WO2009135861A2 - Humanized antibodies against human interferon-alpha - Google Patents
Humanized antibodies against human interferon-alpha Download PDFInfo
- Publication number
- WO2009135861A2 WO2009135861A2 PCT/EP2009/055448 EP2009055448W WO2009135861A2 WO 2009135861 A2 WO2009135861 A2 WO 2009135861A2 EP 2009055448 W EP2009055448 W EP 2009055448W WO 2009135861 A2 WO2009135861 A2 WO 2009135861A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- ifn
- hzaco
- aco
- cdr
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/24—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
- C07K16/249—Interferons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/14—Prodigestives, e.g. acids, enzymes, appetite stimulants, antidyspeptics, tonics, antiflatulents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
- A61P11/02—Nasal agents, e.g. decongestants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
- A61P11/06—Antiasthmatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/12—Drugs for disorders of the urinary system of the kidneys
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/06—Antipsoriatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/20—Antivirals for DNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/08—Antiallergic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P5/00—Drugs for disorders of the endocrine system
- A61P5/14—Drugs for disorders of the endocrine system of the thyroid hormones, e.g. T3, T4
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/04—Antihaemorrhagics; Procoagulants; Haemostatic agents; Antifibrinolytic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/06—Antianaemics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/46—Hybrid immunoglobulins
- C07K16/461—Igs containing Ig-regions, -domains or -residues form different species
- C07K16/464—Igs containing CDR-residues from one specie grafted between FR-residues from another
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
Definitions
- the present invention relates to humanized antibodies against human interferon al- pha (IFN- ⁇ ) and their use in treating or preventing various diseases and disorders in human patients.
- IFN- ⁇ interferon al- pha
- interferon alpha is a cytokine believed to be involved in a number of autoimmune diseases.
- SLE systemic lupus erythomatosus
- DC dendritic cell
- Antibodies against IFN- ⁇ have therefore been suggested as tools to neutralize the activity of this cytokine for the treatment of such autoimmune diseases, alone or in combination.
- Specific murine antibodies (ACO-1 to ACO-6) that recognize a wide range of different IFN- ⁇ subtypes were generated and characterized as described in the international patent application published as WO20060086586.
- murine antibodies are not suitable for use in humans because of their immunogenicity, and it is therefore desirable to generate humanized antibodies where the murine CDRs are grafted onto a human scaffold antibody.
- humanized antibodies often suffer from functional deficiencies as compared to the murine parent, such as, e.g., a lower affinity and/or stability and/or undesirable immunogenic- ity.
- Such deficiencies in humanized antibodies can in some cases be compensated for by making one or a few back point mutations. It is usually desirable to perform no or only a very few back point mutations since the presence of too many back mutations tend to result in undesirable low stability and/or an undesirable degree of immunogenicity.
- the provision of a safe and stable humanized anti-IFN- ⁇ antibody having desirable biological properties such as e.g. retaining affinity and potency of the humanized anti-IFN- ⁇ antibody to a large number of IFN- ⁇ subtypes is thus desirable.
- the present invention relates to a humanized antibody that specifically binds human interferon- ⁇ (IFN- ⁇ ), or an antigen-binding fragment thereof, which humanized antibody is a humanized version of murine antibody ACO-1 or ACO-2, or of a combination thereof, comprising fewer donor amino acid residues than the murine complementary deter- mining regions (CDRs) according to Kabat.
- IFN- ⁇ human interferon- ⁇
- CDRs murine complementary deter- mining regions
- the present invention furthermore relates to a humanized antibody that specifically binds IFN- ⁇ , or an antigen-binding fragment thereof, wherein said antibody is capable of binding IFN- ⁇ subtypes A, 2, B2, C, F, G, H2, I, J1 , K, 4a, 4b and WA, but not subtypes 1 or D, and wherein said antibody comprises fewer donor amino acid residues than the non-human CDRs according to Kabat.
- the present invention furthermore relates to methods for obtaining such antibodies as well as use of such antibodies for therapeutic purposes and compositions comprising such antibodies.
- the antibodies according to the present invention can be suitable for treatment of various inflammatory diseases.
- Figure 2 shows an alignment between ACO-1 and ACO-2 VH (A) and VL (B) sequences, as well as the corresponding mouse germline sequences.
- Figure 3 shows the location of ACO-2 residues selected for introduction into hzACO-1.
- Figure 4 shows hzACO-1 inhibition of the protective effect of all interferon subtypes tested except for IFN- ⁇ D and IFN- ⁇ 1 in a CPE assay.
- Figure 5 shows hzACO-1 inhibition of 12 IFN- ⁇ species by a reporter gene (RG) assay. Values for each antibody concentration were normalized and the average of four repetitions were calculated. Data are shown as average +/- standard errors. Best fit sigmoidal re- sponse curves were calculated using Prism software. R2 values were for all dataset above 0.98 (except for IFN- ⁇ D for which no curve fitting was made).
- Figure 6 shows an RG assay comparison of hzACO-1 with a hzACO-1 variants having the single ACO-2-derived mutation A93V, using IFN- ⁇ A (A) or IFN- ⁇ F (B). Data calculations were made as described for Figure 5.
- Figure 7 shows transition temperatures for hzACO-1 and variants at pH 3.5 (A), 4.5
- Figure 8 shows the structure of hzACO-1 Fab fragment chains (H, L) bound to IFN- ⁇ 8, determined by X-ray crystallography.
- Figure 9 shows the IFN- ⁇ 8 binding epitopes for IFNAR1 and IFNAR2 (Quadt- Akabayov S. R. et al. Protein Sci. 15, 2656-2668, 2006 and Roisman L.C et al. J. MoI. Biol. 353, 271-281 , 2005), as indicated by colored boxes below the IFN- ⁇ 8 sequence. Residues indicated by boxes colored gray are partly conserved among all IFN- ⁇ subtypes while residues indicated by black colored boxes are fully conserved.
- the hzACO-1 binding epitope, using a 4 A distance cut-off, on IFN- ⁇ 8 is indicated by "*" above the amino acid sequence of IFN- ⁇ 8.
- Figure 11 shows a protein stability study of hzACO-1 expressed with human IgGI , lgG2 and lgG4 isotypes. Aggregation was determined by HPLC after incubation in histidine buffer for 5 weeks.
- Figure 12 shows a 51 Cr release assay illustating lack of ADCC by hzACO-1 lgG4, IFN- ⁇ and different combinations hereof, at different effector: target cell ratios (E:T).
- E:T target cell ratios
- Cells + PBMCs alone without IFN- ⁇ pr hzACO-1 determines background lysis and Triton-X 100 illus- trates maximal lysis.
- Rituxan was included as a positive control and induces detectable cell lysis at all E:T ratios.
- Figure 13 shows a complement binding study by Elisa.
- the hzACO-1 expressed as an lgG4 was unable to fix complement when bound to IFN- ⁇ .
- the hzACO-1 was cross bound with an anti-lgG4 pAb, and a clear dose dependent binding of C4 to the anti-lgG4 was detected.
- the present invention is based, in part, on anti-IFN- ⁇ antibodies with properties suitable for treating human patients suffering from an IFN- ⁇ -related condition or disease, such as, e.g., a lupus disease or disorder such as, e.g., SLE; graft versus host disease; type 1 diabetes, AIDS, autoimmune thyroiditis, psoriasis, juvenile dermatomyositis, and Sjogren's syndrome.
- the antibodies are typically based on humanized versions of the murine ACO-1 and/or ACO-2 antibodies.
- ACO-1 and ACO-2 were identified as capable of blocking the bioactivity of thirteen recombinant IFN- ⁇ subtypes as well as two complex mixtures of IFN- produced upon viral infection (see WO2006086586).
- ACO-1 and ACO-2 also consistently blocked the bioactivity of serum from SLE patients that exhibited IFN- ⁇ signatures by microarray analysis.
- ACO-1 and ACO-2 did not significantly neutralize the bioactivity of IFN- ⁇ protein subytpes D and 1 , but did neutralize the IFN- ⁇ bioactivity of SLE serum. Though not limited to theory, it is therefore possible that subtypes D and 1 are not significantly involved in the etiology of SLE.
- variable regions As described in the Examples, structural modelling of the variable regions revealed that it was possible to humanize ACO-1 and ACO-2 using fewer donor (murine) residues than the Kabat CDRs, thus further reducing the risk for an adverse immune response in a human patient.
- the analysis also identified advantageous sites for back-mutations. It was further discovered that, possibly due to the high sequence similarity between the ACO-1 and ACO-2 variable regions (differing only at 13 sites), certain amino acid residues in the humanized ACO-1 (hzACO-1) sequence could be replaced by ACO-2 residues at the corresponding position. Within CDR regions, mutations can normally be made without rendering the antibody sequence less human. This humanization procedure resulted in improved functional properties such as affinity, stability, expression level and IFN- ⁇ -inhibitory activity of the humanized antibody.
- exemplary mutations in the hzACO-1 VH include V5Q, T28S, M69L, R71V, T73K, S76I, S76N, T77I, V78A, Y79F and A93V, as well as any combination thereof, using Kabat numbering.
- Exemplary mutations in the hzACO-1 VL include E1Q, D29G, L33F, L47W, S50G, I58V, and F71Y, as well as any combination thereof.
- the hzACO-1 VH region comprises a mutation selected from T28S, N31 S, and A93V.
- the hzACO-1 VH region comprises a mutation selected from T28S, N31S, and A93V, and any combination thereof, such as, e.g., T28S and N31S, T28S and A93V, and N31 S and A93V.
- the hzACO-1 VH region comprises a mutation selected from T28S, N31S, and A93V, or a combination thereof, such as, e.g., T28S and N31 S, T28S and A93V, or N31S and A93V; and and at least one additional mutation.
- ACO-1 and ACO-2 antibodies are characterized and described in WO20060086586.
- ACO-1 is deposited with ATCC accession no. PTA-6557 (WO2006086586) and ACO-2 is deposted as ATCC accesson No. PTA-7778 (WO2008021976).
- the antibodies according to the present invention are humanized variants of ACO-1 and ACO-2.
- the humanized versions of ACO-1 and ACO-2 according to the present invention do not comprise the full length murine Kabat sequences.
- at least one of the CDR sequences comprise a truncation of about 3-10 amino acids, preferably 3-8, more preferably 4-7 amino acids.
- the antibody preferably comprises a truncation in the CDR H2, said CDR H2 preferably being truncated by 3-10, preferably 3-8, more preferably 4-7, and most preferably by 6 amino acids. And it furthermore follows that occassional point mutations may be introduced in one or more CDR sequences as well as within the human scaffold antibody.
- the term "ACO-1 and ACO-2 antibodies” may however furthermore embrace any IFN- ⁇ antibody capable of binding IFN- ⁇ subtypes A, 2, B2, C, F, G, H2, I, J1 , K, 4a, 4b and WA, but not subtypes 1 or D.
- An ACO- 1/ACO-2 antibody according to the present invention is thus a humanized antibody compris- ing CDR sequences having at least 90% identity with the CDR sequences of ACO-1 and ACO-2, more preferably at least 92%, and most preferably at least 95%.
- CDR truncation “forward mutation”, and “shortening of CDRs” may be used interchangeably throughout the document. In connection with the present invention such terms generally refer to the fact that CDR-truncation may be perceived as a number of forward mutations in a row - meaning that a shortened murine CDR fragment can be grafted onto the human framework. While it may not be surprising that grafting of shorter CDRs tend to result in antibodies with reduced degree of immunogenicity, it is actually surprising that other advantageous features of the humanized antibody may be retained such as e.g. stability, specificity, etc. "Back mutations” always refer to mutations in the framework (i.e. not in the CDRs) - and back mutations are typically introduction of one or more "murine" amino acid residue at selected sites e.g. in order to stabilise the antibody structure.
- IFN- ⁇ interferon alpha
- IFN- ⁇ B2 is sometimes also referred to as IFN- ⁇ B, and is not to be confused with IFN- ⁇ .
- Natural IFN- ⁇ from leukocytes (leukocyte IFN-), as well as recombinant human IFN- ⁇ protein subtypes are available from PBL Biomedical Labs, Pis- cataway, NJ (interferonsource.com). Natural IFN- ⁇ is a complex mixture of IFN- ⁇ subtypes. Methods for detecting and quantifying these interferons, such as ELISA and RIA, are known in the art.
- antibody herein is used in the broadest sense and specifically includes full-length monoclonal antibodies, polyclonal antibodies, and, unless otherwise stated or con- tradicted by context, antigen-binding fragments, antibody variants, and multispecific molecules thereof, so long as they exhibit the desired biological activity.
- a full-length antibody is a glycoprotein comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds, or an antigen binding portion thereof.
- Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant region.
- the heavy chain constant region is comprised of three domains, CH 1 , CH2 and CH3.
- Each light chain is comprised of a light chain variable region (abbreviated herein as VL) and a light chain constant region.
- the light chain constant region is comprised of one domain, CL.
- the VH and VL regions can be further subdivided into regions of hypervariabil- ity, termed complementarily determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR).
- CDR complementarily determining regions
- FR framework regions
- Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1 , CDR1 , FR2, CDR2, FR3, CDR3, FR4.
- the variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
- an "antigen-binding fragment" of an antibody is a molecule that comprises a portion of a full-length antibody which is capable of detectably binding to the antigen.
- Antigen- binding fragments include multivalent molecules comprising one, two, three, or more antigen- binding portions of an antibody, and single-chain constructs wherein the VL and VH regions, or selected portions thereof, are joined by synthetic linkers or by recombinant methods to form a functional, antigen-binding molecule.
- antibody derivative and “immunoconjugate” are used interchangeably herein to denote molecules comprising a full-length antibody or an antigen-binding fragment thereof, wherein one or more amino acids are chemically modified, e.g., by alkylation, PEGy- lation, acylation, ester formation or amide formation or the like, e.g., for linking the antibody to a second molecule.
- exemplary modifications include PEGylation, cysteine-PEGylation, biotinylation, radiolabelling, and conjugation with a second agent, such as a detectable or cytotoxic agent.
- a “multispecific molecule” comprises an antibody, or an antigen-binding fragment thereof, which is associated with or linked to at least one other functional molecule (e.g. an- other peptide or protein such as another antibody or ligand for a receptor) to generate a molecule that binds to at least two different binding sites or target molecules.
- exemplary multispecific molecules include bi-specific antibodies and antibodies linked to soluble receptor fragments or ligands.
- a “humanized” antibody is a human/non-human chimeric antibody that contains a minimal sequence (CDR regions) derived from non-human immunoglobulin.
- Humanized antibodies are thus human immunoglobulins (recipient antibody) in which residues from a hyper-variable region of the recipient are replaced by residues from a hypervariable region of a non-human species (donor antibody) such as mouse, rat, rabbit, or non-human primate having the desired specificity, affinity, and capacity.
- donor antibody such as mouse, rat, rabbit, or non-human primate having the desired specificity, affinity, and capacity.
- FR residues of the hu- man immunoglobulin are replaced by corresponding non-human residues.
- humanized antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance.
- a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin and all or substantially all of the FR residues are those of a human immunoglobulin sequence.
- the humanized antibody can optionally also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
- hypervariable region when used herein refers to the amino acid residues of an antibody that are responsible for antigen binding.
- the hypervariable region generally comprises amino acid residues from a "complementarity-determining region” or "CDR" (residues 24-34 (L1), 50-56 (L2) and 89-97 (L3) in the light-chain variable domain and 31 -35 (H1 ), 50-65 (H2) and 95-102 (H3) in the heavy-chain variable domain; (Kabat et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No.
- CDR complementarity-determining region
- a heavy chain variable domain may include amino acid inser- tions (residue 52a, 52b and 52c according to Kabat) after residue 52 of CDR H2 and inserted residues (e.g. residues 82a, 82b, and 82c, etc. according to Kabat) after heavy chain FR residue 82.
- the Kabat numbering of residues may be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a "standard” Kabat numbered sequence. "Framework region" or "FR" residues are those VH or VL residues other than the
- “Corresponding" amino acid positions in two substantially identical amino acid sequences are those aligned by any of the protein analysis software referred to herein, typically using default parameters.
- An "isolated" molecule is a molecule that is the predominant species in the composition wherein it is found with respect to the class of molecules to which it belongs (i.e., it makes up at least about 50% of the type of molecule in the composition and typically will make up at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or more of the species of molecule, e.g., peptide, in the composition).
- a composition of an antibody molecule will exhibit 98%, 98%, or 99% homogeneity for antibody molecules in the context of all present peptide species in the composition or at least with respect to substantially active peptide species in the context of proposed use.
- selectively neutralizes and “selectively neutralizing”, as used herein, refer to an isolated and purified antibody (such as, but not limited to a monoclonal antibody), or an antigen-binding fragment thereof, that neutralizes selectively at least about 40%, at least about 50%, or at least about 60% of a bioactivity of one or more IFN- ⁇ protein subtypes, but does not significantly neutralize at least one bioactivity of another IFN- ⁇ protein subtype, wherein the bioactivity can be, e.g., activation of the MxA promoter and/or antiviral activity.
- treatment refers to preventing, alleviating, managing, curing or reducing one or more symptoms or clinically relevant manifestations of a disease or disorder, unless contradicted by context.
- treatment of a patient in whom no symptoms or clinically relevant manifestations of a disease or disorder have been identified is preventive or prophylactic therapy, whereas “treatment” of a patient in whom symptoms or clinically relevant manifestations of a disease or disorder have been identified generally does not constitute preventive or prophylactic therapy.
- IFN- ⁇ -related condition or disease refers to an abnormal condition, disease, or pre-clinical disease state that has been linked with elevated levels of IFN- ⁇ in a patient's serum.
