WO2009135854A2 - Encapsulation of biologically active agents - Google Patents

Encapsulation of biologically active agents Download PDF

Info

Publication number
WO2009135854A2
WO2009135854A2 PCT/EP2009/055437 EP2009055437W WO2009135854A2 WO 2009135854 A2 WO2009135854 A2 WO 2009135854A2 EP 2009055437 W EP2009055437 W EP 2009055437W WO 2009135854 A2 WO2009135854 A2 WO 2009135854A2
Authority
WO
WIPO (PCT)
Prior art keywords
biologically active
antibody
active agent
particulate carrier
nanoparticles
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2009/055437
Other languages
English (en)
French (fr)
Other versions
WO2009135854A3 (en
Inventor
Mehmet Fidanboylu
Irene Papanicolaou
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Glaxo Group Ltd
Original Assignee
Glaxo Group Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to JP2011507898A priority Critical patent/JP2011519893A/ja
Priority to MX2010012141A priority patent/MX2010012141A/es
Priority to AU2009245785A priority patent/AU2009245785A1/en
Priority to CN2009801270058A priority patent/CN102083423A/zh
Priority to BRPI0912536A priority patent/BRPI0912536A2/pt
Priority to PCT/EP2009/055437 priority patent/WO2009135854A2/en
Priority to US12/991,521 priority patent/US20110059167A1/en
Priority to EP09742072A priority patent/EP2271324A2/en
Application filed by Glaxo Group Ltd filed Critical Glaxo Group Ltd
Priority to EA201001567A priority patent/EA201001567A1/ru
Publication of WO2009135854A2 publication Critical patent/WO2009135854A2/en
Priority to IL208666A priority patent/IL208666A0/en
Priority to ZA2010/07437A priority patent/ZA201007437B/en
Publication of WO2009135854A3 publication Critical patent/WO2009135854A3/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/48Preparations in capsules, e.g. of gelatin, of chocolate
    • A61K9/50Microcapsules having a gas, liquid or semi-solid filling; Solid microparticles or pellets surrounded by a distinct coating layer, e.g. coated microspheres, coated drug crystals
    • A61K9/51Nanocapsules; Nanoparticles
    • A61K9/5107Excipients; Inactive ingredients
    • A61K9/513Organic macromolecular compounds; Dendrimers
    • A61K9/5138Organic macromolecular compounds; Dendrimers obtained by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyvinyl pyrrolidone, poly(meth)acrylates
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0048Eye, e.g. artificial tears
    • A61K9/0051Ocular inserts or implants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/14Particulate form, e.g. powders, Processes for size reducing of pure drugs or the resulting products, Pure drug nanoparticles
    • A61K9/16Agglomerates; Granulates; Microbeadlets ; Microspheres; Pellets; Solid products obtained by spray drying, spray freeze drying, spray congealing,(multiple) emulsion solvent evaporation or extraction
    • A61K9/1605Excipients; Inactive ingredients
    • A61K9/1629Organic macromolecular compounds
    • A61K9/1641Organic macromolecular compounds obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyethylene glycol, poloxamers
    • A61K9/1647Polyesters, e.g. poly(lactide-co-glycolide)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/48Preparations in capsules, e.g. of gelatin, of chocolate
    • A61K9/50Microcapsules having a gas, liquid or semi-solid filling; Solid microparticles or pellets surrounded by a distinct coating layer, e.g. coated microspheres, coated drug crystals
    • A61K9/51Nanocapsules; Nanoparticles
    • A61K9/5107Excipients; Inactive ingredients
    • A61K9/513Organic macromolecular compounds; Dendrimers
    • A61K9/5146Organic macromolecular compounds; Dendrimers obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyethylene glycol, polyamines, polyanhydrides
    • A61K9/5153Polyesters, e.g. poly(lactide-co-glycolide)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/48Preparations in capsules, e.g. of gelatin, of chocolate
    • A61K9/50Microcapsules having a gas, liquid or semi-solid filling; Solid microparticles or pellets surrounded by a distinct coating layer, e.g. coated microspheres, coated drug crystals
    • A61K9/51Nanocapsules; Nanoparticles
    • A61K9/5192Processes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P27/00Drugs for disorders of the senses
    • A61P27/02Ophthalmic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/10Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • a number of drugs have activity at targets in the brain or in the eye, in order to get these to their target they must pass through a biological barrier such as the blood brain barrier. While some molecules are able to cross biological barriers, there are others which do not pass these barriers efficiently or in fact at all. Many drugs are also only efficient when given directly into the target tissue and if this target tissue cannot be reached the drug simply cannot work. Therefore many potentially potent drugs are not useful clinically due to their inability to pass such biological barriers.
