)
US5925565A (en) 1994-07-05 1999-07-20 Institut National De La Sante Et De La Recherche Medicale Internal ribosome entry site, vector containing it and therapeutic use
US6008341A (en) 1994-08-22 1999-12-28 The Provost, Fellows And Scholars Of The College Of The Holy And Undivided Trinity Of Queen Elizabeth Near Dublin S. aureus fibrinogen binding protein gene
US5871986A (en) 1994-09-23 1999-02-16 The General Hospital Corporation Use of a baculovirus to express and exogenous gene in a mammalian cell
US5736524A (en) 1994-11-14 1998-04-07 Merck & Co.,. Inc. Polynucleotide tuberculosis vaccine
US5935825A (en) 1994-11-18 1999-08-10 Shimadzu Corporation Process and reagent for amplifying nucleic acid sequences
US6770278B1 (en) 1994-12-02 2004-08-03 Central Biomedia, Inc. Methods of making and using immunoglobulin (Ig) compositions
US5548066A (en) 1994-12-02 1996-08-20 Central Biomedia, Inc. Failure of passive transfer immune serum and method of making same
US5928905A (en) 1995-04-18 1999-07-27 Glaxo Group Limited End-complementary polymerase reaction
US5843650A (en) 1995-05-01 1998-12-01 Segev; David Nucleic acid detection and amplification by chemical linkage of oligonucleotides
US5801234A (en) 1995-10-16 1998-09-01 Smithkline Beecham P.L.C. Polynucleotide encoding saliva binding protein
US5780448A (en) 1995-11-07 1998-07-14 Ottawa Civic Hospital Loeb Research DNA-based vaccination of fish
EP0786519A2 (en) 1996-01-05 1997-07-30 Human Genome Sciences, Inc. Staphylococcus aureus polynucleotides and sequences
US5846783A (en) 1996-01-16 1998-12-08 Gull Laboratories Methods and apparatus for preparing, amplifying, and discriminating multiple analytes
US5928906A (en) 1996-05-09 1999-07-27 Sequenom, Inc. Process for direct sequencing during template amplification
US6288214B1 (en) 1996-05-16 2001-09-11 Texas A&M University Systems Collagen binding protein compositions and methods of use
US5939291A (en) 1996-06-14 1999-08-17 Sarnoff Corporation Microfluidic method for nucleic acid amplification
US5945100A (en) 1996-07-31 1999-08-31 Fbp Corporation Tumor delivery vehicles
US6294177B1 (en) 1996-09-11 2001-09-25 Nabi Staphylococcus aureus antigen-containing whole cell vaccine
US5849546A (en) 1996-09-13 1998-12-15 Epicentre Technologies Corporation Methods for using mutant RNA polymerases with reduced discrimination between non-canonical and canonical nucleoside triphosphates
US5981274A (en) 1996-09-18 1999-11-09 Tyrrell; D. Lorne J. Recombinant hepatitis virus vectors
US5958895A (en) 1996-10-23 1999-09-28 American Home Products Corporation DNA vaccines for herpes simplex virus
US5849497A (en) 1997-04-03 1998-12-15 The Research Foundation Of State University Of New York Specific inhibition of the polymerase chain reaction using a non-extendable oligonucleotide blocker
WO1998057994A2 (en) 1997-06-16 1998-12-23 Henry M. Jackson Foundation For The Advancement Of Military Medicine Opsonic and protective monoclonal and chimeric antibodies specific for lipoteichoic acid of gram positive bacteria
US5866366A (en) 1997-07-01 1999-02-02 Smithkline Beecham Corporation gidB
US5916776A (en) 1997-08-27 1999-06-29 Sarnoff Corporation Amplification method for a polynucleotide
US6756361B1 (en) 1997-10-14 2004-06-29 Nabi Enterococcus antigens and vaccines
US5994624A (en) 1997-10-20 1999-11-30 Cotton Incorporated In planta method for the production of transgenic plants
US5932451A (en) 1997-11-19 1999-08-03 Incyte Pharmaceuticals, Inc. Method for unbiased mRNA amplification
WO2000002523A2 (en) 1998-07-10 2000-01-20 U.S. Medical Research Institute Of Infectious Diseases Department Of The Army Vaccine against staphylococcus intoxication
WO2000012132A1 (en) 1998-08-31 2000-03-09 Inhibitex, Inc. Staphylococcal immunotherapeutics via donor selection and donor stimulation
WO2000012689A1 (en) 1998-08-31 2000-03-09 The Provost Fellows And Scholars Of The College Of The Holy And Undivided Trinity Of Queen Elizabeth Near Dublin Polypeptides and polynucleotides from coagulase-negative staphylococci
WO2000015238A1 (en) 1998-09-14 2000-03-23 Nabi COMPOSITIONS OF β-GLUCANS AND SPECIFIC IGIV
US6733754B2 (en) 1999-01-29 2004-05-11 Pfizer, Inc. Adjuvants for use in vaccines
US6814971B2 (en) 1999-01-29 2004-11-09 Pfizer Inc. Adjuvants for use in vaccines
US6936258B1 (en) 1999-03-19 2005-08-30 Nabi Biopharmaceuticals Staphylococcus antigen and vaccine
WO2001034809A2 (en) 1999-11-09 2001-05-17 Glaxo Group Limited Staphylococcus epidermidis nucleic acids and proteins
US6656462B2 (en) 1999-12-03 2003-12-02 Richard S. Dondero Interleukin-1 muteins useful as vaccine adjuvants
US6651655B1 (en) 2000-01-18 2003-11-25 Quadrant Technologies Limited Inhaled vaccines
WO2001060852A1 (en) 2000-02-17 2001-08-23 Biostapro Ab A 52 kDa PROTEIN FROM COAGULASE NEGATIVE STAPHYLOCOCCI AND FRAGMENTS THEREOF
WO2001098499A1 (en) 2000-06-20 2001-12-27 University Of Sheffield Antigenic polypeptides
US6793923B2 (en) 2000-11-07 2004-09-21 Immunovaccine Technologies, Inc. Vaccines with enhanced immune response and methods for their preparation
WO2002059148A2 (en) 2001-01-26 2002-08-01 Intercell Ag A method for identification, isolation and production of antigens to a specific pathogen
US20020169288A1 (en) 2001-03-15 2002-11-14 Magnus Hook Collagen-binding adhesin from staphylococcus epidermidis and method of use
WO2002094868A2 (en) 2001-03-27 2002-11-28 Chiron Srl. Staphylococcus aureus proteins and nucleic acids
US20030153022A1 (en) 2001-11-05 2003-08-14 Patti Joseph M. Monoclonal antibodies to the fibronectin binding protein and method of use in treating or preventing infections
WO2003053462A2 (en) 2001-12-11 2003-07-03 Merck & Co., Inc. Staphylococcus aureus exopolysaccharide and process
WO2004043405A2 (en) 2002-11-12 2004-05-27 The Brigham And Women's Hospital, Inc. Polysaccharide vaccine for staphylococcal infections
WO2004043407A2 (en) 2002-11-12 2004-05-27 The Brigham And Women's Hospital, Inc. Methods and products for treating staphylococcal infections
WO2006032472A2 (en) 2004-09-22 2006-03-30 Glaxosmithkline Biologicals S.A. Immunogenic composition for use in vaccination against staphylococcei
WO2006032475A2 (en) 2004-09-22 2006-03-30 Glaxosmithkline Biologicals S.A. Staphylococcal immunogenic compositions
WO2006032500A2 (en) 2004-09-22 2006-03-30 Glaxosmithkline Biologicals S.A. Immunogenic composition
WO2007113223A2 (en) 2006-03-30 2007-10-11 Glaxosmithkline Biologicals S.A. Immunogenic composition
WO2007113222A2 (en) 2006-03-30 2007-10-11 Glaxosmithkline Biologicals S.A. Immunogenic composition
US8901025B2 (en) 2010-03-24 2014-12-02 IFP Energies Nouvelles Catalyst regeneration zone divided into sectors for regenerative catalytic units