- lupus diseases or disorders such as SLE, graft versus host disease (GVHD), type 1 diabetes, AIDS (caused by human immunodeficiency virus (HIV)), autoimmune thyroiditis, and psoriasis.
- GVHD graft versus host disease
- HIV human immunodeficiency virus
- autoimmune thyroiditis autoimmune thyroiditis
- psoriasis psoriasis.
- the antibodies of the invention are humanized version of the anti-IFN- ⁇ mouse antibodies ACO-1 or ACO-2, variants thereof, and/or antigen-binding fragments thereof, charac- terized by particular functional and/or structural features or properties.
- Recombinant antibodies can be produced in suitable host cell lines by standard techniques and be characterized by various assays to evaluate their functional activities, as described below.
- IFN-alpha antibodies according to the present invention may be produced with a significantly improved yield compared to IFN-alpha antibodies that were humanized in a tradi- tional way.
- the sequence of the variable domain of a rodent antibody is screened against a library of such known human variable-domain sequences or libraries of human germline sequences.
- the human sequence that is closest to that of the rodent can then be accepted as the human framework region for the humanized antibody (Sims et a/., J. Immunol. 1993;151 :2296 et seq.; Chothia et al, Chothia and Lesk, J. MoI. Biol 1987; 196:901 -917).
- Another method uses a particular framework region derived from the consensus sequence of all human antibodies of a particular subgroup of light or heavy chains. The same framework may be used for several different humanized antibodies.
- Preferred framework sequences for use in the antibodies of the invention are those that are structurally similar to the framework sequences used by ACO-1 or ACO-2.
- the invention provides a humanized ACO-1 or ACO-2 anitbody comprising VH framework residues derived from a human VH1_46 gene and a human JH4 gene, and VL framework residues derived from a human VKIII_L6 gene and a human JK2 gene, and specifically binds human IFN- ⁇ .
- Example 1 below describes the design of an exemplary humanized ACO-1 antibody, hzACO-1 , comprising such framework sequences.
- the humanized antibodies of the invention bind specifically to IFN- ⁇ subtypes A, 2, B2, C, F, G, H2, I, J1 , K, 4a, 4b, and WA (Table 2).
- a humanized ACO- 1 or ACO-2 antibody of the invention binds to an IFN- ⁇ protein subtype such as IFN- ⁇ A with high affinity, for example with a KD of about 10 '7 M or less, a KD of about 10 '8 M or less, a KD of about 5 x10 '9 M or less, or a KD of about 2x10 '9 M or less.
- the humanized antibody is a hzACO-1 variant which binds to IFN- ⁇ A, IFN- ⁇ F, and/or another IFN- ⁇ protein subtypes with an affinity comparable to or higher than that of hzACO-1.
- the ratio between the KD of the hzACO-1 variant and the KD of hzACO-1 to a IFN- ⁇ A protein subtype can be about 1.0, about 0.8, about 0.7, or about 0.6.
- the humanized antibody is a hzACO-1 variant which binds to IFN- ⁇ A, IFN- ⁇ F, and/or another IFN- ⁇ protein subtype with an affinity comparable to or higher than that of recombinantly produced ACO-1.
- the humanized antibody is a hzACO-1 variant which binds to IFN- ⁇ A, IFN- ⁇ F, and/or another IFN- ⁇ protein subtypes with an affinity comparable to or higher than that of hybridoma-produced ACO-1.
- the humanized antibodies of the invention are capable of selectively neutralizing a bioactivity of one or more IFN- ⁇ protein subtypes.
- a humanized ACO-1 or ACO-2 variant can be capable of selectively neutralizing at least about 40%, at least about 50%, or at least about 60% of a bioactivity of IFN- ⁇ protein subtypes A, 2, B2, C, F, G, H2, I, J1 , K, 4a, 4b, or WA, or any combination thereof, as compared to a control.
- the humanized antibody does not significantly neutralize the bioactivity of IFN- ⁇ subtypes D and/or 1.
- Exemplary bioactivities include, but are not limited to, activation of the MxA promoter, antiviral activity, or both.
- the ability of a humanized antibody to neutralize such IFN- ⁇ bioactivity can be evaluated using, e.g., the reporter gene (RG) an cy- topathic inhibition (CPE) assays described herein.
- the humanized antibody is a hzACO-1 variant which has an IC50 comparable to or lower than the IC50 of hzACO-1 in an RG assay.
- the hzACO-1 variant has a lower IC50 than hzACO-1 in an RG assay.
- the humanized antibodies of the invention compete with and/or bind to the same epitope on an IFN- ⁇ protein subtype as ACO-1 and/or ACO-2.
- Such antibodies can be identified based on their ability to cross-compete with ACO-1 and/or ACO-2 in standard IFN- ⁇ binding assays as described herein.
- the ability of a test humanized antibody antibody to inhibit the binding of ACO-1 or ACO-2 to one or more IFN- ⁇ protein subtypes demonstrates that the test antibody can compete with ACO-1 or ACO-2 for binding to IFN- ⁇ and thus can bind to the same epitope on the IFN- ⁇ protein subtype as ACO-1 and/or ACO-2 (WO02066649 and WO2005059106).
- the humanized antibody binds to a different human IFN- ⁇ epitope than any of the murine monoclonal antibodies 9F3, and MMHA-1 , -2, -3, -6, -8, -9, -1 1 , -13, and -17 (PBL Biomedical Laboratories, NJ, USA) and/or human monoclonal antibodies 13H5, 13H7, and 7H9, and/or cross-competes more with ACO-1 or ACO-2 than with one or more of the listed murine and human monoclonal antibodies.
- hzACO-1 , hzACO-2, hzACO-1 variants or hzACO-2 variants provided by the invention have an immunogenicity comparable to or lower than that of a hu- manized ACO-1 or ACO-2 antibody comprising murine CDRs according to Kabat (Kabat
- Immunogenicity of a humanized antibody can be evaluated by, e.g. , one or more of the methods described in Wadwha et al., Dev Biol (Basel). 2005; 122: 155-70), which is hereby incorporated by reference in its entirety.
- the humanized antibodies of the invention are stable in a formula- tion suitable for administration to a human patient.
- the humanized ACO- 1 or ACO-2 antibody according to the invention is at least as as stable as the IFN-alpha antibodies humanized in a traditional way comprising the full length murine Kabat seqeunces. Stablity of an antibody can be evaluated using known methods in the art, including the ther- maflour analyses described in Example 1 1.
- Preferred humanized antibodies of the invention exhibit at least one, more preferably two, three, four, five or more, of the following properties: (a) bind specifically to IFN- ⁇ subtypes A, 2, B2, C, F, G, H2, I 1 JI 1 K, 4a, 4b, and WA; (b) selectively neutralize one or more bioactivities of IFN- ⁇ protein subtypes A, 2, B2, C, F, G, H2, I 1 J1 , K, 4a, 4b, or WA; any combination thereof, or all thereof; (c) do not significantly neutralize a bioactivity of IFN- ⁇ 1 or D; (d) compete with and/or bind to the same epitope on an IFN- ⁇ protein subtype as ACO-1 and/or ACO-2; (e) compete more with ACO-1 or ACO-2 than with any of 9F3, 13H5, 13H7, and 7H9; (f) are less likely to elicit an immune response than a hzACO-1 or hzACO-2 antibody compris
- Preferred antibodies of the invention are humanized versions of the murine monoclonal antibodies ACO-1 and ACO-2. Such antibodies can be produced, isolated, and structurally and functionally characterized as described in the Examples. Full-length, variable region, and Kabat CDR sequences of ACO-1 , hzACO-1 and ACO-2 are set forth in Table 3 and described in Figures 1-3.
- the sequences of hzACO-1 CDR H1 , H3, L1 , L2, and L3 are identical to the corresponding ACO-1 sequences.
- ACO-2 CDR H3 and L3 are identical to the corresponding ACO-1 CDR sequences.
- the amino acids shown in italics in the hzACO-1 CDR_H2 se- quence correspond to the human framework sequence - in traditionally humanized antibodies the full length Kabat sequence correspond to the ACO-1 CDR_H2 sequence, where all amino acids are derived from the murine antibody.
- the invention provides humanized versions of murine ACO-1 and ACO-2 antibodies with fewer donor residues than the Kabat CDRs, i.e., fewer murine resi- dues than a humanized ACO-1 or ACO-2 antibody produced by grafting of the kabat CDRs.
- the humanized antibody specifically binds human IFN- ⁇ and is a humanized version of murine antibody ACO-1 or ACO-2, or of a combination thereof, comprising fewer donor amino acid residues than the murine complementary determining regions (CDRs) according to Kabat.
- the CDR H2 sequence may, for example, comprise fewer do- nor amino acid residues than those corresponding to Kabat residues 50-65, 50-64, 50-63, 50-62, 50-61 , or 50-60.
- the CDR H2 donor residues may comprise Kabat residues 50-59. Additionally or alternatively, the CDR H2 donor amino acid residues may consist of Kabat residues 50-59. Kabat residues 50-59 correspond to residues 1-1 1 of SEQ ID NOS: 16, 21 , and 23.
- the remaining VH CDRs may comprise or consist of the Kabat CDRs (see Figures 1-3), i.e., a CDR H1 sequence comprising donor amino acid residues corresponding to Kabat residues 31 -35, and a CDR H3 sequence comprising donor amino acid residues corresponding to Kabat residues 95-102.
- the humanized ACO-1 or ACO-2 antibody may comprise a CDR L1 comprising donor amino acid residues corresponding to Kabat residues 24-34 of the vari- able region of the ACO-1 light chain (VL), a CDR L2 comprising donor amino acid residues corresponding to Kabat residues 50-56 of the ACO-1 VL region, and a CDR L3 comprising donor amino acid residues corresponding to Kabat residues 89-97 of the ACO-1 VL region (SEQ ID NO:4) or ACO-2 VL region (SEQ ID NO:9).
- VL vari- able region of the ACO-1 light chain
- CDR L2 comprising donor amino acid residues corresponding to Kabat residues 50-56 of the ACO-1 VL region
- a CDR L3 comprising donor amino acid residues corresponding to Kabat residues 89-97 of the ACO-1 VL region (SEQ ID NO:4) or ACO-2 VL region (SEQ ID NO:9).
- the antibody may comprise CDR L1 donor amino acid residues consisting of Kabat residues 24-34, CDR L2 donor residues consisting of Kabat residues 50-56, and CDR L3 donor amino acid residues consisting of Kabat residues 89-97.
- the corresponding amino acid sequences are shown in Table 3.
- the invention provides specific humanized ACO-1 antibodies.
- the humanized ACO-1 antibody specifically binds human IFN- ⁇ , and comprises VH CDR se- quences substantially identical to the sequences of Kabat residues 31-35, 50-65, and 95-102 of SEQ ID NO:3, with an optional N31 S mutation.
- the antibody may, e.g., comprise a CDR H1 sequence comprising SEQ ID NO:15; a CDR H2 sequence comprising SEQ ID NO:21 ; and a CDR H3 sequence comprising SEQ ID NO:17.
- the antibody may comprise a CDR H1 sequence consisting of SEQ ID NO:15; a CDR H2 sequence consisting of SEQ ID NO:21 ; and a CDR H3 sequence consisting of SEQ ID NO:17.
- the humanized ACO-1 comprises VH framework residues derived from a human VH1_46 gene and/or a human JH4 gene, preferably both.
- the humanized antibody comprises a VH sequence corresponding to SEQ ID NO:3.
- the humanized ACO-1 antibody may further comprise VL CDR sequences substan- tially identical to the sequences of Kabat residues 24-34, 50-56, and 89-97 of SEQ ID NO:6.
- the antibody may, e.g., comprise a CDRJ.1 sequence comprising SEQ ID NO:18; a CDR_L2 sequence comprising SEQ ID NO:19; and a CDR_L3 sequence comprising SEQ ID NO:20.
- the may comprise a CDRJ.1 sequence consisting of SEQ ID NO:18; a CDRJ.2 sequence consisting of SEQ ID NO:19; and a CDR_L3 sequence consisting of SEQ ID NO:20.
- the humanized ACO-1 antibody comprises VL framework residues derived from a human VKIII_L6 gene and/or a human JK2 gene, preferably both.
- the humanized antibody comprises a VL sequence corresponding to SEQ ID NO:6.
- the invention provides an antibody comprising the CDR sequences of ACO-2.
- the antibody can specifically bind human IFN- ⁇ and comprises VH CDR sequences substantially identical to the sequences of Kabat residues 31 -35, 50-59, and 95-102 of SEQ ID NO:7.
- the antibody comprises a CDR_H1 sequence comprising SEQ ID NO:22; a CDRJH2 sequence comprising SEQ ID NO:23; and a CDRJH3 sequence comprising SEQ ID NO:17.
- the antibody comprises a CDR_H1 sequence consisting of SEQ ID NO:22; a CDRJH2 sequence consisting of SEQ ID NO:23; and a CDR_H3 sequence consisting of SEQ ID NO:17.
- the antibody may further comprise VL CDR sequences substantially identical to the sequences of residues Kabat residues 24-34, 50-56, and 89-97 of SEQ ID NO:9.
- the antibody comprises a CDR_L1 sequence comprising SEQ ID NO:24; a CDRJ.2 sequence comprising SEQ ID NO:25; and a CDR_L3 sequence comprising SEQ ID NO:20.
- the antibody comprises a CDR_L1 sequence consisting of SEQ ID NO:24; a CDRJ.2 sequence consisting of SEQ ID NO:25; and a CDR_L3 sequence consisting of SEQ ID NO:20.
- the antibody may, in one aspect, be a humanized ACO-2 antibody.
- a humanized ACO-1 or ACO-2 antibody may further comprise at least a portion of a human Fc-region (unless the antibody is an antigen-binding fragment not comprising any Fc- portion).
- the size of the Fc-region is selected to achieve the desired pharmacokinetic properties of the antibody; the larger Fc-portion, the slower clearance.
- the humanized antibody is a full-length antibody, preferably comprising an lgG4 iso- type Fc-region.
- the lgG4 Fc-region comprises an S241 P muta- tion, with numbering according to Kabat; corresponding to residue 228 per the EU numbering system (Edelman G.M. et AL., Proc. Natl. Acad. USA 63, 78-85 (1969)).
- the humanized VH and VL sequences can be "mixed and matched" to create other anti-IFN- ⁇ binding molecules of the invention.
- IFN- ⁇ binding of such "mixed and matched" antibodies can be tested using the binding assays described herein (e.g. flow cytometry, Biacore, ELISAs) and/or using one or more functional assays as described herein.
- a VH sequence from a particular VH/VL pairing is replaced with a structurally similar VH sequence.
- the invention provides an humanized monoclonal antibody, or antigen binding portion thereof, comprising: (a) a VH region comprising ACO-1 or ACO-2 VH CDRs and (b) a VL region comprising ACO-1 or ACO-2 VL CDRs; wherein the antibody specifically binds IFN- ⁇ .
- Preferred heavy and light chain combinations include: (a) a VH region comprising SEQ ID NOS:15-17, optionally omitting some or all of the 5 C- terminal amino acids of SEQ ID NO:16, and (b) a light chain variable region comprising SEQ ID NOS:18-20; (a) a VH region comprising SEQ ID NOS:15-17, optionally omitting some or all of the 5 C-terminal amino acids of SEQ ID NO:16, and (b) a light chain variable region comprising SEQ ID NOS:24, 25, and 20; (a) a VH region comprising SEQ ID NOS:22, 23, and 17, optionally omitting some or all of the 5 C-terminal amino acids of SEQ ID NO:23, and (b) a light chain variable region comprising SEQ ID NOS: 18-20; and (a) a VH region comprising SEQ ID NOS:22, 23, and 17, optionally omitting some or al of the 5 C-terminal amino acids of SEQ
- VH region comprising the sequence of SEQ ID NO:3 and (b) a VL region comprising the amino acid sequence of SEQ ID NO:4; (a) a VH comprising SEQ ID NOS:15, 21 , and 17, and (b) a VL comprising SEQ ID NOS: 18-20; and (a) a VH comprising SEQ ID NOS:15, 21 , and 17, and (b) a VL comprising SEQ ID NOS:24, 25, and 20.
- the invention provides antibodies that comprise the heavy chain and light chain CDRIs, CDR2s and/or CDR3s of ACO-1 or ACO-2, or combinations thereof. Given that each of these antibodies can bind to IFN- ⁇ and that antigen-binding specificity is provided primarily by the CDR1 , 2 and 3 regions, the CDR H1 , H2 and H3 sequences and CDR L1 , L2 and L3 sequences can be "mixed and matched" (i.e., CDRs from different antibodies can be mixed and match, although each antibody can contain a CDR H1 , H2 and H3 and a CDR L1 , L2 and L3) to create other anti-IFN- ⁇ binding molecules of the invention.
- IFN- ⁇ -binding of such "mixed and matched" antibodies can be tested using the binding assays described below and in the Examples (e.g. flow cytometry, Biacore, or ELISAs).
- the CDR H1 , H2 and/or H3 sequence from a particular VH sequence is replaced with a structurally similar CDR sequence(s).
- the CDR L1 , L2 and/or L3 se- quence from a particular VL sequence preferably is replaced with a structurally similar CDR sequence(s).
- the CDRs of ACO-1 and ACO-2 share substantial structural similarity and therefore are amenable to mixing and matching.
- the invention provides a humanized monoclonal antibody, or antigen binding portion thereof comprising: (a) a CDR H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 15 and 22; (b) a CDR H2 comprising an amino acid sequence selected from the group consisting of at least residues 1-12 of SEQ ID NOS:16 and 23, (c) a CDR H3 comprising SEQ ID NO:17; (d) a CDR L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 18 and 24; (e) a CDR L2 comprising an amino acid sequence selected from the group consist- ing of SEQ ID NOS:19 and 25; and (f) a CDR L3 comprising SEQ ID NO:20; wherein the antibody specifically binds IFN- ⁇ .