  • osmotic agents or cholinomimetic arecolines result in the opening, or a change in the permeability, of the blood brain barrier (Saija A et al, J Pharm. Pha. 42:135-138 (1990)).
  • modifications of proteins to attempt passage across the blood brain barrier include glycating such proteins, or alternatively by forming a prodrug. (WO/2006/029845).
  • Still another approach is the implantation of controlled release polymers which release the active ingredient from a matrix system directly into the nervous tissue.
  • this approach is invasive and requires surgical intervention if implanted directly into the brain or spinal cord (sable et al. US patent no. 4,833,666) this presents problems with patient compliance and often only allows for localised delivery within the brain with the administered drug usually draining away very quickly. (WO/2006/029845).
  • RES reticuloendothelial system
  • Figure 1 shows the sizing data obtained for a nanoparticle formulation by dynamic light scattering (DLS) that indicate the presence of nanoparticles prepared via the hollow method in suspension.
  • DLS dynamic light scattering
  • Fig. 1 (a) Correlogram obtained following analysis of a nanoparticle suspension by dynamic light scattering.
  • Fig 1 Multimodal size distribution (derived data) of the nanoparticles plotted to depict the distribution of the particle population (number) over a range of sizes.
  • Fig. 1 Multimodal size distribution (derived data) of the nanoparticles plotted to depict the distribution of the particle population (number) over a range of sizes.
  • Fig 1 (d) Multimodal size distribution (derived data) of the nanoparticles plotted to depict the distribution of the particle population (number) over a range of sizes.
  • Figure 3 Image of hollow nanoparticles by TEM, with a superimposed image of solid PBCA nanoparticles for comparison.
  • Figure 4 Encapsulation efficiency measurements of monoclonal IgGI (anti-CD23).
  • Figure 5 Release profile obtained following enzymatic degradation of particles and analysis of the released enzyme by ELISA.
  • Figure 6 Determination of the encapsulation efficiency of a domain antibody (hen egg lysozyme dAb) by the bicinchoninic acid assay (BCA assay) in a hollow PBCA nanoparticle.
  • a method of encapsulating biologically active agents in particulate carriers such as methods of encapsulating proteins and or peptides in, or in and on, or with nanoparticles and a method of delivery of proteins and or peptides across the blood brain barrier by encapsulation in, or in and on, or with nanoparticles and a method of delivery of proteins and or peptides to the eye by encapsulation in, or in and on, or with particulate carriers.
  • particulate carriers comprising a particle forming substance and a biologically active agent such as a protein and or peptide, for delivery of a protein and or peptide from the blood to the brain across the blood brain barrier or for delivery to the eye.
  • a biologically active agent such as a protein and or peptide
  • compositions of nanoparticles and their use in treating disorders or diseases of the central nervous system and or eye are provided.
  • the present invention provides particulate carriers comprising a particle forming substance and a biologically active agent, and methods of making said particulate carriers.
  • a polymeric particulate carrier comprising a biologically active agent in an aqueous phase in a hollow lumen.