Non-Patent Citations (310)

* Cited by examiner, † Cited by third party
Title
"Epitope Mapping Protocols In: Methods in Molecular Biology", vol. 66, 1996
"Methods in Enzymology", vol. 203, 1991, ACADEMIC PRESS, pages: 46 - 88
"Remington's Pharmaceutical Sciences", 1990, MACK PRINTING COMPANY, pages: 1289 - 1329
ABDALLAH ET AL., MOL. MICROBIOL., vol. 62, 2006, pages 667 - 679
ABDALLAH ET AL., NAT. REV. MICROBIOL., vol. 5, 2007, pages 883 - 891
ALBUS ET AL., INFECT. IMMUN., vol. 59, 1991, pages 1008 - 1014
AN, J. VIROL., vol. 71, no. 3, 1997, pages 2292 - 302
ANAVI, SC. THESIS FROM THE DEPARTMENT OF MOLECULAR MICROBIOLOGY AND BIOTECHNOLOGY OF THE TEL-AVIV UNIVERSITY, 1998
ANDERSEN ET AL., J. IMMUNOL., vol. 154, 1995, pages 3359 - 3372
ANGEL ET AL., CELL, vol. 49, 1987, pages 729
ANGEL ET AL., MOL. CELL. BIOL., vol. 7, 1987, pages 2256
ARCHER, CLIN. INFECT. DIS., vol. 26, 1998, pages 1179 - 1181
ATCHISON; PERRY, CELL, vol. 46, 1986, pages 253
ATCHISON; PERRY, CELL, vol. 48, 1987, pages 121
AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 1996, JOHN, WILEY & SONS, INC
BABA ET AL., J. BACTERIOL., vol. 190, 2007, pages 300 - 310
BAE ET AL., PROC. NATL. ACAD. SCI. USA, vol. 101, 2004, pages 12312 - 12317
BAE; SCHNEEWIND, PLASMID, vol. 55, 2006, pages 58 - 63
BANERJI ET AL., CELL, vol. 27, 1981, pages 299 - 308
BANERJI ET AL., CELL, vol. 33, no. 3, 1983, pages 729 - 740
BARANY; MERRIFIELD: "The Peptides", 1979, ACADEMIC PRESS, pages: 1 - 284
BEHRING EA: "Über das Zustandekommen der Diphtherie - Immunität bei Thieren", DEUTSCHE MEDZINISCHE WOCHENSCHRIFT, vol. 16, 1890, pages 1145 - 8
BELLUS, J. MACROMOL. SCI. PURE APPL. CHEM., vol. A31, no. 1, 1994, pages 1355 - 1376
BERKHOUT ET AL., CELL, vol. 59, 1989, pages 273 - 282
BIRCH-HIRSCHFELD, L: "Über die Agglutination von Staphylokokken durch Bestandteile des Säugetierblutplasmas.", KLINISCHE WOSCHENSCHRIFT, vol. 13, 1934, pages 331
BJERKETORP ET AL., FEMS MICROBIOL. LETT., vol. 234, 2004, pages 309 - 314
BLANAR ET AL., EMBO J., vol. 8, 1989, pages 1139
BODINE; LEY, EMBO J., vol. 6, 1987, pages 2997
BORREBAECK: "Antibody Engineering--A Practical Guide", 1992, W. H. FREEMAN AND CO.
BOSHART ET AL., CELL, vol. 41, 1985, pages 521
BOSZE ET AL., EMBO J., vol. 5, no. 7, 1986, pages 1615 - 1623
BOUCHER; COREY, CLIN. INFECT. DIS. 4, vol. 6, 2008, pages S334 - S349
BRADDOCK ET AL., CELL, vol. 58, 1989, pages 269
BROWN ET AL., BIOCHEMISTRY, vol. 37, 1998, pages 4397 - 4406
BUBECK WARDENBURG; SCHNEEWIND, J EXP. MED., vol. 205, 2008, pages 287 - 294
BUBECK-WARDENBURG ET AL., INFECT. IMMUN., vol. 74, 2007, pages 1040 - 1044
BUBECK-WARDENBURG ET AL., PROC. NATL. ACAD. SCI. USA, vol. 103, 2006, pages 13831 - 13836
BULLA; SIDDIQUI, J. VIROL., vol. 62, 1986, pages 1437
BURKE ET AL., J INF. DIS., vol. 170, 1994, pages 1110 - 1119
BURLAK ET AL., CELL MICROBIOL., vol. 9, 2007, pages 1172 - 1190
BURTS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 102, 2005, pages 1169 - 1174
BURTS; MISSIAKAS, MOL. MICROBIOL., vol. 69, 2008, pages 736 - 46
CAMPBELL; VILLARREAL, MOL. CELL. BIOL., vol. 8, 1988, pages 1993
CAMPERE; TILGHMAN, GENES AND DEV., vol. 3, 1989, pages 537
CAMPO ET AL., NATURE, vol. 303, 1983, pages 77
CARBONELLI ET AL., FEMS MICROBIOL. LETT., vol. 177, no. 1, 1999, pages 75 - 82
CEDERGREN ET AL., PROTEIN ENG., vol. 6, 1993, pages 441 - 448
CELANDER ET AL., J VIROLOGY, vol. 62, 1988, pages 1314
CELANDER; HASELTINE, J VIROLOGY, vol. 61, 1987, pages 269
CESPEDES ET AL., J. INFECT. DIS., vol. 191, no. 3, 2005, pages 444 - 52
CHAMPION ET AL., SCIENCE, vol. 313, 2006, pages 1632 - 1636
CHANDLER ET AL., CELL, vol. 33, 1983, pages 489
CHANDLER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 94, no. 8, 1997, pages 3596 - 601
CHANG ET AL., LANCET, vol. 362, no. 9381, 2003, pages 362 - 369
CHANG ET AL., MOL. CELL. BIOL., vol. 9, 1989, pages 2153
CHATTERJEE ET AL., PROC. NATL. ACAD. SCI. USA, vol. 86, 1989, pages 9114
CHEN; OKAYAMA, MOL. CELL BIOL., vol. 7, no. 8, 1987, pages 2745 - 2752
CHENG ET AL., FASEB J.,, vol. 23, 2009, pages 1 - 12
CHOI ET AL., CELL, vol. 53, 1988, pages 519
COCEA, BIOTECHNIQUES, vol. 23, no. 5, 1997, pages 814 - 816
COHEN ET AL., J CELL. PHYSIOL., vol. 5, 1987, pages 75
COSGROVE ET AL., INFECT. CONTROL HOSP. EPIDEMIOL., vol. 26, 2005, pages 166 - 174
COSTA ET AL., MOL. CELL. BIOL., vol. 8, 1988, pages 81
CRIPE ET AL., EMBO J., vol. 6, 1987, pages 3745
CULOTTA; HAMER, MOL. CELL. BIOL., vol. 9, 1989, pages 1376
DALBEY; WICKNER, J. BIOL. CHEM., vol. 260, 1985, pages 15925 - 15931
DANDOLO ET AL., J VIROLOGY, vol. 47, 1983, pages 55 - 64
DE VILLIERS ET AL., NATURE, vol. 312, no. 5991, 1984, pages 242 - 246
DEBORD ET AL., INFECT. IMMUN., vol. 74, 2006, pages 4910 - 4914
DEDENT ET AL., EMBO J., vol. 27, 2008, pages 2656 - 2668
DEDENT ET AL., J. BACTERIOL., vol. 189, 2007, pages 4473 - 4484
DEISENHOFER ET AL., HOPPE-SEYH ZEITSCH. PHYSIOL. CHEM., vol. 359, 1978, pages 975 - 985
DEISENHOFER, BIOCHEMISTRY, vol. 20, 1981, pages 2361 - 2370