- the antibody comprises: (a) a CDR H1 comprising SEQ ID NO: 15; (b) a CDR H2 comprising at least residues 1-12 of SEQ ID NO:16; (c) a CDR H3 comprising SEQ ID NO:17; (d) a CDR L1 comprising SEQ ID NO:18; (e) a CDR L2 comprising SEQ ID NO:19; and (f) a CDR L3 comprising SEQ ID NO:20.
- the antibody comprises: (a) a CDR H1 comprising SEQ ID NO: 22; (b) a CDR H2 comprising at least residues 1-12 of SEQ ID NO:23; (c) a CDR H3 comprising SEQ ID NO:17; (d) a CDR L1 comprising SEQ ID NO:24; (e) a CDR L2 comprising SEQ ID NO:25; and (f) a CDR L3 comprising SEQ ID NO:20.
- the antibody comprises: (a) a CDR H1 comprising SEQ ID NO: 15; (b) a CDR H2 comprising SEQ ID NO:21 ; (c) a CDR H3 comprising SEQ ID NO:17; (d) a CDR L1 comprising SEQ ID NO:18; (e) a CDR L2 comprising SEQ ID NO:19; and (f) a CDR L3 comprising SEQ ID NO:20.
- the antibody comprises: (a) a CDR H1 comprising SEQ ID NO: 15; (b) a CDR H2 comprising SEQ ID NO:21 ; (c) a CDR H3 comprising SEQ ID NO:17; (d) a CDR L1 comprising SEQ ID NO:18; (e) a CDR L2 comprising SEQ ID NO:19; and (f) a CDR L3 comprising SEQ ID NO:20.
- the antibody comprises: (a) a CDR H1 comprising SEQ ID NO: 15
- the antibody comprises: (a) a CDR H1 comprising SEQ ID NO: 15; (b) a CDR H2 comprising at least residues 1-12 of SEQ ID NO:16; (c) a CDR H3 comprising SEQ ID NO:17; (d) a CDR L1 comprising SEQ ID NO:24; (e) a CDR L2 comprising SEQ ID NO:19; and (f) a CDR L3 comprising SEQ ID NO:20.
- the antibody comprises: (a) a CDR H1 comprising SEQ ID NO: 15; (b) a CDR H2 comprising at least residues 1-12 of SEQ ID NO:16; (c) a CDR H3 comprising SEQ ID NO:17; (d) a CDR L1 comprising SEQ ID NO:18; (e) a CDR L2 comprising SEQ ID NO:25; and (f) a CDR L3 comprising SEQ ID NO:20.
- antibody variants or derivatives can retain one, some, most, or all of the functional properties of the patent anti-IFN- ⁇ antibody, including, but not limited to: (a) bind specifically to IFN- ⁇ subtypes A, 2, B2, C, F, G, H2, I, J1 , K, 4a, 4b, and WA; (b) selectively neutralize one or more bioactivities of IFN- ⁇ protein subtypes A, 2, B2, C, F, G, H2, I, J1 , K, 4a, 4b, or WA; any combination thereof, or all thereof; (c) do not significantly neutralize a bioactivity of IFN- ⁇ 1 or D; (d) compete with and/or bind to the same epi- tope on an IFN- ⁇ protein subtype as ACO-1 and/or ACO-2; (e) compete more with ACO-1 or ACO-2 than with any of 9F3, 13H5, 13H7, and 7H9; (f) bind specifically to IFN- ⁇ subtypes A, 2, B2, C, F
- a humanized antibody of the invention comprises a VH region comprising CDR H1-H3 sequences and a VL region comprising CDR L1 -L3 sequences, wherein one or more of these CDR sequences comprise specified amino acid sequences based on the preferred antibodies described herein; ACO-1 and ACO-2, or conservative modifications thereof, and wherein the antibodies have retained or improved the desired functional properties of the anti-IFN- ⁇ antibodies of the invention.
- the invention provides an isolated monoclonal antibody, or antigen-binding fragment thereof, comprising a heavy chain variable region comprising CDR H1 , CDR H2, and CDR H3 sequences and a light chain variable region comprising CDR H1 , CDR H2, and CDR H3 sequences, wherein: (a) a CDR H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 15 and 22, and conservative modifications thereof; (b) a CDR H2 comprising an amino acid sequence selected from the group consisting of at least residues 1 -12 of SEQ ID NOS: 16 and 23, and conservative modifications thereof, (c) a CDR H3 comprising SEQ ID NO: 17, and conservative modifications thereof; (d) a CDR L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 18 and 24, and conservative modifications thereof; (e) a CDR L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 19 and 25, and conservative modifications thereof; and
- one or more amino acid residues within the CDR or FR regions of an antibody of the invention can be replaced with other amino acid residues from the same side chain family and the altered antibody can be tested for retained function (i.e., the functions set forth in (c), (d) and (e) above) using the functional assays described herein.
- the functional properties of the antibody variants can be assessed using standard assays available in the art and/or described herein.
- the ability of the antibody to bind IFN- ⁇ can be determined using standard binding and biological effects (e.g. reporter gene) assays, such as those set forth in the Examples (e.g., Biacore, or ELISAs).
- the invention provides a humanized ACO-1 or ACO-2 antibody with mutations in the CDR or framework regions.
- Examples 2 and 3 Specific exemplary mutations in humanized ACO-1 and their identification are de- scribed in Examples 2 and 3 (see, also Figures 1 and 3). These include both back- mutations; introducing ACO-1 residues into humanized ACO-1 , as well as mutations where ACO-2-derived residues are introduced into humanized ACO-1.
- Exemplary back-mutations in the hzACO-1 VH include V5Q, M69L, R71V, T73K, S76I, and V78A, as well as any combination thereof, using Kabat numbering.
- Exemplary back-mutations in the hzACO-1 VL SEQ ID NO:6) include E1Q, L47W, I58V, and F71 Y, as well as any combination thereof.
- Exemplary ACO-2-derived mutations in the hzACO-1 VH include T28S, N31 S, I58S, S76N, T77I, and A93V, as well as any combination thereof.
- Exemplary ACO-2 derived mutations in the hzACO-1 VL include D29G, L33F, and S50G, as well as any combination thereof.
- various hzACO-1 VH and VL variant sequences can be "mixed and matched" with variant sequences or parent sequences to create a library of hzACO-1 variants of the invention.
- the invention provides a humanized antibody that specifically binds human IFN- ⁇ and contains a variable domain having, incorporated into a human antibody variable domain, amino acids from a donor non-human antibody that binds human IFN- ⁇ , comprising a donor antibody amino acid residue at one or more sites selected from 5, 28, 31 , 58, 69, 71 , 73, 76, 78, 79, and 93 in the heavy chain variable domain.
- the invention provides a humanized antibody that specifically binds human IFN- ⁇ and contains a variable domain having, incorporated into a human antibody variable domain, amino acids from a donor non-human antibody that binds human IFN- ⁇ , comprising a donor antibody amino acid residue at one or more sites selected from 1 , 29, 33, 47, 50, 58, and 71 in the light chain variable domain.
- the invention provides a humanized ACO-1 antibody that specifically binds human IFN- ⁇ and contains a variable domain having, incorporated into a human antibody variable domain, CDR sequences from ACO-1 that bind human IFN- ⁇ , and further comprising ACO-2 amino acid residues at one or more sites selected from 28, 31 , 58, 76, 77, 78, 79, and 93 in the heavy chain variable domain.
- the ACO-2 amino acid residues are at one or more sites selected from 28, 31 , and 93.
- the invention provides a humanized ACO-1 antibody that specifically binds human IFN- ⁇ and contains a variable domain having, incorporated into a human antibody variable domain, CDR sequences from ACO-1 that bind human IFN- ⁇ , and further comprising ACO-2 amino acid residues at one or more sites selected from 29, 33, and 50 in the light chain variable domain.
- the invention provides a hzACO-1 variant that specifically binds human IFN- ⁇ , and comprises VH CDR sequences substantially identical to the sequences of Kabat residues 31 -35, 50-65, and 95-102 of SEQ ID NO:3, with an N31 S mutation.
- the antibody may, e.g., comprise a CDR H1 sequence comprising SEQ ID NO:15 with an N31 S mutation; a CDR H2 sequence comprising SEQ ID NO:21 ; and a CDR H3 sequence comprising SEQ ID NO:17.
- the antibody may comprise a CDR H1 sequence consisting of SEQ ID NO:15 with an N31S mutation; a CDR H2 sequence consisting of SEQ ID NO:21 ; and a CDR H3 sequence consisting of SEQ ID NO:17.
- the humanized ACO-1 comprises VH framework residues derived from a human VH1_46 gene and/or a human JH4 gene, preferably both.
- the humanized antibody comprises a VH sequence corresponding to SEQ ID NO:3, with an N to S mutation at Kabat position 31.
- an N31S mutation in hzACO-1 increased the binding affinity to IFN- ⁇ A to levels comparable to that of ACO-1 , and increased the stability at pH3.5 and 4.5. Moreover, since residue 31 is in a "donor" CDR residue, the mutation does not introduce a further murine residue into the hzACO-1 sequence, thus not increasing the risk for an immune response against the antibody when administered to a human.
- Other CDR mutations with the same advantage include D29G and S50G in the hzACO-1 VL.
- the invention provides a hzACO-1 variant that specifically binds human IFN- ⁇ , and comprises VH CDR sequences substantially identical to the sequences of Kabat residues 31 -35, 50-65, and 95-102 of SEQ ID NO:3, with a T28S mutation.
- the antibody may, e.g., comprise a CDR H1 sequence comprising SEQ ID NO:15; a CDR H2 sequence comprising SEQ ID NO:21 ; and a CDR H3 sequence comprising SEQ ID NO:17.
- the antibody may comprise a CDR H1 sequence consisting of SEQ ID NO:15; a CDR H2 sequence consisting of SEQ ID NO:21 ; and a CDR H3 sequence consisting of SEQ ID NO:17.
- the humanized ACO-1 comprises VH framework residues derived from a human VH1_46 gene, further comprising a T28S mutation.
- the humanized antibody comprises a VH sequence corresponding to SEQ ID NO:3, with an T to S mutation at Kabat position 28. As shown in the Examples, a T28S mutation in hzACO-1 increased the binding affinity to IFN- ⁇ A to levels comparable to that of ACO-1 , and increased stability at pH3.5 and 4.5.
- the invention provides a hzACO-1 variant that specifically binds human IFN- ⁇ , and comprises VH CDR sequences substantially identical to the sequences of Kabat residues 31 -35, 50-65, and 95-102 of SEQ ID NO:3, with an A93V mutation.
- the antibody may, e.g., comprise a CDR H1 sequence comprising SEQ ID NO:15; a CDR H2 sequence comprising SEQ ID NO:21 ; and a CDR H3 sequence comprising SEQ ID NO:17.
- the antibody may comprise a CDR H1 sequence consisting of SEQ ID NO:15; a CDR H2 sequence consisting of SEQ ID NO:21 ; and a CDR H3 sequence consisting of SEQ ID NO:17.
- the humanized ACO-1 comprises VH framework residues derived from a human VH1_46 gene and a human JH4 gene, further comprising an A93V mutation.
- the humanized antibody comprises a VH sequence corresponding to SEQ ID NO:3, with an A to V mutation at Kabat position 93.
- an A93V mutation in hzACO-1 increased the binding affinity to IFN- ⁇ A to levels comparable to that of ACO-1 , increased the potency for inhibition of IFN- effects as measured in the RG assay, and increased stability at pH3.5 and 4.5.
- the invention provides a hzACO-1 variant that specifically binds human IFN- ⁇ , and comprises VH CDR sequences substantially identical to the sequences of Kabat residues 31 -35, 50-65, and 95-102 of SEQ ID NO:3, further comprising a mutation in one of the VH CDR sequences, wherein the mutation is not in Kabat residue 58.
- the antibody may, e.g., comprise VH CDRs consisting of Kabat residues 31-35, 50-65, and 95-102 of SEQ I D NO:3, further comprising a mutation in one of the VH CDR sequences, wherein Kabat residue 58 is I.
- the humanized ACO-1 comprises VH framework residues derived from a human VH1_46 gene and a human JH4 gene. As shown in the Ex- amples, an I58S mutation in hzACO-1 substantially decreased the binding affinity to IFN- ⁇ A and decreased the potency for inhibition of IFN- effects as measured in the RG assay.
- Another type of framework modification involves mutating one or more residues within the framework region, or even within one or more CDR regions, to remove T cell epitopes to thereby reduce the potential immunogenicity of the antibody. This approach is also referred to as "deimmunization" and is described in futher detail in U.S. Patent Publication No. 20030153043 by Carr et a/.
- antibodies of the invention may be engineered to include modifications within the Fc region, typically to alter one or more functional properties of the antibody, such as serum half-life, complement fixation, Fc receptor binding, protein stability and/or antigen-dependent cellular cytotoxicity, or lack thereof.
- an antibody of the invention may be chemically modified (e.g. , one or more chemical moieties can be attached to the antibody) or be modified to alter its glycosylation, again to alter one or more functional properties of the anti- body.
- the class of an antibody may be "switched" by known techniques. Such techniques include, e.g., the use of direct recombinant techniques (see e.g., US Patent 4,816,397) and cell-cell fusion techniques (see e.g., US Patent 5,916,771).
- an antibody that was originally produced as an IgM molecule may be class switched to an IgG antibody.
- Class switching techniques also may be used to convert one IgG subclass to another, e.g., from IgGI to lgG2.
- the effector function of the antibodies of the invention may be changed by isotype switching to, e.g.
- an IgGI , lgG2, lgG3, lgG4, IgD, IgA, IgE, or IgM antibody for various therapeutic uses.
- Exemplary cDNA sequences for constant regions are available via, e.g. , GenBank, each of which incorporated by reference in its entirety, are as follows:
- Human IgGI constant heavy chain region GenBank accession No.: J00228;
- Human lgG2 constant heavy chain region GenBank accession No.: J00230;
- Human lgG3 constant heavy chain region GenBank accession No.: X04646; Human lgG4 constant heavy chain region: GenBank accession No.: K01316; and
- the hinge region of CH1 is modified such that the number of cysteine residues in the hinge region is altered, e.g., increased or decreased.
- This approach is described further in U.S. Patent No. 5,677,425 by Bodmer et al.
- the number of cysteine residues in the hinge region of CH 1 is altered to, for example, facilitate assembly of the light and heavy chains or to increase or decrease the stability of the antibody.
- the Fc hinge region of an antibody is mutated to decrease the biological half life of the antibody. More specifically, one or more amino acid mutations are introduced into the CH2-CH3 domain interface region of the Fc-hinge fragment such that the antibody has impaired Staphylococcyl protein A (SpA) binding relative to native Fc-hinge domain SpA binding.
- SpA Staphylococcyl protein A
- the antibody is modified to increase its biological half life.
- one or more of the following mutations can be introduced: T252L, T254S, T256F, as described in U.S. Patent No. 6,277,375 to Ward.
- the antibody can be al- tered within the CH 1 or CL region to contain a salvage receptor binding epitope taken from two loops of a CH2 domain of an Fc region of an IgG, as described in U.S. Patent Nos. 5,869, 046 and 6,121 ,022 by Presta et al.
- the Fc region is altered by replacing at least one amino acid residue with a different amino acid residue to alter the effecter function(s) of the antibody.
- one or more amino acids selected from amino acid residues 234, 235, 236, 237, 297, 318, 320 and 322 can be replaced with a different amino acid residue such that the antibody has an altered affinity for an effector ligand but retains the antigen-binding ability of the parent antibody.
- the effector ligand to which affinity is altered can be, for example, an Fc receptor or the C1 component of complement. This approach is described in further detail in U.S. Patent Nos. 5,624, 821 and 5,648,260, both to Winter et al.
- one or more amino acids selected from amino acid residues 329, 331 and 322 can be replaced with a different amino acid residue such that the antibody has altered C1q binding and/or reduced or abolished complement dependent cytotoxicity (CDC).
- CDC complement dependent cytotoxicity
- the Fc region is modified to increase the ability of the antibody to mediate antibody dependent cellular cytotoxicity (ADCC) and/or to increase the affinity of the antibody for an Fey receptor by modifying one or more amino acids at the following positions: 238, 239, 248, 249, 252, 254, 255, 256, 258, 265, 267, 268, 269, 270, 272, 276, 278, 280, 283, 285, 286, 289, 290, 292, 293, 294, 295, 296, 298, 301 , 303, 305, 307, 309, 312, 315, 320, 322, 324, 326, 327, 329, 330, 331 , 333, 334, 335, 337, 338, 340, 360, 373, 376, 378, 382, 388, 389, 398, 414, 416, 419, 430, 434, 435, 437, 438 or 439.
- ADCC antibody dependent cellular cytotoxicity
- the constant region may further be modified to stabilize the antibody, e.g., to reduce the risk of a bivalent antibody separating into two monovalent VH-VL fragments.
- residue S241 may be mutated to a proline (P) residue to allow complete disulphide bridge formation at the hinge (see, e.g., Angal et al., MoI Immunol. 1993;30:105-8).
- P proline
- the glycosylation of an antibody is modified.
- an aglycoslated antibody can be made (i.e., the antibody lacks glycosylation).
- Glycosylation can be altered to, for example, increase the affinity of the antibody for antigen.
- car- bohydrate modifications can be accomplished by, for example, altering one or more sites of glycosylation within the antibody sequence.
- the anti-IFN- ⁇ antibodies of the invention may be prepared as full-length antibodies or antigen-binding fragments thereof.
- antigen-binding fragments include Fab, Fab', F(ab)2, F(ab')2, F(ab)3, Fv (typically the VL and VH domains of a single arm of an antibody), single-chain Fv (scFv; see e.g., Bird et al., Science 1988;242:423-426; and Huston et al.