  • a method of encapsulating biologically active agents in particulate carriers for ocular delivery comprising the steps of: a) dissolving a polymer in an organic solvent to form a polymer solution; b) adding an aqueous solution containing a biologically active agent to the polymer solution to form a primary emulsion of aqueous phase droplets in a continuous organic phase; c) mixing the primary emulsion with an aqueous medium to form a W/O/W emulsion; and d) allowing the organic phase to evaporate and thereby obtain particulate carriers comprising a hollow lumen containing said biologically active agent in an aqueous phase.
  • the ocular delivery is periocular, for example trans-scleral, subconjunctival, sub-tenon, peribulbar, topical, retrobulbar or is delivered to the inferior, superior or lateral rectus muscle.
  • the ocular delivery is trans-scleral.
  • Allowing the organic phase to evaporate may be passive or active.
  • active evaporation may be by the use of heat.
  • a method of producing nanoparticles for delivery of proteins to the blood brain barrier comprising the steps of: a) dissolving a polymer in an organic solvent to form a polymer solution; b) adding an aqueous solution containing protein to the polymer solution to form a primary emulsion of aqueous phase droplets in a continuous organic phase; c) mixing the primary emulsion with an aqueous medium to form a W/O/W emulsion; and d) allowing the organic phase to evaporate and thereby obtain nanoparticles comprising a hollow lumen containing said proteins in an aqueous phase.
  • Allowing the organic phase to evaporate may be passive or active.
  • active evaporation may be by the use of heat.
  • polymer used in any of the methods as described above is selected from but not limited to: poly - L -lactide (PLA), poly(lacto-co-glycolide) (PLG), poly(lactide), poly(caprolactone), poly(hydroxybutyrate) and/or copolymers thereof.
  • Suitable particle-forming materials include, but are not limited to, poly(dienes) such as poly(butadiene) and the like; poly(alkenes) such as polyethylene, polypropylene, and the like; poly(acrylics) such as poly(acrylic acid) and the like; poly(methacrylics) such as poly(methyl methacrylate), poly(hydroxyethyl methacrylate), and the like; polyvinyl ethers); polyvinyl alcohols); polyvinyl ketones); poly(vinylhalides) such as polyvinyl chloride) and the like; polyvinyl nitriles), polyvinyl esters) such as polyvinyl acetate) and the like; polyvinyl pyridines) such as poly(2-vinyl pyridine), poly(5-methyl-2-vinyl pyridine) and the like; poly(styrenes); poly(carbonates); poly(esters); poly(orthoesters); poly(esterarnides); poly(an
  • Also polyacrylates polymethacrylates, polybutylcyanoacrylat.es, polyalkylcyanoacrylat.es, polyarylamides, polyanhydrates, polyorthoesters, N,N-L-lysinediylterephthalate, polyanhydrates, desolvated biologically active agents or carbohydrates, polysaccharides, polyacrolein, polyglutaraldehydes and derivatives, copolymers and polymer blends.
  • a method of encapsulating biologically active agents by producing particulate carriers comprising the steps of: a) dissolving polybutylcyanoacrylate (PBCA) in an organic solvent to form a polymer solution; b) adding an aqueous solution containing a biologically active agent to the polymer solution to form a primary emulsion of aqueous phase droplets in a continuous organic phase; c) mixing the primary emulsion with an aqueous medium to form a W/O/W emulsion; and d) allowing the organic phase to evaporate and thereby obtain particulate carriers comprising a hollow lumen containing said biologically active agent in an aqueous phase.
  • PBCA polybutylcyanoacrylate
  • Allowing the organic phase to evaporate may be passive or active.
  • active evaporation may be by the use of heat.
  • step (d) additionally comprises the addition of gel forming polymers.
  • the gel forming polymer is agarose.
  • the particulate carriers of the present invention comprise biologically active agents such as proteins or peptides.
  • proteins may be antigen binding molecules which as used herein refers to antibodies, antibody fragments and other protein constructs which are capable of binding to a target.
  • Antigen binding molecules may comprise a domain.
  • a "domain” is a folded protein structure which has tertiary structure independent of the rest of the protein.
  • domains are responsible for discrete functional properties of proteins and in many cases may be added, removed or transferred to other proteins without loss of function of the remainder of the protein and/or of the domain.