DESCHAMPS ET AL., SCIENCE, vol. 230, 1985, pages 1174 - 1177
DEVEREUX ET AL., NUCL. ACID RES., vol. 12, 1984, pages 387 - 395
DIEP ET AL., J. INFECT. DIS., vol. 193, 2006, pages 1495 - 1503
DIEP ET AL., LANCET, vol. 367, 2006, pages 731 - 739
DINGES ET AL., CLIN. MICROBIOL. REV., vol. 13, 2000, pages 16 - 34
DUTHIE; LORENZ, J. GEN. MICROBIOL., vol. 6, 1952, pages 95 - 107
EDBROOKE ET AL., MOL. CELL. BIOL., vol. 9, 1989, pages 1908
EDLUND ET AL., SCIENCE, vol. 230, 1985, pages 912 - 916
EKSTEDT; YOTIS, ANN. N.Y. ACAD. SCI.,, vol. 80, 1960, pages 496 - 500
EMORL; GAYNES, CLIN. MICROBIOL. REV., vol. 6, 1993, pages 428 - 442
FECHHEIMER ET AL., PROC NATL. ACAD. SCI. USA, vol. 84, 1987, pages 8463 - 8467
FENG; HOLLAND, NATURE, vol. 334, 1988, pages 6178
FIELD; SMITH, J. COMP. PATHOL., vol. 55, 1945, pages 63
FIRAK; SUBRAMANIAN, MOL. CELL. BIOL., vol. 6, 1986, pages 3667
FOECKING; HOFSTETTER, GENE, vol. 45, no. 1, 1986, pages 101 - 105
FORTUNE ET AL., PROC NATL. ACAD. SCI. USA, vol. 102, 2005, pages 10676 - 10681
FOSTER, NAT. REV. MICROBIOL., vol. 3, 2005, pages 948 - 958
FOURNIER ET AL., INFECT. IMMUN., vol. 45, 1984, pages 87 - 93
FRALEY ET AL., PROC. NATL. ACAD. SCI. USA, vol. 76, 1979, pages 3348 - 3352
FRIEDRICH ET AL., NATURE, vol. 425, 2003, pages 535 - 539
FUJITA ET AL., CELL, vol. 49, 1987, pages 357
GILLES ET AL., CELL, vol. 33, 1983, pages 717
GLOSS ET AL., EMBO J., vol. 6, 1987, pages 3735
GODBOUT ET AL., MOL. CELL. BIOL., vol. 8, 1988, pages 1169
GOMEZ ET AL., EMBO J., vol. 26, 2007, pages 701 - 709
GOMEZ ET AL., J BIOL. CHEM., vol. 281, 2006, pages 20190 - 20196
GOMEZ ET AL., NATURE MED., vol. 10, 2004, pages 842 - 8
GOODBOUM; MANIATIS, PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 1447
GOODBOURN ET AL., CELL, vol. 45, 1986, pages 601
GOODYEAR; SILVERMAN, J. EXP. MED., vol. 197, 2003, pages 1125 - 1139
GOODYEAR; SILVERMAN, PROC. NAT. ACAD. SCI. USA, vol. 101, 2004, pages 11392 - 11397
GOPAL, MOL. CELL BIOL., vol. 5, 1985, pages 1188 - 1190
GOUDA ET AL., BIOCHEMISTRY, vol. 31, no. 40, 1992, pages 9665 - 72
GOUDA ET AL., BIOCHEMISTRY, vol. 37, 1998, pages 129 - 36
GRAHAM; VAN DER EB, VIROLOGY, vol. 52, 1973, pages 456 - 467
GRAILLE ET AL., PROC. NAT. ACAD. SCI. USA, vol. 97, 2000, pages 5399 - 5404
GREENE ET AL., IMMUNOLOGY TODAY, vol. 10, 1989, pages 272
GROSSCHEDL; BALTIMORE, CELL, vol. 41, 1985, pages 885
GUINN ET AL., MOL. MICROBIOL., vol. 51, 2004, pages 359 - 370
GUSS ET AL., EUR. J. BIOCHEM., vol. 138, 1984, pages 413 - 420
HARLAND; WEINTRAUB, J. CELL BIOL., vol. 101, no. 3, 1985, pages 1094 - 1099
HARLOW ET AL.: "Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY
HARTLEIB ET AL., BLOOD, vol. 96, 2000, pages 2149 - 2156
HARVEY ET AL., PROC. NATL. ACAD. SCI. USA, vol. 83, 1986, pages 1084 - 1088
HASLINGER; KARIN, PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 8572
HAUBER; CULLEN, J. VIROLOGY, vol. 62, 1988, pages 673
HEN ET AL., NATURE, vol. 321, 1986, pages 249
HENSEL ET AL., LYMPHOKINE RES., vol. 8, 1989, pages 347
HERR; CLARKE, CELL, vol. 45, 1986, pages 461
HIROCHIKA ET AL., J. VIROL., vol. 61, 1987, pages 2599
HIRSCH ET AL., MOL. CELL. BIOL., vol. 10, 1990, pages 1959
HOLBROOK ET AL., VIROLOGY, vol. 157, 1987, pages 211
HORLICK; BENFIELD, MOL. CELL. BIOL., vol. 9, 1989, pages 2396
HSU ET AL., PROC. NATL. ACAD. SCI. USA, vol. 100, 2003, pages 12420 - 12425
HUANG ET AL., CELL, vol. 27, 1981, pages 245
HUG ET AL., MOL. CELL. BIOL., vol. 8, 1988, pages 3065
HWANG ET AL., MOL. CELL. BIOL., vol. 10, 1990, pages 585
IMAGAWA ET AL., CELL, vol. 51, 1987, pages 251
IMBRA; KARIN, NATURE, vol. 323, 1986, pages 555
IMIER ET AL., MOL. CELL. BIOL., vol. 7, 1987, pages 2558
IMPERIALE; NEVINS, MOL. CELL. BIOL., vol. 4, 1984, pages 875
INNIS ET AL., PROC NATL ACAD SCI USA, vol. 85, no. 24, 1988, pages 9436 - 9440
INOUYE; INOUYE, NUCLEIC ACIDS RES., vol. 13, 1985, pages 3101 - 3109
JAKOBOVITS ET AL., MOL. CELL. BIOL., vol. 8, 1988, pages 2555
JAMEEL; SIDDIQUI, MOL. CELL. BIOL., vol. 6, 1986, pages 710
JANSSON ET AL., FEMS IMMUNOL. MED. MICROBIOL., vol. 20, 1998, pages 69 - 78
JAYNES ET AL., MOL. CELL. BIOL., vol. 8, 1988, pages 62
JENSEN, ACTA PATH. MICROBIOL. SCANDIN., vol. 44, 1958, pages 421 - 428
JOHNSON ET AL., METHODS IN ENZYMOL., vol. 203, 1991, pages 88 - 99
JOHNSON ET AL., MOL. CELL. BIOL., vol. 9, 1989, pages 3393
JONES, CARB. RESEARCH, vol. 340, 2005, pages 1097 - 1106
JONSSON ET AL., ORAL DIS., vol. 8, no. 3, 2002, pages 130 - 140
JOYCE ET AL., CARBOHYDRATE RESEARCH, vol. 338, 2003, pages 903 - 922
KADESCH; BERG, MOL. CELL. BIOL., vol. 6, 1986, pages 2593
KAEPPLER ET AL., PLANT CELL REP., vol. 8, 1990, pages 415 - 418
KANEDA ET AL., SCIENCE, vol. 243, 1989, pages 375 - 378
KARIN ET AL., MOL. CELL. BIOL., vol. 7, 1987, pages 606
KATINKA ET AL., CELL, vol. 20, 1980, pages 393
KATO ET AL., J. BIOL. CHEM., vol. 266, 1991, pages 3361 - 3364
KAWAMOTO ET AL., MOL. CELL. BIOL., vol. 8, 1988, pages 267