- dsFv, Fd typically the VH and CH 1 domain
- dAb typically a VH domain
- VH, VL, VhH, and V-NAR domains monovalent molecules comprising a single VH and a single VL chain
- minibodies, diabodies, triabodies, tetrabodies, and kappa bodies see, e.g., Ill et al., Protein Eng 1997; 10:949-57
- Antibody fragments can be obtained using conventional recombinant or protein engineering techniques, and the fragments can be screened for antigen-binding or other function in the same manner as are intact antibodies.
- F(ab')2 fragments can be isolated directly from recombinant host cell culture.
- the antibody of choice is a single-chain Fv fragment (scFv). See WO 1993/16185; U.S. Pat. No. 5,571 ,894; and U.S. Pat. No. 5,587,458.
- the antibody fragment may also be a "linear antibody", e.g., as described in U.S. Pat. No. 5,641 ,870, for example. Such linear antibody fragments may be monospecific or bispecific.
- the present invention features multispecific molecules comprising an anti-IFN- ⁇ antibody, or an antigen-fragment thereof, of the invention.
- multispecific molecules include bispecific molecules comprising at least one first binding specificity for IFN- ⁇ and a second binding specificity for a second target epitope.
- bispecific antibodies are antibodies that have binding specificities for at least two different epitopes. Methods for mak- ing bispecific antibodies are known in the art, and traditional production of full-length bispecific antibodies is usually based on the coexpression of two immunoglobulin heavy-chain-light- chain pairs, where the two chains have different specificities (Millstein et al. , Nature, 305: 537-539 (1983)). Bispecific antibodies can be prepared as full-length antibodies or antibody fragments (e.g. F(ab')2 bispecific antibodies) or any other antigen-binding fragments de- scribed herein.
- multispecific molecules include those produced from the fusion of a IFN- ⁇ - binding antibody moiety to one or more other non-antibody proteins.
- Such multispecific proteins and how to construct them have been described in the art. See, e.g., Dreier et al. (Bio- conjug. Chem. 9(4): 482-489 (1998)); U.S. Patent 6,046,310; U.S. Patent Publication No. 20030103984; European Patent Application 1 413 316; US Patent Publication No.
- Multispecific molecules with more than two valencies are also contemplated.
- trispecific antibodies can be prepared. Tutt et al., J. Immunol, 147: 60 (1991).
- the multispecific molecules of the present invention can be prepared by conjugating the constituent binding specificities using methods known in the art. For example, each binding specificity of the multispecific molecule can be generated separately and then conjugated to one another. When the binding specificities are proteins or peptides, a variety of coupling or cross-linking agents can be used for covalent conjugation.
- cross-linking agents examples include protein A, carbodiimide, N-succinimidyl-S-acetyl-thioacetate (SATA), 5,5'- dithiobis(2-nitrobenzoic acid) (DTNB), o-phenylenedimaleimide (oPDM), N-succinimidyl-3-(2- pyridyldithio)propionate (SPDP), and sulfosuccinimidyl 4-(N-maleimidomethyl) cyclohaxane- 1-carboxylate (sulfo-SMCC) (see e.g., Karpovsky et al. (1984) J. Exp. Med.
- conjugating agents are SATA and sulfo-SMCC, both available from Pierce Chemical Co. (Rockford, IL).
- binding specificities are antibodies, they can be conjugated via sulthydryl bonding of the C-terminus hinge regions of the two heavy chains.
- the hinge region is modified to contain an odd number of sulfhydryl residues, preferably one, prior to conjugation.
- both binding specificities can be encoded in the same vector and expressed and assembled in the same host cell.
- This method is particularly useful where the bispecific molecule is a mAb x mAb, mAb x Fab, Fab x F(ab')2 or ligand x Fab fusion protein.
- a bispecific molecule of the invention can be a single chain molecule comprising one single chain antibody and a binding determinant, or a single chain bispecific molecule comprising two binding determinants. Bispecific molecules may comprise at least two single chain molecules. Methods for preparing bispecific molecules are described or reviewed in, for example in U.S. Patent Number 5,260,203; U.S. Patent Number 5,455,030; U.S.
- Antibody derivatives within the scope of this invention include anti-IFN- ⁇ antibodies conjugated or covalently bound to a second agent.
- the invention provides immunoconjugates comprising an antibody conjugated or covalently bonded to a cytotoxic agent, which cytotoxic agent can be selected from therapeutic radioisotopes, toxic proteins, toxic small molecules, such as drugs, toxins, immunomodulators, hormones, hormone antagonists, enzymes, oligonucleotides, enzyme inhibitors, therapeutic radionuclides, angiogenesis inhibitors, chemotherapeu- tic drugs, vinca alkaloids, anthracyclines, epidophyllotoxins, taxanes, antimetabolites, alkylat- ing agents, antibiotics, COX-2 inhibitors, SN-38, antimitotics, antiangiogenic and apoptotoic agents, particularly doxorubicin, methotrexate, taxol, CPT-11 , camptothecans, nitrogen mustards, gemcitabine, alkyl sulfonates, nitrosoureas, triazenes, folic acid analogs,
- a toxin can be of animal, plant, fungal, or microbial origin, or can be created de novo by chemical synthesis.
- the antibody is derivatized with a radioactive isotope, such as a therapeutic radionuclide or a radionuclide suitable for detection purposes.
- a radioactive isotope such as a therapeutic radionuclide or a radionuclide suitable for detection purposes.
- Any of a number of suitable radioactive isotopes can be used, including, but not limited to, 1-131 , In- dium-11 1 , Lutetium-171 , Bismuth-212, Bismuth-213, Astatine-211 , Copper-62, Copper-64, Copper-67, Yttrium-90, lodine-125, lodine-131 , Phosphorus-32, Phosphorus-33, Scandium- 47, Silver-1 11 , Gallium-67, Praseodymium-142, Samarium-153, Terbium-161 , Dysprosium- 166, Holmium-166, Rhenium-186, Rhenium-188, Rhenium-189
- the radionuclide preferably has a decay energy in the range of 20 to 6,000 keV, preferably in the ranges 60 to 200 keV for an Auger emitter, 100- 2,500 keV for a beta emitter, and 4,000-6,000 keV for an alpha emitter. Also preferred are radionuclides that substantially decay with generation of alpha-particles.
- the antibody conjugates of the invention can be used to modify a given biological response, where the drug moiety is not to be construed as limited to classical chemical therapeutic agents.
- the drug moiety may be a protein or polypeptide possessing a desired biological activity.
- proteins may include, for example, an enzymatically active toxin, or active fragment thereof, such as abrin, ricin A, pseudomonas exotoxin, or diphtheria toxin; a protein such as tumor necrosis factor or interferon-y; or, biological response modifiers such as, for example, lymphokines, interleukin-l (“IL-1"), interleukin-2 (“IL- 2"), interleukin-6 (“IL-6”), granulocyte macrophage colony stimulating factor (“GM-CSF”), granulocyte colony stimulating factor (“G-CSF”), or other growth factors.
- IL-1 interleukin-l
- IL-2 interleukin-2
- IL-6 interleukin-6
- the second agent can be linked to the antibody directly or indirectly, using any of a large number of available methods.
- an agent can be attached at the hinge region of the reduced antibody component via disulfide bond formation, using cross-linkers such as N-succinyl 3-(2-pyridyldithio)proprionate (SPDP), or via a carbohydrate moiety in the Fc region of the antibody (see, e.g., Yu et al. (1994) Int. J. Cancer 56: 244; Wong, Chemistry of Protein Conjugation and Cross-linking (CRC Press 1991); Upeslacis et al., "Modification of Antibodies by Chemical Methods," in Monoclonal antibodies: principles and applications, Birch et al.
- the second agent is a detectable moiety, which can be any molecule that can be quantitatively or qualitatively observed or measured.
- detectable markers useful in the conjugated antibodies of this invention are radioisotopes, fluorescent dyes, or a member of a complementary binding pair, such as a member of any one of: and antigen/antibody (other than an antibody to IFN- ⁇ ), lectin/carbohydrate; avidin/biotin; receptor/ligand; or molecularly imprinted polymer/print molecule systems.
- the second agent may also or alternatively be a polymer, intended to, e.g., increase the circulating half-life of the antibody.
- exemplary polymers and methods to attach such polymers to peptides are illustrated in, e.g. , U.S. Pat. Nos. 4,766, 106; 4,179,337; 4,495,285; and 4,609,546.
- Additional illustrative polymers include polyoxyethylated polyols and polyeth- ylene glycol (PEG) moieties.
- polyethylene glycol is intended to encompass any of the forms of PEG that have been used to derivatize other proteins, such as mono (C1-C10) alkoxy-or aryloxy-polyethylene glycol or polyethylene glycol-maleimide.
- a full-length antibody or antibody fragment can be conjugated to one or more PEG molecules with a molecular weight of between about 1 ,000 and about 40,000, such as between about 2000 and about 20,000, e.g., about 3,000-12,000.
- the antibody or fragment typically is reacted with polyethylene glycol (PEG), such as a reactive ester or aldehyde derivative of PEG, under conditions in which one or more PEG groups become attached to the antibody or antibody fragment.
- PEG polyethylene glycol
- the pegylation is carried out via an acylation reaction or an alkylation reaction with a reactive PEG molecule (or an analogous reactive water-soluble polymer).
- the antibody to be pegylated is an aglycosylated antibody.
- Methods for pegylating proteins are known in the art and can be applied to the antibodies of the invention. See for example, EP 0 154 316 by Nishimura et al. and EP 0 401 384 by Ishikawa et al.
- Antibody characterization After production or purification, or as part of a screening or selection procedure, the functional characteristics of an anti-IFN- ⁇ antibody of the invention can be investigated.
- Binding Assays The present invention provides for antibodies, and antigen-binding fragments and immunoconjugates thereof, that bind IFN- ⁇ . Any of a wide variety of assays can be used to assess binding of an antibody to IFN- ⁇ . Protocols based upon ELISAs, radioimmunoassays, Western blotting, BIACORE, and competition assays, inter alia, are suitable for use and are well known in the art.
- simple binding assays can be used, in which a test antibody is incubated in the presence of a target protein or epitope (e.g., an IFN- ⁇ protein subtype selected from A, 2, B2, C, F, G, H2, I, J1 , K, 4a, 4b, WA, 1 and D, a portion thereof, or a combination of any thereof), unbound antibodies are washed off, and the presence of bound antibodies is assessed using, e.g., RIA, ELISA, etc.
- a target protein or epitope e.g., an IFN- ⁇ protein subtype selected from A, 2, B2, C, F, G, H2, I, J1 , K, 4a, 4b, WA, 1 and D, a portion thereof, or a combination of any thereof
- a target protein or epitope e.g., an IFN- ⁇ protein subtype selected from A, 2, B2, C, F, G, H2, I, J1 , K, 4a, 4b, WA, 1
- the ability of the test antibody to bind to human IFN- ⁇ can be compared with the ability of a (negative) control protein, e.g. an antibody raised against a structurally unrelated antigen, or a non-lg peptide or protein, to bind to the same target.
- a (negative) control protein e.g. an antibody raised against a structurally unrelated antigen, or a non-lg peptide or protein
- Antibod- ies or fragments that bind to IFN- ⁇ using any suitable assay with 25%, 50%, 100%, 200%, 1000%, or higher increased affinity capacity ?relative to the control protein, are said to "specifically bind to" or “specifically interact with” the target, and are preferred for use in the therapeutic methods described below.
- the ability of a test antibody to affect the binding of a (positive) control antibody against IFN- ⁇ e.g. a humanized ACO-1 or ACO-2 antibody, may also be assessed.
- the invention provides for humanized anti-IFN- ⁇ antibodies sharing biological characteristics and/or substantial VH and/or VL sequence identity with humanized ACO-1 or ACO-2 antibodies.
- One exemplary biological characteristic is the binding to the ACO-1 or ACO-2 epitope, i.e. , the respective regions in the extracellular domain of certain IFN- ⁇ protein subtypes to which the ACO-1 and ACO-2 antibodies bind.
- a routine cross-blocking assay such as that described in Antibodies, A Laboratory Manual, Cold Spring Harbor Laboratory, Ed Harlow and David Lane (1988), can be performed.
- ACO-1 or ACO-2 (control) antibody and a test antibody are admixed (or pre-adsorbed) and applied to a sample containing IFN- ⁇ .
- control antibodies are admixed with varying amounts of the test antibody ⁇ e.g., 1 : 10 or 1 : 100) for a period of time prior to applying to the IFN- ⁇ -containing sample.
- control and varying amounts of test an- tibody can simply be admixed during exposure to the antigen/target sample.
- the control antibody As long as one can distinguish bound from free antibodies (e.g., by using separation or washing techniques to eliminate unbound antibodies) and the control antibody from test antibody (e.g., by using species- or isotype-specific secondary antibodies, by specifically labeling the control antibody with a detectable label, or by using physical methods such as mass spectrometry to distin- guish between different compounds) one will be able to determine if the test antibody reduces the binding of the control antibody to the antigen, indicating that the test antibody recognizes substantially the same epitope as the control. In this assay, the binding of the (labeled) control antibody in the presence of a completely irrelevant antibody is the control high value. The control low value is be obtained by incubating the labeled (positive) control anti- body with unlabeled control antibody, where competition would occur and reduce binding of the labeled antibody.
- a significant reduction in labeled antibody reactivity in the presence of a test antibody is indicative of a test antibody that recognizes the same epitope, i.e., one that "cross-reacts" with the labeled control antibody.
- Any test antibody or compound that re- Jerusalem the binding of the labeled control to the antigen/target by at least 50% or more pref- erably 70%, at any ratio of control:test antibody or compound between about 1 :10 and about 1 : 100 is considered to be an antibody or compound that binds to substantially the same epitope or determinant as the control.
- such test antibody or compound will reduce the binding of the control to the antigen/target by at least 90%. Nevertheless, any compound or antibody that reduces the binding of a control antibody or compound to any measurable extent can be used in the present invention.
- APCs antigen presenting cells
- IFN- ⁇ which can activate DCs and the activated activity can blocked with humanized antibody preparations according to the invention. Methods to detect and quantitate this activity are described in the scientific and patent literature (see, e.g. , paragraphs 0136 through 0150 of patent publication number US20040067232A1 , relevant portions of which are hereby incorporated herein by reference).
- Activation of the MxA promoter The ability of IFN- ⁇ to activate the MxA promoter, and the ability of the anti-IFN- ⁇ monoclonal antibodies of the invention to block this activation can be measured using reporter gene (RG) assays where the MxA promoter is fused to a reporter gene, such as chloramphenicol acetyltransferase (CAT) or luciferase (luc), pref- erably luciferase. Assays for CAT and luciferase are known to those of skill in the art.
- the activity of the MxA promoter is measured in A549 cells stably transformed with an MxA promoter/reporter gene fusion construct.
- A549 cells are a lung carcinoma cell line available through the ATCC (product number CC1-185).
- the MxA (a.k.a. MxI) promoter can be human, mouse or rat.
- the sequence and structure of the human MxA promoter is disclosed in Genbank Accession number X55639, Chang et al. (1991) Arch Virol. 1 17:1 -15; and Ronni et al. (1998) J Interferon Cytokine Res. 18:773-781.
- Human MxA promoter/luciferase fusion constructs and luciferase assays are disclosed in patent publication US20040209800 and Rosmorduc et al. (1999) J of Gen Virol 80:1253-1262.
- MxA promoter/CAT fusion constructs and CAT assays Human MxA promoter/CAT fusion constructs and CAT assays are disclosed in Fernandez et al. (2003) J Gen Virol 84:2073- 2082 and Fray et al. (2001) J Immunol Methods 249:235-244.
- the mouse MxA (MxI) promoter is disclosed in Genbank accession number M21 104; Hug et al. (1988) MoI Cell Biol 8:3065-3079; and Lleonart et al. (1990) Biotechnology 8:1263-1267.
- a mouse MxA promoter/luciferase fusion construct and a luciferase assay are disclosed in Canosi et al. (1996) J Immunol Methods 199:69-67.
- Cytopathic effect inhibition (CPE) assays are based on the antiviral activity of interferon.
- a suitable cell line is infected with a virus in the presence of interferon, and the inhibitory activity of interferon is quantified on viral propagation or replica- tive processes.
- the readout of the assay may be based on reduction of virus yield, reduction of viral cytophatic effect, reduction of viral protein of RNA synthesis, reduction of viral plaque formation.
- the cytopathic assay may be used to determine the neutralizing effect of antibodies on the activity of interferon. Exemplary CPE assays are described in Meager, A. 1987. Quantification of interferons by anti-viral assays and their standardization.
- Another object of the present invention is to provide a pharmaceutical formulation comprising a [the protein] compound which is present in a concentration from 10-500 mg/ml, such as e.g. 20-300 mg/ml, preferably 30-100 mg/ml, and most preferably 50-100 mg/ml,. and wherein said formulation has a pH from 2.0 to 10.0.
- the formulation may further comprise a buffer system, preservative(s), tonicity agent(s), chelating agent(s), stabilizers and surfactants.
- the pharmaceutical formulation is an aque- ous formulation, i.e. formulation comprising water. Such formulation is typically a solution or a suspension.
- the pharmaceutical formulation is an aqueous solution.
- aqueous formulation is defined as a formulation comprising at least 50 %w/w water.
- aqueous solution is defined as a solution comprising at least 50 %w/w water, and the term “aqueous suspension” is defined as a suspension comprising at least 50 %w/w water.
- the pharmaceutical formulation is a freeze-dried formulation, whereto the physician or the patient adds solvents and/or diluents prior to use.