  • a "single antibody variable domain” is a folded polypeptide domain comprising sequences characteristic of antibody variable domains. It therefore includes complete antibody variable domains and modified variable domains, for example, in which one or more loops have been replaced by sequences which are not characteristic of antibody variable domains, or antibody variable domains which have been truncated or comprise N- or C-terminal extensions, as well as folded fragments of variable domains which retain at least the binding activity and specificity of the full-length domain.
  • Antigen binding molecules may comprise at least one immunoglobulin variable domain, for example such molecules may comprise an antibody, a domain antibody, Fab, Fab', F(ab')2, Fv, ScFv, diabody, heteroconjugate antibody. Such antigen binding molecules may be capable of binding to a single target, or may be multispecific, i.e. bind to a number of targets, for example they may be bispecific or trispecfic.
  • the antigen binding molecule is an antibody.
  • the antigen binding molecule is a domain antibody (dAb).
  • the antigen binding molecule may be a combination of antibodies and antigen binding fragments such as for example, one or more dAbs and or one or more ScFvs attached to a monoclonal antibody. In yet a further embodiment the antigen binding molecule may be a combination of antibodies and peptides.
  • Antigen binding molecules may comprise at least one non-lg binding domain such as a domain that specifically binds an antigen or epitope independently of a different V region or domain, this may be a dAb, for example a human, camelid or shark immunoglobulin single variable domain or it may be a domain which is a derivative of a scaffold selected from the group consisting of CTLA-4 (Evibody); lipocalin; Protein A derived molecules such as Z-domain of Protein A (Affibody, SpA), A-domain (Avimer/Maxibody); Heat shock proteins such as GroEI and GroES; transferrin (trans- body); ankyrin repeat protein (DARPin); peptide aptamer; C-type lectin domain (Tetranectin); human -crystallin and human ubiquitin (affilins); PDZ domains; scorpion toxinkunitz type domains of human protease inhibitors; and fibronectin
  • adnectin (adnectin); which has been subjected to protein engineering in order to obtain binding to a ligand other than the natural ligand.
  • CTLA-4 Cytotoxic T Lymphocyte-associated Antigen 4
  • CTLA-4 is a CD28-family receptor expressed on mainly CD4+ T-cells. Its extracellular domain has a variable domain- like Ig fold. Loops corresponding to CDRs of antibodies can be substituted with heterologous sequence to confer different binding properties.
  • CTLA-4 molecules engineered to have different binding specificities are also known as Evibodies. For further details see Journal of Immunological Methods 248 (1-2), 31-45 (2001 )
  • Lipocalins are a family of extracellular proteins which transport small hydrophobic molecules such as steroids, bilins, retinoids and lipids. They have a rigid -sheet secondary structure with a numer of loops at the open end of the conical structure which can be engineered to bind to different target antigens. Anticalins are between 160-180 amino acids in size, and are derived from lipocalins. For further details see Biochim Biophys Acta 1482: 337-350 (2000), US7250297B1 and US20070224633
  • An affibody is a scaffold derived from Protein A of Staphylococcus aureus which can be engineered to bind to antigen.
  • the domain consists of a three-helical bundle of approximately 58 amino acids. Libraries have been generated by randomisation of surface residues.
  • Protein Eng. Des. SeI. 17, 455-462 (2004) and EP1641818A1 Avimers are multidomain proteins derived from the A-domain scaffold family. The native domains of approximately 35 amino acids adopt a defined disulphide bonded structure. Diversity is generated by shuffling of the natural variation exhibited by the family of A-domains. For further details see Nature Biotechnology 23(12), 1556 -
  • a transferrin is a monomeric serum transport glycoprotein. Transferrins can be engineered to bind different target antigens by insertion of peptide sequences in a permissive surface loop. Examples of engineered transferrin scaffolds include the Trans-body. For further details see J. Biol. Chem 274, 24066-24073 (1999).