KENNEDY ET AL., PROC. NATL. ACAD. SCI. USA, vol. 105, 2008, pages 1327 - 1332
KILEDJIAN ET AL., MOL. CELL. BIOL., vol. 8, 1988, pages 145
KINOSHITA, M.; N. KOBAYASHI; S. NAGASHIMA; M. ISHINO; S. OTOKOZAWA; K. MISE; A. SUMI; H. TSUTSUMI; N. UEHARA; N. WATANABE: "Diversity of staphylocoagulase and identification of novel variants of staphylocoagulase gene in Staphylococcus aureus", MICROBIOL. IMMUNOL.S, vol. 52, 2008, pages 334 - 348
KLAMUT ET AL., MOL. CELL. BIOL., vol. 10, 1990, pages 193
KLEVENS ET AL., CLIN. INFECT. DIS., vol. 47, 2008, pages 927 - 30
KLEVENS ET AL., JAMA, vol. 298, 2007, pages 1763 - 1771
KOCH ET AL., MOL. CELL. BIOL., vol. 9, 1989, pages 303
KOHLER; MILSTEIN, NATURE, vol. 256, 1975, pages 495 - 497
KRIEGLER ET AL., CELL, vol. 38, 1984, pages 483
KRIEGLER ET AL., CELL, vol. 53, 1988, pages 45
KRIEGLER ET AL.: "Cancer Cells 2/Oncogenes and Viral Genes", 1984, COLD SPRING HARBOR LABORATORY
KRIEGLER; BOTCHAN, MOL. CELL. BIOL., vol. 3, 1983, pages 325
KRIEGLER; BOTCHAN: "Eukaryotic Viral Vectors", 1982, COLD SPRING HARBOR LABORATORY
KROH ET AL., PROC. NATL. ACAD. SCI. USA, vol. 106, 2009, pages 7786 - 7791
KUHL ET AL., CELL, vol. 50, 1987, pages 1057
KUKLIN ET AL., INFECT. IMMUN., vol. 74, 2006, pages 2215 - 23
KUNZ ET AL., NUCL. ACIDS RES., vol. 17, 1989, pages 1121
KURODA ET AL., LANCET, vol. 357, 2001, pages 1225 - 1240
KYTE; DOOLITTLE, J. MOL. BIOL., vol. 157, no. 1, 1982, pages 105 - 132
LAGERGARD ET AL., EUR. J. CLIN. MICROBIOL. INFECT. DIS., vol. 11, 1992, pages 341 - 5
LAM ET AL., J. BACTERIOL., vol. 86, 1963, pages 87 - 91
LARSEN ET AL., PROC NATL. ACAD. SCI. USA., vol. 83, 1963, pages 8283
LASPIA ET AL., CELL, vol. 59, 1989, pages 283
LATIMER ET AL., MOL. CELL. BIOL., vol. 10, 1990, pages 760
LEE ET AL., NATURE, vol. 294, 1981, pages 228
LEE ET AL., NUCLEIC ACIDS RES., vol. 12, 1984, pages 4191 - 206
LEE, TRENDS MICROBIOL., vol. 4, no. 4, 1996, pages 162 - 166
LEVENSON ET AL., HUM. GENE THER., vol. 9, no. 8, 1998, pages 1233 - 1236
LEVINSON ET AL., NATURE, vol. 295, 1982, pages 79
LIN ET AL., MOL. CELL. BIOL., vol. 10, 1990, pages 850
LOWY, NEW ENGL. J. MED., vol. 339, 1998, pages 520 - 532
LURIA ET AL., EMBO J., vol. 6, 1987, pages 3307
LUSKY ET AL., MOL. CELL. BIOL., vol. 3, 1983, pages 1108
LUSKY; BOTCHAN, PROC. NATL. ACAD. SCI. USA, vol. 83, 1986, pages 3609
MACEJAK; SAMOW, NATURE, vol. 353, 1991, pages 90 - 94
MACGURN ET AL., MOL. MICROBIOL., vol. 57, 2005, pages 1653 - 1663
MAIRA-LITRAN ET AL., INFECT. IMMUN., vol. 70, 2002, pages 4433 - 4440
MAIRA-LITRAN ET AL., VACCINE, vol. 22, 2004, pages 872 - 879
MAJORS; VARMUS, PROC. NATL. ACAD. SCI. USA, vol. 80, 1983, pages 5866
MARKWARDT, UNTERSUCHUNGEN ÜBER HIRUDIN. NATURWISSENSCHAFTEN, vol. 41, 1955, pages 537 - 538
MAZMANIAN ET AL., MOL. MICROBIOL., vol. 40, 2001, pages 1049 - 1057
MAZMANIAN ET AL., MOL. MICROBIOL., vol. 40, no. 5, 2001, pages 1049 - 1057
MAZMANIAN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 97, 2000, pages 5510 - 5515
MAZMANIAN ET AL., SCIENCE, vol. 285, no. 5428, 1999, pages 760 - 3
MCLAUGHLIN ET AL., PLOS PATHOG, vol. 3, 2007, pages EL05
MCNEALL ET AL., GENE, vol. 76, 1989, pages 81
MERNAUGH ET AL.: "Molecular Methods in Plant Pathology", 1995, CRC PRESS INC., pages: 359 - 365
MERRIFIELD, SCIENCE, vol. 232, no. 4748, 1986, pages 341 - 347
MIKSICEK ET AL., CELL, vol. 46, 1986, pages 203
MORDACQ; LINZER, GENES AND DEV., vol. 3, 1989, pages 760
MOREAU ET AL., CARBOHYDRATE RES., vol. 201, 1990, pages 285 - 297
MOREAU ET AL., NUCL. ACIDS RES., vol. 9, 1981, pages 6047
MOREILLON ET AL., INFECT. IMMUN., vol. 63, 1995, pages 4738 - 4743
MOSMANN; COFFINAN, ANN. REV. IMMUNOL., vol. 7, 1989, pages 145 - 173
MUESING ET AL., CELL, vol. 48, 1987, pages 691
MUSHER ET AL., MEDICINE (BALTIMORE), vol. 73, 1994, pages 186 - 208
NAVARRE; SCHNEEWIND, J. BIOL. CHEM., vol. 274, 1999, pages 15847 - 15856
NEEDLEMAN; WUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 443
NG ET AL., NUC. ACIDS RES., vol. 17, 1989, pages 601
NICOLAU ET AL., METHODS ENZYMOL., vol. 149, 1987, pages 157 - 176
NICOLAU; SENE, BIOCHIM. BIOPHYS. ACTA, vol. 721, 1982, pages 185 - 190
NOVICK, MOL. MICROBIOL.,, vol. 48, 2003, pages 1429 - 1449
O'BRIEN ET AL., MOL. MICROBIOL., vol. 44, 2002, pages 1033 - 1044
OMIRULLEH ET AL., PLANT MOL. BIOL., vol. 21, no. 3, 1993, pages 415 - 28
OMITZ ET AL., MOL. CELL. BIOL., vol. 7, 1987, pages 3466
ONDEK ET AL., EMBO J., vol. 6, 1987, pages 1017
O'SEAGHDHA ET AL., FEBS J., vol. 273, 2006, pages 4831 - 4841
PALLEN, TRENDS MICROBIOL., vol. 10, 2002, pages 209 - 212
PALMITER ET AL., NATURE, vol. 300, 1982, pages 611
PALMQVIST ET AL., MICROBES. INFECT., vol. 7, 2005, pages 1501 - 11
PANIZZI ET AL., J. BIOL. CHEM., vol. 281, 2006, pages 1179 - 1187
PEARSON; LIPMAN, PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 2444
PECH ET AL., MOL. CELL. BIOL., vol. 9, 1989, pages 396
PELLETIER; SONENBERG, NATURE, vol. 334, no. 6180, 1988, pages 320 - 325
PEREZ-STABLE; CONSTANTINI, MOL. CELL. BIOL., vol. 10, 1990, pages 1116