- the pharmaceutical formulation is a dried formulation (e.g. freeze-dried or spray-dried) ready for use without any prior dissolution.
- the IFN- ⁇ -antibodies of the invention also have non-therapeutic applications.
- anti-IFN- ⁇ antibodies may also be useful in diagnostic assays for IFN- ⁇ protein, e.g. detecting its expression in specific cells, tissues, or serum.
- anti-IFN- ⁇ an- tibodies could be used in assays selecting patients for anti-IFN- ⁇ treatment.
- the anti-IFN- ⁇ antibodies could be used for analyzing for the presence of IFN- ⁇ in serum or tissue specimens.
- the antibody typically will be labeled with a detectable moiety.
- the invention provides for the use of a humanized antibody as described herein in the preparation of a pharmaceutical composition for administration to a human patient.
- the patient suffers from, or is at risk for, an autoimmune or inflammatory disease or disorder associated with abnormal expression of at least one IFN- ⁇ subtype selected from the group consisting of subtypes A, 2, B2, C, F, G, H2, I, J1 , K, 4a, 4b, and WA.
- Exemplary conditions or disorders to be treated with the antibodies of the invention include, but are not limited to lupus (e.g., systemic lupus erythematosis (SLE)), rheumatoid arthritis, juvenile chronic arthritis, osteoarthritis, spondyloarthropathies, systemic sclerosis (scleroderma), idiopathic inflammatory myopathies (dermatomyositis, polymyositis), Sjogren's syndrome, vasculitis, systemic vasculitis, sarcoidosis, autoimmune hemolytic anemia (immune pancytopenia, paroxysmal nocturnal hemoglobinuria), autoimmune thrombocytopenia (idiopathic thrombocytopenic purpura, immune-mediated thrombocytopenia), thy- roiditis (Grave's disease, Hashimoto's thyroiditis, juvenile lymphocytic thyroiditis, atrophic thyroiditis), diabetes mellitus, immune
- the disease, condition or disorder is selected from lupus, Sjogren's syndrome, psoriasis, dia- betes mellitus, rheumatoid arthritis, and juvenile dermatomyotosis.
- the disease, condition, or disorder is SLE.
- the anti- IFN- ⁇ antibody is used in combination with one or more other anti-inflammatory agents, including, but not limited to, analgesic agents, immunosuppressive agents, corticosteroids, and anti-TNF ⁇ agents or other anti-cytokine or anti-cytokine receptor agents, and anti-angiogenic agents.
- analgesic agents include metothrexate, TSG-6, Rituxan®, and CTLA4-Fc fusion proteins. Further examples of combination therapies are provided below.
- an article of manufacture containing materi- als useful for the treatment of the disorders described above can comprise a container containing a humanized anti-IFN- ⁇ antibody as described herein together with instructions directing a user to treat a disorder such as an autoimmune or inflammatory disease or disorder in a human with the antibody in an effective amount.
- the article of manufacture typically comprises a container and a label or package insert on or associated with the container. Suitable containers include, for example, bottles, vials, syringes, etc.
- the containers may be formed from a variety of materials such as glass or plastic.
- the container holds a composition that is effective for treating the condition and may have a sterile access port (for example, the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle).
- At least one ac- tive agent in the composition is the humanized anti-IFN- ⁇ antibody herein, or an antigen- binding fragment or antibody derivative (e.g., an immunoconjugate) comprising such an antibody.
- the label or package insert indicates that the composition is used for treating the condition of choice, such as, e.g., SLE.
- the article of manufacture may comprise (a) a first container with a com- position contained therein, wherein the composition comprises the human or humanized antibody herein, and (b) a second container with a composition contained therein, wherein the composition comprises a therapeutic agent other than the human or humanized antibody.
- the article of manufacture in this embodiment of the invention may further comprise a package insert indicating that the first and second compositions can be used in combination to treat an autoimmune or inflammatory disease or disorder.
- Such therapeutic agents may be any of the adjunct therapies described in the preceding section..
- the article of manufacture may further comprise a second (or third) container comprising a pharmaceutically acceptable buffer, such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution. It may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, and syringes.
- BWFI bacteriostatic water for injection
- phosphate-buffered saline such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution.
- BWFI bacteriostatic water for injection
- phosphate-buffered saline such as phosphate-buffered saline, Ringer's solution and dextrose solution.
- dextrose solution such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution
- the present invention thus relates to a humanized antibody, or an antigen- binding fragment thereof, that specifically binds human interferon- ⁇ (IFN- ⁇ ), which humanized antibody is a humanized version of murine antibody ACO-1 or ACO-2, or of a combination thereof, comprising fewer donor amino acid residues than the murine complementary determining regions (CDRs) according to Kabat.
- IFN- ⁇ human interferon- ⁇
- the present invention thus relates to a humanized antibody that specifi- cally binds IFN- ⁇ , or an antigen-binding fragment thereof, wherein said antibody is capable of binding IFN- ⁇ subtypes A, 2, B2, C, F, G, H2, I, J1 , K, 4a, 4b and WA, but not subtypes 1 or D, and wherein said antibody comprises fewer donor amino acid residues than the non- human CDRs according to Kabat.
- the CDR H2 donor residues comprise Kabat residues 50- 59.
- said antibody competes with and/or binds to the same epitope on an IFN- ⁇ subtype as ACO-1 and/or ACO-2 antibody.
- the antibody is an lgG4 subtype.
- the antibody comprises a CDR H2 sequence according to SEQ ID NO: 21.
- the present invention relates to a method for producing an antibody accord- ing to the invention, wherein said method comprises incubating a host cell encoding said antibody under appropriate conditions and subsequently isolating said antibody.
- the invention furthermore relates to antibodies obtained by or obtainable by such methods.
- the present invention relates to a composition comprising an antibody according to the invention.
- the invention furthermore relates to a process for the preparation of a composition according to the invention, wherein said method comprises mixing antibody or a fragment thereof with excipients.
- the invention furthermore relates to compositions obtained by or obtainable by such methods.
- the present invention relates to a method of preventing, managing, treating or ameliorating an IFN- ⁇ related IFNIammatory disease or disorder, said method comprising administering to a subject in need thereof a prophylactiaclly or therapeutically effective amount of an antibody according to the invention.
- the present invention relates to use of an antibody according to the invention for preparation of a medicament suitable for treatment of an inflammatory disease.
- This example describes sequencing and recombinant expression of the murine antibodies ACO-1 and ACO-2, described in WO20060086586, as well as BLAST searches on the ACO-2 VH and VL sequences.
- the forward primer for both heavy and light chain was universal primer mix (UPM) that was included in the SMART RACE kit.
- the reverse primer sequence for ACO-1 heavy chain (HC) was designed as follows:
- the reverse primer sequence for ACO-2 heavy chain (HC) was designed as follows:
- the PCR reactions were carried out using Advantage HF PCR kit from Clonetech and the PCR program was run with a single denaturing step at 94 °C/2 min followed by 24 cycles as given: 94 °C/30 sec; 55 °C/30 sec; 72 °C/1.5 min. The final extension step was 72 °C/10 min.
- the PCR products were identified on a 1 % agarose gel containing ethidiumbro- mide.
- the PCR products were purified from the gel using GFX Purification kit from GE Healthcare followed by cloning into Zero Blunt TOPO PCR Cloning Kit (#K2875-40) and transformed into TOP10 E. coli cells from Invitrogen. DNA was extracted from E.
- coli colonies using the miniprep kit (#27106) from Qiagen. Plasmids were sequenced at MWG Biotech, Matinsried, Germany using the sequencing primers M13 rev (-29) and M13 uni (-21 ). HC and LC were verified from the identified sequences by using VectorNTI. All procedures based on kits were performed according to manufacturer directions.
- ACO-1 VH sequence (SEQ ID NO:13 (signal peptide included)): atgggatggagctatatcatgctctttttggtagcaacagctacagatgtccactcccaggtccaactgcagcagcctg gggctgaactggtgaagcctggggcttcagtgaagctgtcctgtaaggcttctggctacaccttcaccaactactggatgcactgg gtgaagcagaggcctggacaaggccttgagtggattggagagattaatcctagccacggtcgtactatctacaatgaaaacttca agagcaaggccacactgactgtagacaaatcctccatcacagccttcatgcaactcagcagcctgacatctgaggactctgcgg tattg
- ACO-1 VL sequence (SEQ ID NO:14 (signal peptide included)): atggattttcaagtgcagattttcagcttcctgctaatcagtgtctcagtcataatgtccagaggacaaattgttctcaccc agtctccagcaatcatgtctgcttctcctggggagaaggtcaccttgacctgcagtgccggctcaagtgtagattccagctattttgtac tggtaccagcagaagccaggatcctcccccaaactctggatttatagcacatccaacctggcttctggagtccctgcttcagt ggcagtgggtctgggacctcttactctctcacaatcagcatggaggctgaagatgctgccctgc
- ACO-1 VL (SEQ ID NO:4 (signal peptide excluded)) QIVLTQSPAIMSASPGEKVTLTCSAGSSVDSSYLYWYQQKPGSSPKLWIYSTSNLA
- ACO-2 VH sequence (SEQ ID 28 (signal peptide included)) atgggatggagctatatcatcctctttttggtagcagcagctacagatgtccactcccaggtccaactgcagcagcctg gggctgaactggtgaagcctggggctttcagtgaagctgtcctgcaaggcctctggctacagcttcaccagctactggatgcactg ggtgaagcagaggcctggacaaggccttgagtggattggagagattaatcctagccacggtcgtactagctacaatgagaactt caagagca
- ACO-2 VH sequence (SEQ ID NO:7 (signal peptide excluded):
- ACO-2 VL sequence (SEQ ID NO:9 (signal peptide excluded):
- CDR-H3 GGLGPAWFAY (SEQ ID NO:17)
- CDR-L1 SAGSSVGSSYFY (SEQ ID NO:24)
- CDR-L2 GTSNLAS (SEQ ID NO:25)
- the ACO-1 CDR sequences according to the Kabat definitions were found to be as follows.
- CDR-H2 EINPSHGRTIYNENFKS (SEQ ID NO:16)
- CDR-H3 GGLGPAWFAY (SEQ ID NO:17)
- CDR-L2 STSNLAS (SEQ ID NO:19)
- CDR-L3 HQWSSYPFT (SEQ ID NO:20) Identification of human qermline
- a 3D protein structure model was built using MOE (Molecular Operating Environment; available at www.chemcomp.com) with a structural template from the Protein Database Bank (PDB): 1Z3G.
- the PDB is described in Berman et al. (Nucl Acids Res 2000;28:235-242), and is available at www.rcsb.org/pdb.
- the most probable residues in the paratope were found to be residues 23-35, 49-58, 93-102 of the ACO-1 VH, and 24-34, 49-56, 89-97 of the ACO-1 VL.
- residues interacting hydrophobic, hydrogen binding, charge interaction
- VH VH1_46 (3e-038) VH1_f (6e-037), VH1_02 (6e-037), VH1_03 (1e-036), VH1_24 (2e-034), VL: VKIII_L6 (9e-035), VKIII_A1 1 (4e-034), VKIII_A27 (8e-034), VKIII_L25 (1e-033),
- VKI_L8 (1e-033).
- VH VH1_46 (3e-01 1) VH1_02 (6e-011), VH1_f (1 e-010), VH5_a (4e-010), VH1_03 (4e-010),
- VL VKIII_A11 (5e-009), VKIII_L6 (7e-009), VKIII_A27 (9e-009), VKIII_L25 (3e-008), VKIJ.9 (6e-008).
- VH1_46 and VKIII_L6 were selected as the human scaffolds.
- Other templates could be chosen to alter or optimize, e.g., the physical-chemical properties of the humanized antibody.
- JH4 and JK2 were selected as germline J-segments (SEQ ID NO:2 and 5, respectively).
- the CDRs of the optimal hzACO-1 antibody obtained were (according to the Kabat definitions):
- the optimized hzACO-1 antibody, or an antibody or antigen-binding fragment comprising at least a portion of the hzACO-1 VH sequence can thus provide for a reduced risk for a human-anti-mouse-antibody (HAMA) -response in a human patient.
- HAMA human-anti-mouse-antibody
- the replacement of the sequence AQK instead of NEN in position 60-62 in heavy chain has the advantage of avoiding two asparagine residues which may be prone to deami- dation.
- - hzACO-1 VL wild-type, E1 Q, L47W, I58V, F71Y and any combination of any thereof; - in various heavy-light chain combinations.
- amino acid sequence alignments of the ACO-1 and ACO-2 VH and VL sequences revealed a high sequence identity between the respective light and heavy chains.
- the antibodies differed at 13 amino acid residues, possibly due to subsequent somatic hyper-mutations.
- - hzACO-1 VH wild-type, T28S, N31S, I58S, S76N, T77I and A93V, and any combination of at least two mutations selected from T28S, N31S, I58S, S76N, T77I and A93V;
- - hzACO-1 VL wild-type, D29G, L33F, S50G and any combination of at least two mutations selected from D29G, L33F, and S50G,
- ACO-1 ACO-2. and hzACO-1
- the VH and VL sequences were transferred to CMV promoter-based expression vectors (pTT vectors) suitable for transient expression in the HEK293-EBNA (HEK293-6E) expression system described by Durocher et al. (Nucleic Acids Res. 2002;30(2):E9).
- the vectors contain a pMB1 origin, an EBV origin and the AmpR gene.
- the VH of ACO-1 and ACO-2 were cloned into the CMV-based vector containing the constant region for mouse lgG2a and lgG2b, respectively.
- the full length LC was transferred to the empty CMV-based vector for both ACO-1 and ACO-2.
- the DNA sequences for the variable regions of hzACO-1 were ordered from Geneart, Regensburg, Germany.
- the delivered sequence for the hzACO-1 VH was transferred to the expression vector containing the constant region for human lgG4(S241 P) (containing a S241 P mutation in the hinge region).
- the delivered hzACO-1 VL sequence was transferred to the vector containing the constant region for a human kappa light chain.
- Example 2 The 10 potential back-mutations identified in Example 2 were introduced separately to hzACO-1 HC and LC constructs in order to gauge the individual contribution of each residue to antigen binding. A few combinations were included as well.
- a variant of hzACO-1 with an extended CDR H2 (hzACO-1 -Kabat CDRH2), equivalent to the Kabat definition of the murine CDR H2 (SEQ ID NO: 16) was also generated by site-directed mutagenesis.
- Site-directed mutagenesis was performed on the hzACO-1 LC and HC expression vectors. To generate single mutants the QuickChange ® Site-Directed Mutagenesis kit from Stratagene (cat.# 200518) was used according to the manufactures protocol. Introduction of desired mutations was verified by sequencing plasmid DNA preparations (MWG Biotech, Matinsried, Germany) for each mutant.
- the mutated light chain constructs were combined with the hzACO-1 heavy chain for expression and mutated heavy chain constructs were combined with the hzACO-1 light chain constructs for antibody expression.
- the ACO-1 , ACO-2, hzACO-1 , and hzACO-1 variants were expressed in transiently transfected HEK293 cells following a generic antibody expression protocol. The following describes the transfection protocol for suspension adapted HEK293 cells.
- the DNA and transfection reagent dilutions were mixed 1 :1 and left at room temperature (23-25 0 C) for 25 min.
- the DNA-293fectinTM mix was added directly to the cell culture.
- the transfection cell culture was transferred to an incubator shaker at 37°C, 8 % CO 2 and 125 rpm. After 4-7 days, cell culture supernatants were har- vested by centrifugation followed by filtration through a 0.22 ⁇ m PES filter (Corning cat. #: 431098).
- the antibodies were analyzed as supernatants or purified using standard protein A purification techniques.
- HEK293-6E cells were transfected as described above with pTT-based expression vectors for hzACO-1 light chain and hzACO-1 or hzACO-1-Kabat CDRH2 heavy chains. The transfections was performed in triplicates. For each antibody variant, three cultures (25 ml) were transfected using a DNA-293Fectin master mix to minimize the influence from pipetting inaccuracy. The transfected cultures were incubated in a shaker incubator for 4 days as described above. At day 4, samples were extracted from the cultures for cell viability and cell density measurements and the remaining cell culture supernatants were harvested by cen- trifugation.
- Transient expression levels in HEK293-6E cells were compared for the lead lgG4(S241 P) variant of hzACO-1 and hzACO-1 (IgGI) and hzACO-1 (lgG2) to determine if heavy chain subclass switching had any effect on antibody expression levels.
- the experiment was performed similarly to the expression assay described above, but with the following changes: The experiment was performed in duplicates in 5 ml cultures. The cultures were incubated in filter capped 50 ml falcon tubes in a shaker incubator at 37°C, 8 % CO 2 and 250 rpm. Unpredictably, the average expression levels for hzACO-1 (IgGI) and hzACO-
- Example 6 Crystal structure of IFN- ⁇ 8 in complex with hzACO-1-Fab
- IFN- ⁇ 8 amino acid 1-166 of SEQ ID NO: 30, and hzACO-1 Fab (with the light chain sequence of SEQ ID NO: 32 and heavy chain sequence of residues 1-221 of SEQ ID NO: 31 ) were mixed, with a slight excess of IFN- ⁇ 8, and the complex was purified on a gel- filtration column.
- the protein complex hzACO-1 -Fab/I FN- ⁇ 8 was put in a buffer of 25 mM HEPES buffer, pH 7.5, + 25 mM NaCI and concentrated to 5 mg/ml.
- the complex was crystallized in 100 mM HEPES buffer, pH 7.5, 15 % PEG 10,000 and 15 % Ethylene glycol, the precipitant solution.