  • DARPins Designed Ankyrin Repeat Proteins
  • Ankyrin which is a family of proteins that mediate attachment of integral membrane proteins to the cytoskeleton.
  • a single ankyrin repeat is a 33 residue motif consisting of two -helices and a -turn. They can be engineered to bind different target antigens by randomising residues in the first -helix and a -turn of each repeat. Their binding interface can be increased by increasing the number of modules (a method of affinity maturation).
  • affinity maturation For further details see J. MoI. Biol. 332, 489-503 (2003), PNAS 100(4), 1700-1705 (2003) and J. MoI. Biol. 369, 1015-1028 (2007) and US20040132028A1.
  • Fibronectin is a scaffold which can be engineered to bind to antigen.
  • Adnectins consists of a backbone of the natural amino acid sequence of the 10th domain of the 15 repeating units of human fibronectin type III (FN3). Three loops at one end of the - sandwich can be engineered to enable an Adnectin to specifically recognize a therapeutic target of interest. For further details see Protein Eng. Des. SeI. 18, 435- 444 (2005), US20080139791 , WO2005056764 and US6818418B1.
  • Peptide aptamers are combinatorial recognition molecules that consist of a constant scaffold protein, typically thioredoxin (TrxA) which contains a constrained variable peptide loop inserted at the active site.
  • TrxA thioredoxin
  • Microbodies are derived from naturally occurring microproteins of 25-50 amino acids in length which contain 3-4 cysteine bridges - examples of microproteins include KalataBI and conotoxin and knottins.
  • the microproteins have a loop which can be engineered to include upto 25 amino acids without affecting the overall fold of the microprotein.
  • engineered knottin domains see WO2008098796.
  • Non Ig binding domains include proteins which have been used as a scaffold to engineer different target antigen binding properties include human -crystallin and human ubiquitin (affilins), kunitz type domains of human protease inhibitors, PDZ- domains of the Ras-binding protein AF-6, scorpion toxins (charybdotoxin), C-type lectin domain (tetranectins) are reviewed in Chapter 7 - Non-Antibody Scaffolds from Handbook of Therapeutic Antibodies (2007, edited by Stefan Dubel) and Protein Science 15:14-27 (2006).
  • Non Ig binding domains of the present invention could be derived from any of these alternative protein domains.
  • the antigen binding molecule binds to a target found in the central nervous system such as for example in the brain or spinal cord, or for example in neuronal tissue.
  • the antigen binding molecule specifically binds to a target known to be linked to neurological diseases or disorders such as for example MAG (myelin associated glycoprotein), NOGO (neurite outgrowth inhibitory protein) or ⁇ -amyloid.
  • MAG myelin associated glycoprotein
  • NOGO nerve outgrowth inhibitory protein
  • ⁇ -amyloid a target known to be linked to neurological diseases or disorders
  • antigen binding molecules include antigen binding molecules capable of binding to NOGO for example anti-NOGO antibodies.
  • an anti-NOGO antibody for use in the present invention is the antibody defined by the heavy chain of SEQ ID NO 1 and the light chain of SEQ ID NO 2 or an anti-NOGO antibody or antigen binding fragment thereof which comprises the CDRs of the antibody set out in SEQ ID NO 1 and 2. Further details of this antibody (H28 L16) can be found in PCT application WO2007068750 which is herein incorporated by reference.
  • antigen binding molecules include antigen binding molecules capable of binding to MAG for example anti-MAG antibodies.
  • anti-MAG antibody for use in the present invention is the antibody defined by the heavy chain variable region of SEQ ID NO 1 1 and the light chain variable region of SEQ ID NO 12 or an anti-MAG antibody or antigen binding fragment thereof which comprises the CDRs of the antibody set out in SEQ ID NO 1 and 2.. Further details of this antibody (BvH1 CvL1 ) can be found in PCT application WO2004014953 which is herein incorporated by reference.
  • antigen binding molecules include antigen binding molecules capable of binding to ⁇ -amyloid for example anti- ⁇ -amyloid antibodies.