PHONIMDAENG ET AL., MOL. MICROBIOL., vol. 4, 1990, pages 393 - 404
PICARD; SCHAFFNER, NATURE, vol. 307, 1984, pages 83
PINKERT ET AL., GENES AND DEV., vol. 1, 1987, pages 268
PONTA ET AL., PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 1020
PORTON ET AL., MOL. CELL. BIOL., vol. 10, 1990, pages 1076
POTRYKUS ET AL., MOL. GEN. GENET., vol. 199, no. 2, 1985, pages 169 - 177
PUGSLEY, MICROBIOL. REV., vol. 57, 1993, pages 50 - 108
PYM ET AL., MOL. MICROBIOL., vol. 46, 2002, pages 709 - 717
PYM ET AL., NAT. MED., vol. 9, 2003, pages 533 - 539
QUEEN; BALTIMORE, CELL, vol. 35, 1983, pages 741
QUINN ET AL., MOL. CELL. BIOL., vol. 9, 1989, pages 4713
REDONDO ET AL., SCIENCE, vol. 247, 1990, pages 1225
REISMAN; ROTTER, MOL. CELL. BIOL., vol. 9, 1989, pages 3571
REMINGTON'S PHARMACEUTICAL SCIENCES, 1990
RESENDEZ JR. ET AL., MOL. CELL. BIOL., vol. 8, 1988, pages 4579
RIPE ET AL., MOL. CELL. BIOL., vol. 9, 1989, pages 2224
RIPPE ET AL., MOL. CELL BIOL., vol. 10, 1990, pages 689 - 695
RITTLING ET AL., NUC. ACIDS RES., vol. 17, 1989, pages 1619
ROBEN ET AL., J. IMMUNOL., vol. 154, 1995, pages 6437 - 6445
ROSEN ET AL., CELL, vol. 41, 1988, pages 813
SAKAI ET AL., , GENES AND DEV., vol. 2, 1988, pages 1144
SALID-SALIM ET AL., INFECT. CONTROL HOSP. EPIDEMIOL, vol. 24, 2003, pages 451 - 455
SAMBROOK ET AL.: "Molecular cloning", 2001, COLD SPRING HARBOR LABORATORY PRESS
SCHAFFNER ET AL., J. MOL. BIOL., vol. 201, 1988, pages 81
SCHNEEWIND ET AL., CELL, vol. 70, 1992, pages 267 - 281
SCHNEEWIND ET AL., EMBO, vol. 12, 1993, pages 4803 - 4811
SCHNEEWIND ET AL., SCIENCE, vol. 268, 1995, pages 103 - 6
SEARLE ET AL., MOL. CELL. BIOL., vol. 5, 1985, pages 1480
SHARP; MARCINIAK, CELL, vol. 59, 1989, pages 229
SHAUL; BEN-LEVY, EMBO J., vol. 6, 1987, pages 1913
SHAW ET AL., MICROBIOLOGY, vol. 150, 2004, pages 217 - 228
SHEAGREN, N. ENGL. J. MED, vol. 310, 1984, pages 1368 - 1373
SHERMAN ET AL., MOL. CELL. BIOL., vol. 9, 1989, pages 50
SHOPSIN ET AL., J. CLIN. MICROBIOL.,, vol. 37, 1999, pages 3556 - 63
SIBBALD ET AL., MICROBIOL. MOL BIOL. REV., vol. 70, 2006, pages 755 - 788
SILVERMAN; GOODYEAR, NAT. REV. IMMUNOL., vol. 6, 2006, pages 465 - 75
SJODAHL, EUR. J. BIOCHEM., vol. 73, 1977, pages 343 - 351
SJOQUIST ET AL., EUR. J. BIOCHEM., vol. 30, 1972, pages 190 - 194
SLEIGH; LOCKETT, J. EMBO, vol. 4, 1985, pages 3831
SMITH ET AL., BRIT. J. EXP. PATHOL., vol. 28, 1947, pages 57
SMITH; WATERMAN, ADV. APPL. MATH., vol. 2, 1981, pages 482
SORENSEN ET AL., INFECT. IMMUN., vol. 63, 1995, pages 1710 - 1717
SPALHOLZ ET AL., CELL, vol. 42, 1985, pages 183
SPANDAU; LEE, J. VIROLOGY, vol. 62, 1988, pages 427
SPANDIDOS; WILKIE, EMBO J., vol. 2, 1983, pages 1193
STANLEY ET AL., PROC. NATL. ACAD. SCI. USA, vol. 100, 2003, pages 13001 - 13006
STEPHENS; HENTSCHEL, BIOCHEM. J., vol. 248, 1987, pages 1
STEWART; YOUNG: "Solid Phase Peptide Synthesis", 1984, PIERCE CHEMICAL CO.
STRANGER-JONES ET AL., PROC. NAT. ACAD. SCI. USA, vol. 103, 2006, pages 16942 - 16947
STUDIER ET AL., METHODS ENZYMOL., vol. 185, 1990, pages 60 - 89
SULLIVAN; PETERLIN, MOL. CELL. BIOL., vol. 7, 1987, pages 3315
SWARTZENDRUBER; LEHMAN, J. CELL. PHYSIOLOGY, vol. 85, 1975, pages 179
TAKEBE ET AL., MOL. CELL. BIOL., vol. 8, 1988, pages 466
TAM ET AL., J. AM. CHEM. SOC., vol. 105, 1983, pages 6442
TAVERNIER ET AL., NATURE, vol. 301, 1983, pages 634
TAYLOR ET AL., J. BIOL. CHEM., vol. 264, 1989, pages 15160
TAYLOR; KINGSTON, MOL. CELL. BIOL., vol. 10, 1990, pages 165
TAYLOR; KINGSTON, MOL. CELL. BIOL., vol. 10, 1990, pages 176
THIESEN ET AL., J. VIROLOGY, vol. 62, 1988, pages 614
THOMSON ET AL., J. IMMUNOL., vol. 157, no. 2, 1996, pages 822 - 826
TIGGES ET AL., J. IMMUNOL., vol. 156, no. 10, 1996, pages 3901 - 3910
TON-THAT ET AL., PROC. NATL. ACAD. SCI. USA, vol. 96, no. 22, 1999, pages 12424 - 9
TREISMAN, CELL, vol. 42, 1985, pages 889
TRONCHE ET AL., MOL. BIOL. MED., vol. 7, 1990, pages 173
TRUDEL; CONSTANTINI, GENES ANDDEV., vol. 6, 1987, pages 954
TUART ET AL., NATURE, vol. 317, 1985, pages 828
TYNDELL ET AL., NUC. ACIDS. RES., vol. 9, 1981, pages 6231
UHLEN ET AL., J. BIOL. CHEM., vol. 259, 1984, pages 1695 - 1702,13628
VAN DEN ENT; LOWE, FEBS LETT., vol. 579, 2005, pages 3837 - 3841
VAN WELY ET AL., FEMS MICROBIOL. REV., vol. 25, 2001, pages 437 - 454
VANNICE; LEVINSON, J. VIROLOGY, vol. 62, 1988, pages 1305
VASSEUR ET AL., PROC NATL. ACAD. SCI. USA, vol. 77, 1980, pages 1068
VAUGHAN ET AL., NAT. BIOTECH., vol. 16, 1998, pages 535 - 539
WANG; CALAME, CELL, vol. 47, 1986, pages 241
WEBER ET AL., CELL, vol. 36, 1984, pages 983
WEINBERGER ET AL., MOL. CELL. BIOL., vol. 8, 1984, pages 988
WEISS ET AL., J. ANTIMICROB. CHEMOTHER., vol. 53, no. 3, 2004, pages 480 - 6
WINOTO; BALTIMORE, CELL, vol. 59, 1989, pages 649
WONG ET AL., GENE, vol. 10, 1980, pages 87 - 94
XU ET AL., J. INFECT. DIS.,, vol. 189, 2004, pages 2323 - 2333
XU ET AL., MOL. MICROBIAL., vol. 66, no. 3, 2007, pages 787 - 800
YUTZEY ET AL., MOL. CELL. BIOL., vol. 9, 1989, pages 1397