- the crystal Prior to diffraction data collection, the crystal was flash frozen in liquid N 2 . The crystal was first transferred to a cryo solution which was a mix of 25 % v/v 99 % glycerol and 75 % of the precipitant solution. Diffraction data were collected at beamline BLI91 1-3, MAX-Lab, Lund, Sweden. Diffraction data were indexed and integrated using the XDS program package (Kabsch, J. Appl. Crystallogr. 1993;26:795-800).
- the three-dimensional structure was determined using the Molecular Replacement (MR) method using the PHASER program (Read, 2001 , Acta Crystallogr. Sect. D-Biol. Crys- tallogr. 57, 1373-1382) of the CCP4 package (Baily, 1994, Acta Crystallogr. Sect. D-Biol. Crystallogr. 50, 760-763).
- the search models were divided into three parts: 1) the variable domain of hzACO-1 Fab), 2) the constant domain of the hzACO-1 Fab and 3) the PDB deposited IFNtau model, Protein Data Bank (Berman et al., 2000,. Nucleic Acids Res. 28, 235- 242) accession code 1 B5L (RADHAKRISHNAN et al, 1999, J.MOLBIOL ⁇ /.286pp.151), mutated by the COOT program to obtain the sequence of IFN- ⁇ 8, SEQ ID NO: 30. The final space group determination was made by the PHASER program.
- the model comprised residues 1-21 , while residues 22- 23 were refined as Ala residues, 28-101 and 1 14-164 of IFN- ⁇ 8, 1-215 of the hzACO-1 light chain and 1-219 of the hzACO-1 heavy chain.
- the contacts were identified by the CONTACT computer program of the CCP4 suite using a cut-off distance of 4.0 A between the Fab and IFN- ⁇ 8 molecules.
- the resulting epitope for human hzACO-1 was found to comprise the following residues of IFN- ⁇ 8 (SEQ ID NO: 30): Ser 55, His 58, GIu 59, GIn 62, GIn 63, Asn 66, GIu 97, Leu 118, Arg 121 , Lys 122, Phe 124, GIn 125, Arg 126, Thr 128, Leu 129, Thr 132).
- Residues of hzACO-1 involved in interactions with IFN- ⁇ 8, the paratope included Ser 32, Tyr 33, Tyr 35, Tyr 50, Ser 51 , Trp 92, Ser 93, Tyr 95 and Phe 97 of the hzACO-1 light (L) chain, (Numbering according to SEQ ID NO: 32, not Kabat, and Thr 30, Asn 31 , Tyr 32, Trp 33, His 35, GIu 50, Asn 52, Ser 54, His 55, Arg 57, Leu 101 , GIy 102, Trp 105 of the heavy (H) chain, Table 9 (Numbering according to SEQ ID NO: 31 , not Kabat).
- the hzACO-1 interaction epitope on IFN- ⁇ 8 overlaps, partly, the IFNAR1 binding epitope while the IFNAR2 binding epitope is distant from the hzCAO-1 binding epitope. That suggests that the neutralization of IFN- ⁇ by hzACO-1 occurs by neutralization of IFN- ⁇ binding to IFNAR1 , but not IFNAR2. Accordingly, it may be envi- sioned that hzACO-1 binds the IFN- ⁇ /IFNAR2 complex but inhibits formation of the ternary receptor complex IFN- ⁇ /IFNAR1/IFNAR2 responsible for intracellular signaling.
- Example 7 Design of structure based mutations for affinity maturation of hzACO-1
- analogues may be generated only within the CDRs.
- mutations outside the CDRs may be made in order to improve affinity.
- a more limited number of qualified mutations that improve affinity may be predicted and analysed, based on structu- rural predictions.
- Example 6 based on the crystal structure of IFN- ⁇ 8 in complex with the Fab fragment of hzACO-1 , as described in Example 6, three mutants that improve hzACO-1 binding to all IFN- ⁇ subtypes were identified.
- the 3 mutants are hzACO-1 HC T30R, hzACO- 1 LC Y32E and the combined hzACO-1 Y32E, T30R (residue numbering according to Ka- bat). The identification of the mutants is described below.
- LC Y32E It can be seen that the electron density for residues Lys 122 of IFN- ⁇ 8, which is part of the binding epitope to hzACO-1 , indicates a rather high mobility. Moreover, the atom O ⁇ of residue Tyr 32 (Kabat notation) of the hzACO-1 light chain is directed to- wards the C ⁇ and Cy atoms of the Lys 122 side chain. That interaction is not any optimal residue-residue interaction. Mutating the light chain Tyr 32 to a negatively charged residue like GIu, or Asp, make the possibility of forming a strong ionic bond between the antibody light chain Tyr 32 residue and the positively charged Lys 122 residue of IFN- ⁇ 8 .
- HC T30R For each hzACO-1 residue close to IFN- ⁇ 8 in the X-ray structure, the following properties were calculated: number of core side chain atoms (core), number of periphery sidechain atoms (peri), number of charged interactions (char), number of hydrogen bonds (hybo) and number of hydrophobic interactions (hyph) and given in Error! Reference source not found, below: Table 10. Properties of amino acids of the hzACO-1 mAb
- the number of core and periphery atoms were calculated by overlaying the X-ray structure onto a 101 x 101 x 101 node grid and for each grid point calculating the number of atoms ⁇ 2.5 A (N ex ) and atoms ⁇ 3.5 A (N 1n ) from the node.
- Core nodes have N ex > 0 covering atoms from both hzACO-1 and IFN-8.
- Core sidechain atoms are now atoms ⁇ 2.5 A from any node.
- Periphery sidechain atoms are now atoms ⁇ 2.5 A & ⁇ 3.5 A from any node.
- periphery residues are defined as residues with only periphery atoms and no interactions, so they can be modified to create binding.
- LC S92, HC T28, HC T30, HC P52, HC Q64 and HC P99 have be identified. Focusing on heavy chain non-prolines, it is seen by visual inspection that the mutation HC T28R would have a possible interaction with D90, HC T30R would have a possible interaction with both D90 and E97 and Q64R would have a possible interaction with E114, but other similar mutations can also be applied. Since only E97 is conserved across all interferon alphas, HC T30R is expected to give the best binding with a similar profile as hzACO-1.
- the specific mutation HC T30R was designed to establish a charge-charge interac- tion in the periphery of the binding site to improve the affinity of hzACO-1.
- hzACO-1 Y32E T30R was generated and analyzed to determine if the two mutations would have additive effects.
- Example 8 Determination of the kinetic parameters for the interaction between hzACO-1, hzACO-1 variants and recombinant human I FN- ⁇ subtypes.
- Protein interactions can be monitored in real-time using surface plasmon resonance (SPR) analysis.
- SRP analysis was performed on Biacore 3000 and Biacore T100 instruments in order to characterize the anti-IFN ⁇ monoclonal antibody hzACO-1 and variants thereof, with respect to affinity towards various subtypes of recombinant human Interferon alpha (I FN- ⁇ ).
- Affinity studies were performed using a direct binding procedure, with the respective monoclonal antibody covalently coupled via free amine groups to the carboxymethylated dextrane membrane (CM5) on the sensor chip surface.
- Recombinant IFN- ⁇ subtypes (PBL Biomedical Laboratories, NJ, USA.) were injected in various concentrations, followed by a dissociation period with constant buffer flow over the sensor chip surface.
- the binding of IFN- ⁇ to the immobilized monoclonal antibody can be regarded as a 1 :1 binding, with one IFN- ⁇ molecule binding to one antibody binding site.
- the kinetic parameters for the interaction can be calculated using a 1 :1 interaction langmuir fitting model.
- the purified monoclonal antibodies were immobilized in individual flow cells on a CM5 type sensor chip. Immobilizations were performed using a standard amine coupling procedure, aiming for an immobilization level of 1000 Resonance Units (RU).
- RU Resonance Unit
- HBS-EP pH 7.4 (1OmM HEPES, 15OmM NaCI, 3mM EDTA and 0,005% Polysorbat P20) was used as running buffer, and diluent for the recombinant IFN- ⁇ 's. Association (injec- tion) was 4 min., followed by a 12 to 30 min. dissociation period. Flow rate was 50 ul/min. Experiments were performed at 25°C. Detection in all flow cells simultaneously. Flow cell #1 contained no immobilized antibody, and was used for subtraction of background and bulk.
- the kinetic parameters were calculated by global fitting of the data for a given anti- body - antigen combination using a 1 : 1 langmuir binding model. Data was inspected for mass-transport limitations prior to calculation of the kinetic parameters.
- the kinetic parameters obtained are valid only in the buffer used, and with the re- combinant form of the antigen.
- KD is the equilibrium dissociation constant
- ka is the association rate constant
- kd is the dissociation rate constant
- the kinetic parameters for the interaction of hzACO-1 as compared to a humanized ACO-1 molecule generated by traditional CDR grafting and accordingly contains a large murine CDR H2 (designated hzACO-1 -kabat CDRH2), with recombinant human IFN- ⁇ A are listed in Table 12 .
- the affinity of the hzACO-1 molecule, humanized as described in example 2 and containing a shorter CDR H2 than the hzACO-1-kabat CDRH2 molecule were equal, showing that the humanization process described in example 2 generates a humanized variant as good as that generated by simple CDR grafting, while having a more human sequence.
- KD is the equilibrium dissociation constant
- ka is the association rate constant
- kd is the dissociation rate constant
- the affinity determination further demonstrated KD values of all ACO2 derived hzACO-1 antibody variants (except hzACO-1-l58S) in the lower nM range.
- the minor varia- tions in the KD values are predominantly related to differences in the kd.
- Introduction of the single amino acid substitutions N31 S, A93V, or T28S, and combinations thereof, in the hzACO-1 slightly increased the affinity to a level similar to that of ACO-1
- the hzACO-1 -I58S mutation has a pronounced negative effect on the kd value, demonstrating the importance of this particular amino acid for the stability of the hzACO-1/IFN ⁇ -A complex.
- KD is the equilibrium dissociation constant
- ka is the association rate constant
- kd is the dissociation rate constant
- the kinetic data in Table 16 illustrate, that a hzACO-1 Y32E,T30R construct gener- ated based on a rational design approach, had retained its IFN- ⁇ subtype profile as it does not bind to IFN- ⁇ 1 but does bind to the remaining subtypes tested.
- a dissociation comparison experiment was performed on selected human IFN- ⁇ subtypes (Table 16).
- the suggested mutations of the double mutant hzACO-1 construct were based on the structure of the IFN- ⁇ 8, unpre- dictably the improved off-rates were observed for all tested human IFN- ⁇ subtypes varying between 6-64 fold.
- This anti-IFN- ⁇ neutralization assay used is based upon the lytic effect of EMC virus on A549 cells. All IFN- ⁇ subtypes can inhibit the EMC virus replication in A549 cells, resulting in cell survival, which can be measured as cellular DNA staining. The neutralizing effect of an anti-IFN- ⁇ antibody on different IFN- ⁇ subtypes can be measured by diminished cellular DNA staining, corresponding to increased cell lysis.
- the assay was performed in plates with 96 wells (Nunc, Cat. No. 167008), where each well contained a final volume of 200 ⁇ l_. All IFN- ⁇ preparations were from PBL Biomedical Laboratories, NJ, USA.
- each IFN- ⁇ subtype (listed in Table 17 below) was derived from previous studies.
- the antibody concentrations used in the assay were selected based on existing data obtained from use of, e.g., murine antibodies ACO-1.5.2 and ACO-2.2.
- Each IFN- ⁇ subtype was pre-incubated with hzACO-1 for 2 hours at 37°C, 5% CO 2 .
- the anti-interferon antibody was diluted as shown in Table 17 below. After pre-incubation of antibody with IFN- ⁇ , 50 ⁇ L of cell-solution (300000 cells/mL) were added to obtain 15000 cells/well. After 4.5 hours incubation at 37°C, 5% CO 2 , 50 ⁇ L EMC virus at a concentration of 10 ⁇ 3.5 TCID 50 were added, followed by incubation for 48 hours at 37°C, 5% CO 2 . The supernatant was subsequently carefully removed, and 50 ⁇ L crystal violet solution (0,5% crystal violet, 25% methanol) were added. After 15 min of incubation at room temperature, the wells were washed in water and dried overnight.
- this CPE-assay showed that the protective effect of almost all interferon subtypes could be inhibited by hzACO-1.
- the protective effects of IFN- ⁇ D and IFN- ⁇ 1 were not inhibited by hzACO-1 , even at antibody concentrations of 50000 ng/mL. Accordingly, the specificity of the mouse ACO-1 was retained in the hzACO-1 construct.
- Example 10 - Analysis of ACO-derived antibodies in a Reporter Gene (RG) Bioassay
- a luciferase-based reporter gene assay was utilized to evaluate the ability of hzACO-1 antibody variants to neutralize the biological activity of recombinant I FNa subtypes.
- the 93D7 cell line was derived by stable transfection of the A549 cell line (CLL-185, ATCC) with an IFN-inducible construct, harboring the Mx promotor driving a luciferase reporter gene .
- the Mx promotor consist of 1.6 kb BamHI fragment containing the murine MxA promotor and IFN response elements excised from pSP64-Mxp(Pstl-Pvull)-r ⁇ glo (Lleonart et a/. (1990) Biotechnology 8: 1263-1267).
- the IFN- ⁇ subtypes (all from PBL Biomedical Laboratories, NJ, USA) used are listed in Figure 5.
- RG assays were performed in quadruplicate wells in opaque Nunc 96-well optical bottom plates. For every assay, a positive control I FNa was included as well as negative control wells containing non-stimulated cells and cells treated with antibody in the absence of IFN ⁇ stimulation.
- adherent 93D7 cells were harvested from flasks by removing the culture media, washing once with PBS, and trypsinizing. Trypsinization was stopped using DMEM complete. Cells were counted and adjusted to 600,000/ml in complete DMEM.
- Purified anti-IFN- ⁇ mAbs were pre-incubated with recombinant IFN subtypes for 1 h in a total volume of 100 ⁇ l DMEM complete at 37 0 C + 5% CO2. Following antibody-IFN incubation, 50 ⁇ l 93D7 cells were added and incubated for 5 h at 37 0 C + 5% CO2.
- the concentration of IFN was adjusted to contain the amount to be placed in each well in 100 ⁇ l. 100 ⁇ l of IFN was placed in quadruplicate wells, incubated for 1 h at 37 0 C + 5% CO 2 . Sub- sequently, 50 ⁇ l cells were added and incubation continued for additionally 5 h.
- Humanized ACO-1 constructs were evaluated for their ability to inhibit various human IFN- ⁇ subtypes in the reporter gene assay.
- Figure 5 shows normalized data for the inhibition of 12 IFN- ⁇ subtypes by the hzACO-1 antibody. IFN- ⁇ stimulation in the absence of antibody was set to 100% whereas mock treated cells (receiving medium only) was set to 0 %. Data points are shown with standard error. Curves were calculated as best fit sigmoidal response curves using the Prism software. hzACO-1 was capable of inhibiting all tested subspecies of IFN- ⁇ s except for IFN- ⁇ D, and accordingly the specificity of the parent mouse ACO-1 antibody was retained during humanization in the hzACO-1 antibody.
- FIG. 10 shows a comparison of the mouse ACO-1 Ab to the humanized ACO-1 (hzACO-1 ) as well as two variants hereof in the RG assay.
- One variant is a humanized ACO- 1 harboring a the entire CDRH2 (designated hzACO-1-kabat CDRH2) whereas the hzACO-1 was constructed with a shorter CDRH2 as described in example 2.
- hzACO-1 which has been optimized for interaction with IFN- ⁇ s (designated hzACO-1 Y32E, T30R) through rational design, as described in example 7.
- hzACO-1 displayed for all five IFN subtypes almost comparable IC50 values as mouse ACO-1 , quantitatively the IC50s being less than twofold (see Table 18 for relative IC50 values) in accordance with the observed KDs reported in example 8..
- the humanization was thus accomplished with an affinity loos less than twofold of the parent ACO-1 antibody for functional inhibition.
- the mAb humanization of ACO-1 has produced an antibody that has retained the affinity for IFN- ⁇ s. Accordingly, both the affinity and the potency was considered retained in of the hzACO-1 antibody as compared to the original mouse ACO-1 , and no futher backmutations were required.
- the humanization method of ACO-1 resulted in an antibody with relatively more human amino acids in the CDR H2 as compared to commonly humanization by simple CDR grafting. Whereas this could be expected to lead to reduced potency in the humanized ACO-1 for neutralization of IFN- ⁇ subtypes, as shown in figure 10 and Table 18, suprisingly this is not the case, as the hzACO-1 and hzACO-1 -kabat CDRH2 are equipotent for all the IFN- ⁇ subtypes tested. This is in agreement with the affinities reported for the two ACO-1 variants as described in example 8.
- IC50 values in were for each IFN- ⁇ species normalized to that of hzACO-1. A value less than one therefore indicates a more potent antibody than hzACO-1 inhibition of IFN- ⁇ activity, whereas conversely values higher than one indicates inhibition with lesser potency.
- ACO-2 derived hzACO-1 variants were compared to hzACO-1 using the RG assay. Comparisons were made using two IFN- ⁇ subspecies (IFN- ⁇ F and IFN- ⁇ A). Four different single amino acid substitutions were tested: T28S (i.e., at position 28, (according to Kabat) threonine was substituted with serine), I58S, N31 S, and A93V. Whereas the I58S variant inhibited the IFN- action with reduced potency, and possibly also with reduced efficacy (IFN- ⁇ A), the T28S and N31S variants both displayed potencies similar to that of hzACO-1.
- the A93V substituted variant showed increased potency for inhibition of IFN- effects as measured in the RG assay ( Figure 6). Although dif- ferences in the effects of the substitutions could be detected between different IFN- ⁇ subtypes, the trend was the same for the two forms in all four cases.
- Example 6 Through rational design using the crystal structure in Example 6, a mutant was constructed having two amino acids changed, HC T30R, LC Y32E of hzACO-1 (designated ACO-1 Y32E, T30R), as described in example 7, to improve binding to IFN- ⁇ . Even though the mutations were based on the structure of IFN- ⁇ 8, as seen from figure 10 (A-E) surprisingly this mutant had increased potency for inhibition of all the tested IFN- ⁇ s. Furthermore, Table 18 shows that whereas the increment in potency is dependent on the specific subtype it is in the order of 16 fold and up til 50 fold improvement of potency.
- citric acid/sodium citrate pH 3.0, 3.5; sodium acetate, pH 4.0, 4.5, and 5.0; histidine, pH 6.0, 6.5; imidazole, pH 7.0; glycine-glycine pH 8.0, 9.0, 10.0.
- thermofluor graphs for hzACO-1 and variants showed the two expected temperature transitions for IgG proteins, reflecting the two main domains, Fc and Fab.
- the proteins showed a lower Tm at lower pH. Above pH 5.5 the transition midpoint was rather constant.
- the effect of additives was the same for the different antibodies. Generally, sucrose at 0.5M had the most stabilizing effect, while addition of NaCI, phenol and Tween 80 seemed to have a destabilizing effect.
- HPLC high-performance liquid chromatography
- BIOSEP SEC 3000 Phenomenex
- PBS phosphate-buffered saline
- the amount of formed high molecular weight forms of the hzACO-1 -isotypes is shown in Figure 11 and shows clearly that the lgG4 construct showed no aggregate formation during the incubation while both the IgGI and lgG2 isotypes formed high molecular weight variants. Furthermore, the hzACO-1-lgG1 variant showed a low molecular weight fragment after incubation. The amount of the fragment was 1.3 %.
- the hzACO-1 lgG4 is a more attractive therapeutic molecule than the corresponding lgG2 and IgGI antibodies.
- the ACO-1 mAb and humanized versions hereof may block the activity of IFN- ⁇ by inhibiting binding of IFN- ⁇ to the type I interferon alpha receptor subtunit 1 (IFNAR1 ). Accordingly, a humanized therapeutic ACO-1 mAb may bind to the cell surface making a complex consisting of the antibody, IFN- ⁇ and IFNAR2. This raises the risk of ACO-1 inducing antibody dependent cellular cytotoxicity (ADCC).
- ADCC antibody dependent cellular cytotoxicity
- ADCC experiment was performed to asses the ability of the hzACO-1 antibody expressed as an lgG4 subtype in the presence of IFN- ⁇ 2A.
- Raji cells human B cell line (ATCC # CCL-86) were used as target cells. Raji cells were cultured in RPM11640 supplemented with 10% fetal calf serum, 10 mM HEPES, 1 mM sodium pyrovate, 1 mM glutamine, 2,5 g/l glucose and 1% penicillin/streptamycin. Highly purified interferon- ⁇ 2A was used for the assay. The protein was tested in a reporter gene assay for biological activity prior to use. Rituxan® (Nomeco A/S, Denmark) was used as a positive control for ADCC, when using Raji cells, which is a B cell line that expresses the B cell surface antigen CD-20.
- Target cells were harvested and counted in a hemocytometer. 1.5*10 6 cells were transferred to a 15 ml. tube and centrifuged. The supernatant was completely removed and the cell pellet was resuspended in 100 ⁇ Ci 51 Cr (Chromium-51 ) per 10 6 cells (volume were adjusted according to decay table). During a 1 hour incubation period at 37 0 C with IFN- ⁇ the vial was tapped every 15 minutes. Subsequently the cells were washed twice in medium (RPM11640, 10% FCS), and resuspended in 2 ml. medium of assay medium. 5000 51 Cr labelled cells were plated in a volume of 50 ⁇ l_ in 96 well plates (flat bottom).
- Example 13 Complement binding ELISA assay.
- the ACO-1 mAb and humanized versions hereof may block the activity of IFN- ⁇ by inhibiting binding of IFN- ⁇ to the type I interferon alpha receptor subtunit 1 (IFNAR1 ). Accordingly, a humanized therapeutic ACO-1 mAb may bind to the cell surface making a complex consisting the antibody, IFN- ⁇ and IFNAR2. This raises the risk for activating the complement system and inducing complement dependent cytotoxicity (CDC).
- CDC complement dependent cytotoxicity
- the purpose of the present complement binding study was to test whether the clas- sical complement pathway is activated when hzACO-1 expressed as a human lgG4 isotype binds to and forms a complex with a corresponding epitope on hlFN- ⁇ . This is accomplished by using an ELISA, which measures the binding of antibodies to C4. Binding of C4 indicates that the C1s is changed and the complement cascade has started. Once the C4 has bound, the other complement components from the plasma will in turn be activated, bind, and enzy- matically cleave the next components of the cascade.
- Streptavidin-coated microtiter plates (236001 , NUNC) were used as ELISA plates.
- Biotinylated hlFN- ⁇ 2A was used as antigen source and the plates were coated in100 ⁇ l/well by 0.25 ⁇ g/ml protein diluted in washing buffer (1OmM Na3PO4 + 145mM NaCI + 0.05 % Tween 20). This hi FN- ⁇ concentration was eshown to be the optimal coating concentration in an ELISA.
- the plates were incubated for 60 min. at RT and gentle shaking and then washed five times in washing buffer, leaving the buffer from the last wash in the plates for 30 min. to block possible residual binding sites on the plates.
- the buffer was discarded from the plates and 10O ⁇ l hzACO-1 mAb diluted in washing buffer were added to the plates at 1 ⁇ g/ml.
- the plates were incubated for 60 min. at RT and gentle shaking. The plates were washed five times in washing buffer.
- a polyclonal anti-lgG4 pAb was used as a positive control by crosslinking of the hzACO-1 lgG4 mAb.
- the anti-lgG4 pAb mAb was diluted in washing buffer and added to the plates in serial dilutions from 32 ⁇ g/ml to 32ng/ml in 100 ⁇ l/well.
- a human antibody isotype When expressing a humanized monoclonal antibody, a human antibody isotype needs to be selected for expression of the full length human antibody. For the development of a neutralizing anti-IFN- ⁇ antibody, no Fc-mediated effector functions are required. Furthermore, although the ACO-1 derived antibodies are capable of neutralizing IFN- ⁇ activity (example 9 and example 10), the binding epitope of the ACO-1 antibody variants, as described in example 6, is compatible with simultaneous binding of the IFNAR2 receptor subunit and IFN- ⁇ ..
- the therapeutic hzACO-1 mAb binds to the soluble IFN- ⁇ cytokine
- the mAb may in fact be able to bind to cell surfaces through the IFN- ⁇ /IFNAR2 complex hand cause cytotoxicity by recruitment of Fc mediated effector functions.
- the selection of the antibody isotype is of particular importance, as it has been described that the Fc part of anti- IFN mAbs may in fact cause undesired biological effects resulting in potentiation instead of neutralization of IFN in certain cell types as described below (Moll HP. et al J Immunol 180, 1594-604, 2008).
- Type I IFNs antibodies against human IFN- ⁇ or IFN- ⁇ that normally neutralize IFN activity in other cell types, instead induce IFN activity in human endothelial cells and PMBCs in the presence of IFN- ⁇ or IFN- ⁇ .
- the antibodies used in these studies are of the mouse IgGI isotype, which are known to cross bind to human Fc receptors.
- the induction of IFN activity is only seen for intact antibodies and not Fab or Fab2 fragments of the same antibodies and appears to be inhibited by blockade of Fc receptors with an antibody isotype control mAb. Accordingly, although the molecular mechanism of this phenomenon is not known, it appears to require that these mAbs bind to cell surface receptors through the Fc part.
- IgGI immunoglobulin G cytoplasmic cytoplasmic cytoplasmic cytoplasmic cytoplasmic cytoplasmic cytoplasmic cytoplasmic cytoplasmic cytoplasmic cytoplasmic cytoplasmic cytoplasmic cytoplasmic cytoplasmic cytoplasmic cytoplasmic cytoplasmic cytoplasmic cytoplasmic cytoplasmic cytoplasmic cytoplasmic cytoplasmic cytoplasmic cytoplasmic mediated effector functions such as -dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC) (Salfeld JG. Biotechnol 25, 1369-1372, 2007). Mutations that abrogate binding of various Fc receptors and C1q have been described in the literature (Hezareh M. et al J Virol 75, 12161-12168, 2001. ldusogie EE. Et al. J Immunol 164, 4178-4184, 2000.
- ADCC -dependent cellular cytotoxicity
- CDC complement-dependent
- the hzACO-1 anti-IFN- ⁇ mAb was expressed both with lgG2 and lgG4 isotypes, which are both used in number of therapeutic antibodies (Salfeld JG. Biotech- nol 25, 1369-1372, 2007).
- the expression levels of the lgG4 construct was significantly higher than of the lgG2 hzACO-1 variant (example 5) which will improve the production yield considerably.
- the lgG2 hzACO-1 molecule but not the lgG4 variant was prone to aggregation (example 1 1). This is considered a serious problem in drug de- velopment, as aggregation may lower yield during production, limit shelf-life and result in reduced potency in patients due to increased immunogenicity.
- the hzACO-1 lgG4 construct was selected for further characterization in an ADCC assay in the presence of IFN- ⁇ , as well as a complement fixation ELISA assay, as described in example 12 and 13, respectively.
- the hzACO-1 lgG4 molecule appears to be a particular suitable therapeutic molecule as it is capable of neutralizing IFN- ⁇ without induction of undesired side- effects caused by Fc-mediated effector functions including cytotoxicity and potentiation of IFN activity, and as it is a stable and well expressed molecule making it suitable for manufacturing and administation to patients.
- hzACO-1 is expected to be less immunogenic, than a traditional CDR grafted humanized ACO-1.
- the mouse ACO-1 antibody was humanized by an untra- ditional method. This constitutes the designing of a mask of residues predicted to comprise the paratope, based on a 3D model of hzACO-1 and IFN- ⁇ A.
- the application of this humani- zation method resulted in a hzACO-1 antibody with fewer murine residues than an antibody humanized by simple CDR grafting, since the peptide comprising the 5 C-terminal amino acids of the optimized hzACO-1 CDR H2 sequence was identical to the corresponding human framework sequence.
- the corresponding peptide sequence in a traditionally CDR grafted humanized antibody was of murine origin.
- this humanization procedure resulted in a humanized antibody with a more human sequence, less likely to cause immunogenicity in patients.
- Analysis of the sequences of the CDR H2 revealed that by reducing the mouse amino acid residues in the hzACO-1 , an MHC class Il T cell epitope containing the mouse amino acids is removed and replaced with a fully human, which patients would be expected to be tolerant to. Accordingly, this confirmed that hzACO-1 is expected to be less immunogenic, than a traditional CDR grafted humanized ACO-1 antibody.
- the affinity of the hzACO-1 antibody was retained, within two-fold of the mouse ACO-1 antibody, as shown in example 8. Accordingly, no further mouse backmutations were required. Furthermore, the IFN- ⁇ subtype profile of the antibody, binding and neutralizing all IFN- ⁇ subtypes except the IFN- ⁇ 1/D had been retained, as described in example 8, 9 and 10. Despite containing fewer mouse amino acids in the CDR H2, the affinity of the hzACO-1 was identical to the affinity and the potency of the hzACO-1 -kabat CDRH2 antibody, containing the full length mouse CDR H2 from the mouse ACO-1 antibody (Example 8 and 9, re- spectively).
- the replacement of the sequence AQK instead of NEN in position 60- 62 in heavy chain by use of the desribed humanization method has the advantage of avoiding two asparagine that may be prone to deamidation. Deamidation change the net charge of proteins which may effect stability and/or specificity. By keeping the sequence AQK the ho- mogeneity of hzACO-1 will be better preserved. Comparison of the hzACO-1 to the traditionally CDR grafted hzACO-1-kabat CDRH2 version, revealed that the hzACO-1 is a highly stable protein, whereas the hzACO-1-kabat CDRH2 antibody unexpectedly had a tendency to aggregate (example 11).
- the hzACO-1 lgG4 antibody was humanized by a novel approach resulting in a therapeutic antibody with less mouse amino acids which is less likely to cause immunogenicity in patients.
- this humanized antibody had a comparable affinity, potency and IFN- ⁇ subtype profile as the mouse antibody and a humanized version generated by traditional CDR grafting.
- the hzACO-1 antibody is less prone to deamidation and has a higher expression level.
- the hzACO-1 antibody it is a stable and well expressed molecule suitable for manufacturing and administration to patients.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Pharmacology & Pharmacy (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Immunology (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Diabetes (AREA)
- Pulmonology (AREA)
- Virology (AREA)
- Biomedical Technology (AREA)
- Dermatology (AREA)
- Biotechnology (AREA)
- Hematology (AREA)
- Physical Education & Sports Medicine (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Rheumatology (AREA)
- Wood Science & Technology (AREA)
- Epidemiology (AREA)
- Neurology (AREA)
- Microbiology (AREA)
- General Engineering & Computer Science (AREA)
- Communicable Diseases (AREA)
- Oncology (AREA)
- Endocrinology (AREA)
- Zoology (AREA)
Priority Applications (16)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN200980116496.6A CN102083859B (zh) | 2008-05-07 | 2009-05-06 | 人源化抗人干扰素-α抗体 |
| HK11107983.1A HK1154251B (en) | 2008-05-07 | 2009-05-06 | Humanized antibodies against human interferon-alpha |
| JP2011507904A JP5766598B2 (ja) | 2008-05-07 | 2009-05-06 | ヒトインターフェロン−αに対するヒト化抗体 |
| RU2010150105/10A RU2532832C2 (ru) | 2008-05-07 | 2009-05-06 | Гуманизированные антитела против альфа-интерферона человека |
| BRPI0912570A BRPI0912570B8 (pt) | 2008-05-07 | 2009-05-06 | anticorpo anti-ifn-alfa humanizado, ou um fragmento de ligação ao antígeno do mesmo, composição terapêutica e seus usos |
| CA2722622A CA2722622C (en) | 2008-05-07 | 2009-05-06 | Humanized antibodies against human interferon-alpha |
| ES09742079.8T ES2549903T3 (es) | 2008-05-07 | 2009-05-06 | Anticuerpos humanizados contra interferón alfa humano |
| US12/597,357 US8163885B2 (en) | 2008-05-07 | 2009-05-06 | Humanized antibodies against human interferon-alpha |
| KR1020107027445A KR101687032B1 (ko) | 2008-05-07 | 2009-05-06 | 인간 인터페론-알파에 대한 인간화 항체 |
| MX2010012052A MX2010012052A (es) | 2008-05-07 | 2009-05-06 | Anticuerpos humanizados contra interferon-alfa humano. |
| EP09742079.8A EP2279207B1 (en) | 2008-05-07 | 2009-05-06 | Humanized antibodies against human interferon-alpha |
| AU2009245792A AU2009245792B2 (en) | 2008-05-07 | 2009-05-06 | Humanized antibodies against human interferon-alpha |
| IL208979A IL208979B (en) | 2008-05-07 | 2010-10-28 | Humanized antibodies against human interferon-alpha |
| ZA2010/08748A ZA201008748B (en) | 2008-05-07 | 2010-12-06 | Humanized antibodies against human interferon-alpha |
| US13/363,609 US8361463B2 (en) | 2008-05-07 | 2012-02-01 | Humanized antibodies against human interferon-alpha |
| US13/719,536 US8658771B2 (en) | 2008-05-07 | 2012-12-19 | Humanized antibodies against human interferon-alpha |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP08103847.3 | 2008-05-07 | ||
| EP08103847 | 2008-05-07 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US12/597,357 A-371-Of-International US8163885B2 (en) | 2008-05-07 | 2009-05-06 | Humanized antibodies against human interferon-alpha |