Cited By (78)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8840906B2 (en) 2007-08-31 2014-09-23 The University Of Chicago Methods and compositions related to immunizing against Staphylococcal lung disease and conditions
US9181329B2 (en) 2007-08-31 2015-11-10 The University Of Chicago Methods and compositions related to immunizing against Staphylococcal lung diseases and conditions
US11639379B2 (en) 2007-08-31 2023-05-02 The University Of Chicago Methods and compositions related to immunizing against Staphylococcal lung diseases and conditions
US9567379B2 (en) 2009-04-03 2017-02-14 The University Of Chicago Compositions and methods related to protein A (SpA) variants
AU2011274367B2 (en) * 2010-07-02 2015-04-23 The University Of Chicago Compositions and methods related to protein A (SpA) variants
US9315554B2 (en) 2010-07-02 2016-04-19 The University Of Chicago Compositions and methods related to protein A (SpA) variants
EP2588120A4 (en) * 2010-07-02 2014-03-26 Univ Chicago COMPOSITIONS AND METHODS RELATED TO PROTEIN-A (SPA) VARIATIONS
US11059866B2 (en) 2010-07-02 2021-07-13 The University Of Chicago Compositions and methods related to protein A (SpA) variants
US20210290748A1 (en) * 2010-07-02 2021-09-23 The University Of Chicago Compositions and Methods Related to Protein A (SpA) Variants
US10464971B2 (en) 2010-07-02 2019-11-05 The University Of Chicago Compositions and methods related to Protein A (SpA) Variants
CN103037885A (zh) * 2010-07-02 2013-04-10 芝加哥大学 与蛋白A(SpA)变体相关的组合物和方法
US11939358B2 (en) 2010-07-02 2024-03-26 The University Of Chicago Compositions and methods related to protein A (SpA) variants
US9937233B2 (en) 2010-08-06 2018-04-10 Modernatx, Inc. Engineered nucleic acids and methods of use thereof
WO2012034067A1 (en) * 2010-09-09 2012-03-15 The University Of Chicago Methods and compositions involving protective staphylococcal antigens
US9701965B2 (en) 2010-10-01 2017-07-11 Modernatx, Inc. Engineered nucleic acids and methods of use thereof
US10064959B2 (en) 2010-10-01 2018-09-04 Modernatx, Inc. Modified nucleosides, nucleotides, and nucleic acids, and uses thereof
US9657295B2 (en) 2010-10-01 2017-05-23 Modernatx, Inc. Modified nucleosides, nucleotides, and nucleic acids, and uses thereof
US9950068B2 (en) 2011-03-31 2018-04-24 Modernatx, Inc. Delivery and formulation of engineered nucleic acids
US20140179898A1 (en) * 2011-06-03 2014-06-26 Nat'l Institute Of Advanced Industrial Science And Technology Mutated protein of protein a having reduced affinity in acidic region and antibody-capturing agent
US9382297B2 (en) * 2011-06-03 2016-07-05 National Institute Of Advanced Industrial Science And Technology Mutated protein of protein A having reduced affinity in acidic region and antibody-capturing agent
EP2744517A4 (en) * 2011-08-15 2015-04-22 Univ Chicago COMPOSITIONS AND METHODS RELATED TO ANTIBODIES TO THE STAPHYLOKOKEN PROTEIN A
WO2013025834A3 (en) * 2011-08-15 2013-04-25 The University Of Chicago Compositions and methods related to antibodies to staphylococcal protein a
AU2012296576B2 (en) * 2011-08-15 2017-09-07 The University Of Chicago Compositions and methods related to antibodies to staphylococcal protein a
JP2014525933A (ja) * 2011-08-15 2014-10-02 ザ・ユニバーシティ・オブ・シカゴ ブドウ球菌プロテインaに対する抗体に関連した組成物および方法
US10047149B2 (en) 2011-08-15 2018-08-14 The University Of Chicago Compositions and methods related to antibodies to Staphylococcal protein A
US9556281B2 (en) 2011-08-15 2017-01-31 The University Of Chicago Compositions and methods related to antibodies to staphylococcal protein A
WO2013025834A2 (en) 2011-08-15 2013-02-21 The University Of Chicago Compositions and methods related to antibodies to staphylococcal protein a
US10022425B2 (en) 2011-09-12 2018-07-17 Modernatx, Inc. Engineered nucleic acids and methods of use thereof
US10751386B2 (en) 2011-09-12 2020-08-25 Modernatx, Inc. Engineered nucleic acids and methods of use thereof
WO2013142349A1 (en) * 2012-03-23 2013-09-26 University Of Chicago Compositions and methods related to staphylococcal sbi
US9878056B2 (en) 2012-04-02 2018-01-30 Modernatx, Inc. Modified polynucleotides for the production of cosmetic proteins and peptides
US9782462B2 (en) 2012-04-02 2017-10-10 Modernatx, Inc. Modified polynucleotides for the production of proteins associated with human disease
US9827332B2 (en) 2012-04-02 2017-11-28 Modernatx, Inc. Modified polynucleotides for the production of proteins
US10501512B2 (en) 2012-04-02 2019-12-10 Modernatx, Inc. Modified polynucleotides
US9828416B2 (en) 2012-04-02 2017-11-28 Modernatx, Inc. Modified polynucleotides for the production of secreted proteins
US9814760B2 (en) 2012-04-02 2017-11-14 Modernatx, Inc. Modified polynucleotides for the production of biologics and proteins associated with human disease
US9701738B2 (en) 2012-04-26 2017-07-11 The University Of Chicago Compositions and methods related to antibodies that neutralize coagulase activity during Staphylococcus aureus disease
EP2841101A4 (en) * 2012-04-26 2016-02-24 Univ Chicago COMPOSITIONS AND METHODS RELATED TO ANTIBODIES FOR NEUTRALIZING COAGULASE ACTIVITY IN STAPHYLOCOCCUS AUREUS DISEASE
JP2015515492A (ja) * 2012-04-26 2015-05-28 ザ・ユニバーシティ・オブ・シカゴThe University Of Chicago 黄色ブドウ球菌(staphylococcusaureus)疾患の間にコアグラーゼ活性を中和する抗体に関連した組成物および方法
WO2013162751A1 (en) 2012-04-26 2013-10-31 University Of Chicago Compositions and methods related to antibodies that neutralize coagulase activity during staphylococcus aureus disease
EP2844275A4 (en) * 2012-04-26 2016-10-05 Univ Chicago STAPHYLOKOKEN COAGULASE ANTIGENS AND METHOD FOR THEIR USE
US20150273040A1 (en) * 2012-04-26 2015-10-01 University Of Chicago Compositions and methods related to antibodies that neutralize coagulase activity during staphylococcus aureus disease
US10857220B2 (en) 2012-04-26 2020-12-08 The University Of Chicago Staphylococcal coagulase antigens and methods of their use
US9968668B2 (en) * 2012-04-26 2018-05-15 The University Of Chicago Staphylococcal coagulase antigens and methods of their use
CN104703622A (zh) * 2012-04-26 2015-06-10 芝加哥大学 与金黄色葡萄球菌疾病期间抵消凝固酶活性的抗体相关的组合物和方法
JP2018058871A (ja) * 2012-04-26 2018-04-12 ザ・ユニバーシティ・オブ・シカゴThe University Of Chicago 黄色ブドウ球菌(staphylococcus aureus)疾患の間にコアグラーゼ活性を中和する抗体に関連した組成物および方法
WO2014179744A1 (en) * 2013-05-03 2014-11-06 The University Of Chicago Staphylococcus live cell vaccines
WO2015005859A1 (en) * 2013-07-10 2015-01-15 Ge Healthcare Bio-Sciences Ab Mutated immunoglobulin-binding polypeptides
US9896486B2 (en) 2013-07-10 2018-02-20 Ge Healthcare Bioprocess R&D Ab Mutated immunoglobulin-binding polypeptides
WO2015005862A1 (en) * 2013-07-10 2015-01-15 Ge Healthcare Bio-Sciences Ab Mutated immunoglobulin-binding polypeptides
US10112980B2 (en) 2013-07-10 2018-10-30 Ge Healthcare Bioprocess R&D Ab Mutated immunoglobulin-binding polypeptides
US11136359B2 (en) 2013-07-10 2021-10-05 Cytiva Bioprocess R&D Ab Mutated immunoglobulin-binding polypeptides
US9663558B2 (en) 2013-07-10 2017-05-30 Ge Healthcare Bio-Sciences Ab Mutated immunoglobulin-binding polypeptides
US10815291B2 (en) 2013-09-30 2020-10-27 Modernatx, Inc. Polynucleotides encoding immune modulating polypeptides
US10323076B2 (en) 2013-10-03 2019-06-18 Modernatx, Inc. Polynucleotides encoding low density lipoprotein receptor
US9890199B2 (en) 2013-12-09 2018-02-13 Olymvax Biopharmaceuticals Inc. Staphylococcus aureus SpA5 mutant, composition comprising mutant and preparation method and use thereof
EP3101027A4 (en) * 2013-12-09 2017-07-19 Olymvax Biopharmaceuticals Inc. Staphylococcus aureus spa5 mutant, composition comprising mutant and preparation method and use thereof
WO2015144653A1 (en) * 2014-03-26 2015-10-01 Glaxosmithkline Biologicals S.A. Mutant staphylococcal antigens
EP3639850A1 (en) 2014-03-26 2020-04-22 GlaxoSmithKline Biologicals S.A. Mutant staphylococcal antigens
US10328140B2 (en) 2014-03-26 2019-06-25 Glaxosmithkline Biologicals S.A. Mutant staphylococcal antigens
WO2015144655A1 (en) * 2014-03-26 2015-10-01 Glaxosmithkline Biologicals S.A. Immunising against staphylococcus aureus
EA037818B1 (ru) * 2014-03-26 2021-05-25 Глаксосмитклайн Байолоджикалс С.А. Мутантные стафилококковые антигены
WO2015144691A1 (en) * 2014-03-26 2015-10-01 Glaxosmithkline Biologicals Sa Compositions for immunising against staphylococcus aureus
BE1022875B1 (fr) * 2014-03-26 2016-09-30 Glaxosmithkline Biologicals S.A. Compositions pour une immunisation contre staphylococcus aureus
BE1022744B1 (fr) * 2014-03-26 2016-08-29 Glaxosmithkline Biologicals Sa Antigenes staphylococciques mutants
WO2016095832A1 (en) * 2014-12-18 2016-06-23 The University Of Hong Kong Immunotherapeutic targets against staphylococcus aureus
CN106188251A (zh) * 2015-05-06 2016-12-07 上海张江生物技术有限公司 一种免疫球蛋白结合蛋白突变体及其用途
CN106188251B (zh) * 2015-05-06 2020-07-31 上海迈泰君奥生物技术有限公司 一种免疫球蛋白结合蛋白突变体及其用途
US11214600B2 (en) 2016-02-12 2022-01-04 The University Of Chicago Compositions and methods related to antibodies that neutralize coagulase activity during Staphylococcus aureus disease
US12514914B2 (en) 2019-05-14 2026-01-06 The University Of Chicago Methods and compositions comprising Staphylococcus protein a (SpA) variants
WO2021028402A1 (en) 2019-08-15 2021-02-18 Glaxosmithkline Biologicals Sa Immunogenic composition
EP3777884A1 (en) 2019-08-15 2021-02-17 GlaxoSmithKline Biologicals S.A. Immunogenic composition
US12528882B2 (en) 2019-09-13 2026-01-20 The University Of Chicago Methods and compositions for treating staphylococcal infections
US20220362368A1 (en) * 2019-10-02 2022-11-17 Janssen Vaccines & Prevention B.V. Staphylococcus peptides and methods of use
WO2021067785A1 (en) 2019-10-02 2021-04-08 Janssen Vaccines & Prevention B.V Staphylococcus peptides and methods of use
CN112898387B (zh) * 2021-03-24 2023-04-28 成都欧林生物科技股份有限公司 一种重组金黄色葡萄球菌疫苗抗原蛋白的纯化方法
CN112898387A (zh) * 2021-03-24 2021-06-04 成都欧林生物科技股份有限公司 一种重组金黄色葡萄球菌疫苗抗原蛋白的纯化方法
CN114605508A (zh) * 2022-05-11 2022-06-10 北京达成生物科技有限公司 能够结合于抗体分子Fc区域的抗体结合蛋白及其应用