| US13/363,609 Continuation US8361463B2 (en) | 2008-05-07 | 2012-02-01 | Humanized antibodies against human interferon-alpha |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2009135861A2 true WO2009135861A2 (en) | 2009-11-12 |
| WO2009135861A3 WO2009135861A3 (en) | 2010-01-28 |
Family
ID=40901961
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2009/055448 Ceased WO2009135861A2 (en) | 2008-05-07 | 2009-05-06 | Humanized antibodies against human interferon-alpha |
Country Status (15)
| Country | Link |
|---|---|
| US (3) | US8163885B2 (https=) |
| EP (1) | EP2279207B1 (https=) |
| JP (1) | JP5766598B2 (https=) |
| KR (1) | KR101687032B1 (https=) |
| CN (1) | CN102083859B (https=) |
| AU (1) | AU2009245792B2 (https=) |
| BR (1) | BRPI0912570B8 (https=) |
| CA (1) | CA2722622C (https=) |
| ES (1) | ES2549903T3 (https=) |
| IL (1) | IL208979B (https=) |
| MX (1) | MX2010012052A (https=) |
| RU (1) | RU2532832C2 (https=) |
| TW (1) | TWI453032B (https=) |
| WO (1) | WO2009135861A2 (https=) |
| ZA (1) | ZA201008748B (https=) |
Cited By (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8080638B2 (en) | 2005-02-10 | 2011-12-20 | Baylor Research Institute | Anti-interferon alpha monoclonal antibodies and methods for use |
| EP2714080A4 (en) * | 2011-05-25 | 2014-11-19 | Medimmune Llc | METHODS OF TREATING SYSTEMIC LUPUS ERYTHEMATOSIS, SCLEROMERMIA AND MYOSITIS WITH ANTIBODY AGAINST INTERFERON ALPHA |
| EP2970461A4 (en) * | 2013-03-15 | 2016-11-23 | Janssen Biotech Inc | INTERFERON ALPHA AND OMEGA ANTIBODY ANTAGONISTS |
| EP3157564A4 (en) * | 2014-06-23 | 2018-01-03 | Janssen Biotech, Inc. | Interferon alpha and omega antibody antagonists |
| US12202892B2 (en) | 2019-04-04 | 2025-01-21 | Janssen Biotech, Inc. | Method of administration of an anti-IFN-α/-ω antibody |
| WO2025247917A1 (en) * | 2024-05-28 | 2025-12-04 | Institut National de la Santé et de la Recherche Médicale | ANTI-IFN-α2 AND ANTI-IFN-ω1 MONOCLONAL ANTIBODIES |
| WO2025247924A1 (en) * | 2024-05-28 | 2025-12-04 | Institut National de la Santé et de la Recherche Médicale | ANTI-IFN-α2 MONOCLONAL ANTIBODIES |
| WO2025247918A1 (en) * | 2024-05-28 | 2025-12-04 | Institut National de la Santé et de la Recherche Médicale | ANTI-IFN-α2 MONOCLONAL ANTIBODIES |
Families Citing this family (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2013034160A1 (en) * | 2011-09-06 | 2013-03-14 | Max-Planck-Gesellschaft zur Förderung der Wissenschaften e. V. | Methods for analyzing biological macromolecular complexes and use thereof |
| JP6742237B2 (ja) * | 2013-07-03 | 2020-08-19 | イムノキュア アーゲーImmunoqure Ag | ヒト抗ifn−アルファ抗体 |
| US10689703B2 (en) * | 2015-04-27 | 2020-06-23 | National Jewish Health | Methods of identifying and treating subjects having acute respiratory distress syndrome |
| CN108204958A (zh) * | 2016-12-19 | 2018-06-26 | 伊缪泰普有限公司 | 结合测定 |
| BR112022003163A2 (pt) * | 2019-08-19 | 2022-05-17 | Pandion Operations Inc | Imunotolerância alvejada com um agonista de pd-1 |
| RU2737466C1 (ru) * | 2019-12-30 | 2020-11-30 | Федеральное государственное бюджетное учреждение науки институт биоорганической химии им. академиков М.М. Шемякина и Ю.А. Овчинникова Российской академии наук (ИБХ РАН) | Гуманизированное нейтрализующее антитело к интерферону-бета человека |
| CN112500476B (zh) * | 2020-12-16 | 2024-02-23 | 南京基蛋生物医药有限公司 | 一种扩增鼠单抗重轻链基因序列的方法及其引物和筛选该引物的方法 |
| CN116355079B (zh) * | 2022-08-19 | 2023-12-26 | 上海迈科康生物科技有限公司 | 检测重组人轮状病毒vp8抗原(vp8 p[8])的单克隆抗体及其应用 |
Family Cites Families (42)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4423147A (en) | 1980-04-11 | 1983-12-27 | Secher David S | Monoclonal antibody to interferon-α |
| US4824432A (en) | 1981-03-24 | 1989-04-25 | S.V.S. Laboratories, Inc. | Method for treating AIDS and other immune deficiencies and immune disorders |
| US4605394A (en) | 1982-12-03 | 1986-08-12 | Simon V. Skurkovich | Methods for the treatment of pathological conditions by removing interferon from the organism |
| US4362155A (en) | 1981-03-24 | 1982-12-07 | Skurkovich Simon V | Method and apparatus for the treatment of autoimmune and allergic diseases |
| DE3211263A1 (de) | 1981-03-31 | 1983-01-27 | Otsuka Pharmaceutical Co. Ltd., Tokyo | Human-interferon verwandte peptide, antigene und antikoerper, sowie verfahren zu deren herstellung |
| EP0139676B1 (en) | 1983-02-04 | 1992-11-25 | Cytoclonal Pharmaceutics Inc. | Production and characterization of hybridoma antibodies directed specifically against common determinant(s) present among closely related, but distinct proteins |
| GB2148299B (en) | 1983-09-01 | 1988-01-06 | Hybritech Inc | Antibody compositions of therapeutic agents having an extended serum half-life |
| FR2560212B1 (fr) | 1984-02-24 | 1989-12-29 | Unicet | Anticorps monoclonaux contre l'interferon a2 et hybridomes produisant de tels anticorps |
| ES2133285T3 (es) | 1991-04-17 | 1999-09-16 | Medisup Int Nv | Polipeptidos hidrosolubles que tienen una alta afinidad para los interferones alfa y beta. |
| DK0601052T3 (da) | 1991-08-30 | 1996-11-18 | Genentech Inc | Terapeutisk fremgangsmåde til behandling af IDDM |
| EP0563487A1 (en) | 1992-03-31 | 1993-10-06 | Laboratoire Europeen De Biotechnologie S.A. | Monoclonal antibodies against the interferon receptor, with neutralizing activity against type I interferon |
| US5821078A (en) | 1992-09-03 | 1998-10-13 | Yeda Research And Development Co. Ltd. | Nucleic acid encoding interferon-α/β binding protein |
| US5888511A (en) | 1993-02-26 | 1999-03-30 | Advanced Biotherapy Concepts, Inc. | Treatment of autoimmune diseases, including AIDS |
| US5780027A (en) | 1995-07-14 | 1998-07-14 | Meiogen Biotechnology Corporation | Methods of treatment of down syndrome by interferon antagonists |
| IL118096A0 (en) | 1996-05-01 | 1996-09-12 | Yeda Res & Dev | Antibodies against interferon alpha/beta receptor |
| US6713609B1 (en) | 1996-07-16 | 2004-03-30 | Genentech, Inc. | Monoclonal antibodies to type I interferon receptor |
| WO1998006431A2 (en) | 1996-08-16 | 1998-02-19 | Osther Kurt B | Method for treating diabetes |
| US5902321A (en) | 1997-07-25 | 1999-05-11 | Innovasive Devices, Inc. | Device and method for delivering a connector for surgically joining and securing flexible tissue repair members |
| US20030018174A1 (en) | 1997-10-06 | 2003-01-23 | Genentech, Inc. | Monoclonal antibodies to IFNAR2 |
| AU2342900A (en) | 1998-09-23 | 2000-05-01 | Cleveland Clinic Foundation, The | Novel interferon stimulated and repressed genes |
| AUPP670698A0 (en) | 1998-10-23 | 1998-11-19 | Monash University | A method of regulation |
| KR20000034847A (ko) | 1998-11-17 | 2000-06-26 | 성재갑 | 인간 4-1비비 분자에 대한 인간화 항체 및 이를 포함하는 약학조성물 |
| CN1454215B (zh) | 1999-11-15 | 2013-01-02 | 米勒腾尼生物技术有限公司 | 树突状细胞特异的抗原结合片段、组合物及其使用方法、被其识别的抗原及由其获得的细胞 |
| GB0001710D0 (en) | 2000-01-25 | 2000-03-15 | Pharma Pacific Pty Ltd | Therapeutic treatment |
| GB0001712D0 (en) | 2000-01-25 | 2000-03-15 | Pharma Pacific Pty Ltd | Therapeutic peptides |
| US6846486B1 (en) | 2000-02-24 | 2005-01-25 | Advanced Biotherapy Concepts, Inc. | Method of treating allergy by administering an anti-histamine antibody |
| GB0013810D0 (en) * | 2000-06-06 | 2000-07-26 | Celltech Chiroscience Ltd | Biological products |
| US6660523B2 (en) | 2000-09-21 | 2003-12-09 | Schering Corporation | Dendritic cells; methods |
| EP1351707B9 (en) | 2001-01-09 | 2012-01-25 | Baylor Research Institute | Methods for treating autoimmune diseases in a subject and in vitro diagnostic assays |
| DE20100503U1 (de) | 2001-01-12 | 2001-05-10 | Josef Schiele oHG, 56651 Niederzissen | Beschichtungsvorrichtung für ein langgestrecktes Werkstück |
| US7087726B2 (en) | 2001-02-22 | 2006-08-08 | Genentech, Inc. | Anti-interferon-α antibodies |
| FR2822845B1 (fr) | 2001-03-30 | 2003-12-12 | Genodyssee | Nouveaux polynucleotides comportant des polymorphismes de type snp fonctionnels dans la sequence nucleotidique du gene ifn-alpha-21 ainsi que de nouveaux polypeptides codes par ces polynucleotides et leurs utilisations therapeutiques |
| WO2003068801A2 (en) * | 2002-02-11 | 2003-08-21 | Genentech, Inc. | Antibody variants with faster antigen association rates |
| NZ535425A (en) | 2002-03-13 | 2008-05-30 | Biogen Idec Inc | Anti-alphavbeta6 antibodies |
| US7538195B2 (en) | 2002-06-14 | 2009-05-26 | Immunogen Inc. | Anti-IGF-I receptor antibody |
| US7438907B2 (en) | 2002-11-15 | 2008-10-21 | Genmab A/S | Human monoclonal antibodies against CD25 |
| KR101225299B1 (ko) | 2003-12-10 | 2013-01-24 | 메다렉스, 인코포레이티드 | 인터페론 알파 항체 및 그의 용도 |
| SV2007002227A (es) * | 2004-09-10 | 2007-03-20 | Wyeth Corp | Anticuerpos anti-5t4 humanizados y conjugados anticuerpo anti-5t4/calicheamicina ref. 040000-0317637 |
| CN101056654A (zh) | 2004-10-07 | 2007-10-17 | 苏黎士大学 | 用于预防和治疗银屑病的i型干扰素阻断剂 |
| US7888481B2 (en) | 2005-02-10 | 2011-02-15 | Baylor Research Institute | Anti-interferon alpha monoclonal antibodies and methods for use |
| CN101155831B (zh) * | 2005-02-10 | 2015-08-19 | 贝勒研究院 | 抗干扰素α单克隆抗体及其使用方法 |
| JP5230022B2 (ja) * | 2006-08-09 | 2013-07-10 | ベイラー リサーチ インスティテュート | 抗インターフェロンアルファモノクローナル抗体及び使用方法 |
-
2009
- 2009-05-06 CN CN200980116496.6A patent/CN102083859B/zh not_active Expired - Fee Related
- 2009-05-06 MX MX2010012052A patent/MX2010012052A/es active IP Right Grant
- 2009-05-06 RU RU2010150105/10A patent/RU2532832C2/ru active
- 2009-05-06 CA CA2722622A patent/CA2722622C/en active Active
- 2009-05-06 ES ES09742079.8T patent/ES2549903T3/es active Active
- 2009-05-06 WO PCT/EP2009/055448 patent/WO2009135861A2/en not_active Ceased
- 2009-05-06 BR BRPI0912570A patent/BRPI0912570B8/pt not_active IP Right Cessation
- 2009-05-06 US US12/597,357 patent/US8163885B2/en not_active Expired - Fee Related
- 2009-05-06 EP EP09742079.8A patent/EP2279207B1/en not_active Not-in-force
- 2009-05-06 JP JP2011507904A patent/JP5766598B2/ja not_active Expired - Fee Related
- 2009-05-06 KR KR1020107027445A patent/KR101687032B1/ko not_active Expired - Fee Related
- 2009-05-06 AU AU2009245792A patent/AU2009245792B2/en not_active Ceased
- 2009-05-07 TW TW098115102A patent/TWI453032B/zh not_active IP Right Cessation
-
2010
- 2010-10-28 IL IL208979A patent/IL208979B/en active IP Right Grant
- 2010-12-06 ZA ZA2010/08748A patent/ZA201008748B/en unknown
-
2012
- 2012-02-01 US US13/363,609 patent/US8361463B2/en not_active Expired - Fee Related
- 2012-12-19 US US13/719,536 patent/US8658771B2/en not_active Expired - Fee Related
Non-Patent Citations (1)
| Title |
|---|
| None |
Cited By (15)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8080638B2 (en) | 2005-02-10 | 2011-12-20 | Baylor Research Institute | Anti-interferon alpha monoclonal antibodies and methods for use |
| US8333965B2 (en) | 2005-02-10 | 2012-12-18 | Baylor Research Institute | Anti-inteferon alpha monoclonal antibodies and methods for use |
| EP2714080A4 (en) * | 2011-05-25 | 2014-11-19 | Medimmune Llc | METHODS OF TREATING SYSTEMIC LUPUS ERYTHEMATOSIS, SCLEROMERMIA AND MYOSITIS WITH ANTIBODY AGAINST INTERFERON ALPHA |
| US10155809B2 (en) | 2013-03-15 | 2018-12-18 | Janssen Biotech, Inc. | Interferon alpha and omega antibody antagonists |
| US9902770B2 (en) | 2013-03-15 | 2018-02-27 | Janssen Biotech, Inc. | Interferon alpha and omega antibody antagonists |
| EP2970461A4 (en) * | 2013-03-15 | 2016-11-23 | Janssen Biotech Inc | INTERFERON ALPHA AND OMEGA ANTIBODY ANTAGONISTS |
| EP3157564A4 (en) * | 2014-06-23 | 2018-01-03 | Janssen Biotech, Inc. | Interferon alpha and omega antibody antagonists |
| US10208113B2 (en) | 2014-06-23 | 2019-02-19 | Janssen Biotech, Inc. | Interferon α and ω antibody antagonists |
| US10358491B2 (en) | 2014-06-23 | 2019-07-23 | Janssen Biotech, Inc. | Interferon alpha and omega antibody antagonists |
| US10759854B2 (en) | 2014-06-23 | 2020-09-01 | Janssen Biotech, Inc. | Interferon alpha and omega antibody antagonists |
| AU2015280275B2 (en) * | 2014-06-23 | 2021-02-25 | Janssen Biotech, Inc. | Interferon alpha and omega antibody antagonists |
| US12202892B2 (en) | 2019-04-04 | 2025-01-21 | Janssen Biotech, Inc. | Method of administration of an anti-IFN-α/-ω antibody |
| WO2025247917A1 (en) * | 2024-05-28 | 2025-12-04 | Institut National de la Santé et de la Recherche Médicale | ANTI-IFN-α2 AND ANTI-IFN-ω1 MONOCLONAL ANTIBODIES |
| WO2025247924A1 (en) * | 2024-05-28 | 2025-12-04 | Institut National de la Santé et de la Recherche Médicale | ANTI-IFN-α2 MONOCLONAL ANTIBODIES |
| WO2025247918A1 (en) * | 2024-05-28 | 2025-12-04 | Institut National de la Santé et de la Recherche Médicale | ANTI-IFN-α2 MONOCLONAL ANTIBODIES |
Also Published As
| Publication number | Publication date |
|---|---|
| KR20110042264A (ko) | 2011-04-26 |
| BRPI0912570B1 (pt) | 2021-04-06 |
| ES2549903T3 (es) | 2015-11-03 |
| CN102083859B (zh) | 2014-09-17 |
| JP5766598B2 (ja) | 2015-08-19 |
| US8361463B2 (en) | 2013-01-29 |
| WO2009135861A3 (en) | 2010-01-28 |
| CA2722622A1 (en) | 2009-11-12 |
| IL208979B (en) | 2018-02-28 |
| EP2279207A2 (en) | 2011-02-02 |
| CA2722622C (en) | 2018-01-02 |
| EP2279207B1 (en) | 2015-09-09 |
| HK1154251A1 (zh) | 2012-04-13 |
| JP2011519571A (ja) | 2011-07-14 |
| TWI453032B (zh) | 2014-09-21 |
| KR101687032B1 (ko) | 2016-12-15 |
| RU2010150105A (ru) | 2012-06-20 |
| AU2009245792A1 (en) | 2009-11-12 |
| US20120195888A1 (en) | 2012-08-02 |
| US8163885B2 (en) | 2012-04-24 |
| US20130101602A1 (en) | 2013-04-25 |
| IL208979A0 (en) | 2011-01-31 |
| BRPI0912570A2 (pt) | 2016-04-26 |
| CN102083859A (zh) | 2011-06-01 |
| ZA201008748B (en) | 2013-02-27 |
| TW200950807A (en) | 2009-12-16 |
| BRPI0912570B8 (pt) | 2021-05-25 |
| AU2009245792B2 (en) | 2012-11-01 |
| MX2010012052A (es) | 2010-12-14 |
| US20110213125A1 (en) | 2011-09-01 |
| RU2532832C2 (ru) | 2014-11-10 |
| US8658771B2 (en) | 2014-02-25 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP2279207B1 (en) | Humanized antibodies against human interferon-alpha | |
| CN108367075B (zh) | 4-1bb结合蛋白及其用途 | |
| US11858992B2 (en) | Nucleic acids encoding antibodies that bind and block triggering receptor expressed on myeloid cells-1 (TREM-1) | |
| JP6740308B2 (ja) | 骨髄細胞で発現されるトリガー受容体1(trem−1)に結合し、それを遮断する抗体 | |
| EP2222706A1 (en) | Antibodies against human nkg2d and uses thereof | |
| KR20110039218A (ko) | 항-인간 인터루킨-20 항체 | |
| JP2019081766A (ja) | インターフェロンアルファ及びオメガ抗体アンタゴニスト | |
| HK1154251B (en) | Humanized antibodies against human interferon-alpha | |
| HK40026121A (en) | Antibodies that bind and block triggering receptor expressed on myeloid cells-1 (trem-1) | |
| HK1240253A1 (en) | Antibodies that bind and block triggering receptor expressed on myeloid cells-1 (trem-1) |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 200980116496.6 Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 09742079 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 12597357 Country of ref document: US |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2722622 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2010/012052 Country of ref document: MX |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2011507904 Country of ref document: JP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2009245792 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 7803/CHENP/2010 Country of ref document: IN |
|
| ENP | Entry into the national phase |
Ref document number: 20107027445 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2009742079 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2010150105 Country of ref document: RU |
|
| ENP | Entry into the national phase |
Ref document number: 2009245792 Country of ref document: AU Date of ref document: 20090506 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: PI0912570 Country of ref document: BR Kind code of ref document: A2 Effective date: 20101104 |