Also Published As

Publication number Publication date
BRPI1010307B1 (pt) 2021-07-27
KR20170102039A (ko) 2017-09-06
ES2563646T3 (es) 2016-03-15
JP5789250B2 (ja) 2015-10-07
HUE026855T2 (en) 2016-07-28
CN102612523B (zh) 2016-01-20
EP2414387A2 (en) 2012-02-08
CA2757543C (en) 2021-07-20
ES2784957T3 (es) 2020-10-02
AU2010271116B2 (en) 2015-08-13
BRPI1010307A2 (pt) 2016-03-22
SI2414387T1 (sl) 2016-01-29
ZA201107702B (en) 2012-07-25
SG174968A1 (en) 2011-11-28
PL2414387T3 (pl) 2016-06-30
KR20110138397A (ko) 2011-12-27
SMT201600033B (it) 2016-02-25
PT2414387E (pt) 2016-03-31
HUE057713T2 (hu) 2022-05-28
AU2010271116A1 (en) 2011-10-27
EP3281947A1 (en) 2018-02-14
HRP20160274T1 (hr) 2016-04-08
HRP20200727T1 (hr) 2020-07-24
KR101773368B1 (ko) 2017-08-31
EP3281947B1 (en) 2020-02-12
DK3281947T3 (da) 2020-05-11
CN102612523A (zh) 2012-07-25
SMT202000246T1 (it) 2020-07-08
SI3281947T1 (sl) 2020-07-31
JP2012522808A (ja) 2012-09-27
CA2757543A1 (en) 2011-01-13
EP2414387B1 (en) 2015-12-16
PT3281947T (pt) 2020-05-07
CY1123052T1 (el) 2021-10-29
US20120114686A1 (en) 2012-05-10
US9567379B2 (en) 2017-02-14
PL3281947T3 (pl) 2020-07-27
HK1162533A1 (zh) 2012-08-31
DK2414387T3 (en) 2016-03-07
LT3281947T (lt) 2020-05-25
EP2414387A4 (en) 2012-08-15
WO2011005341A3 (en) 2011-06-09
EP3002293A1 (en) 2016-04-06

Similar Documents

Publication Publication Date Title
US11939358B2 (en) Compositions and methods related to protein A (SpA) variants
CA2757543C (en) Compositions and methods related to protein a (spa) variants
US9095540B2 (en) Methods and compositions involving protective staphylococcal antigens
US9907850B2 (en) Compositions and methods related to protein A (SpA) antibodies as an enhancer of immune response
US8945588B2 (en) Methods and compositions involving protective staphylococcal antigens, such as EBH polypeptides
AU2015202158B2 (en) Compositions and methods related to protein a (spa) variants
HK1162533B (en) Compositions and methods related to protein a (spa) variants

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 201080024448.7

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 10797468

Country of ref document: EP

Kind code of ref document: A2

WWE Wipo information: entry into national phase

Ref document number: 2757543

Country of ref document: CA

Ref document number: 2012503769

Country of ref document: JP

WWE Wipo information: entry into national phase

Ref document number: 7833/DELNP/2011

Country of ref document: IN

ENP Entry into the national phase

Ref document number: 2010271116

Country of ref document: AU

Date of ref document: 20100405

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2010797468

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 20117026053

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 13260878

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: PI1010307

Country of ref document: BR

ENP Entry into the national phase

Ref document number: PI1010307

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20111003