  • anti- ⁇ - amyloid antibody for use in the present invention is the antibody defined by the heavy chain of SEQ ID NO 5 and or the light chain of SEQ ID NO 6 or an anti- ⁇ -amyloid antibody or antigen binding fragment thereof which comprises the CDRs of the antibody set out in SEQ ID NO 5 and 7. Further details of this antibody (H2L1 ) can be found in PCT application WO2007113172 which is herein incorporated by reference.
  • An alternative anti- ⁇ -amyloid antibody which is of use in the present invention is the anticody defined by the heavy chain of SEQ ID NO 7 and or the light chain of SEQ ID NO 8 or an anti- ⁇ -amyloid antibody or antigen binding fragment thereof which comprises the CDRs of the antibody set out in SEQ ID NO 7 and 8.
  • the CDR sequences of such antibodies can be determined by the Kabat numbering system (Kabat et al; Sequences of proteins of Immunological Interest NIH, 1987), the Chothia numbering system (Al-Lazikani et al., (1997) JMB 273,927-948), the contact definition method (MacCallum R.M., and Martin A.C.R. and Thornton J. M, (1996), Journal of Molecular Biology, 262 (5), 732-745) or any other established method for numbering the residues in an antibody and determining CDRs known to the skilled man in the art.
  • the antigen binding protein binds to a target found in the eye such as for example TNF, TNFr-1 , TNFr-2, TGFbeta receptor-2, VEGF, NOGO, MAG, IL-1 , IL-2, IL-6, IL-8, IL-17, CD20, Beta amyloid, FGF-2, IGF-1 , PEDF, PDGF or a complement factor for example C3, C5, C5aR , CFD, CFH, CFB, CFI, sCR1 or C3,
  • a target found in the eye such as for example TNF, TNFr-1 , TNFr-2, TGFbeta receptor-2, VEGF, NOGO, MAG, IL-1 , IL-2, IL-6, IL-8, IL-17, CD20, Beta amyloid, FGF-2, IGF-1 , PEDF, PDGF or a complement factor for example C3, C5, C5aR , CFD, CFH, CFB, CFI, s
  • the antigen binding protein binds to VEGF. In an alternative embodiment of the invention the antigen binding protein binds to ⁇ - amyloid.
  • the particulate carriers may be microspheres or nanoparticles.
  • the particulate carrier is a nanoparticle and the biologically active agent is a protein.
  • the particulate carrier is a nanoparticle and the biologically active agent is a peptide.
  • the particulate carrier is a nanoparticle and the biologically active agent comprises an antigen binding molecule for example a domain antibody or antibody.
  • the particulate carrier is a nanoparticle and the biologically active agent comprises a domain.
  • the particulate carrier is a microsphere and the biologically active agent is a protein.
  • the particulate carrier is a microsphere and the biologically active agent is a peptide.
  • the particulate carrier is a microsphere and the biologically active agent comprises an antigen binding molecule for example a domain antibody or antibody.
  • the particulate carrier is a microsphere and the biologically active agent comprises a domain.
  • a composition comprising nanoparticles according to any method of the invention as presented herein.
  • at least about 90% of the nanoparticles by number are within the range of about 1 nm to about IOOOnm when measured using dynamic light scattering techniques.
  • at least about 90% of the nanoparticles by number are within the range of about 1 nm to about 400nm, or about 1 nm to about 250nm or about 1 nm to about 150nm, or about 40nm to about 250nm, or about 40nm to about 150nm, or about 40nm to about 100nm when measured using dynamic light scattering techniques.
  • at least about 90% of the nanoparticles by number are within the range of about 40nm to about 250 nm when measured using dynamic light scattering techniques.
  • At least about 90% of the nanoparticles by number are within the range of about 40nm to about 150 nm when measured using dynamic light scattering techniques.
  • a composition comprising the nanoparticles of the present invention wherein the median size of the nanoparticles in the composition is less than about IOOOnm in diameter, for example is less than about 400nm in diameter for example is less than about 250nm in diameter, for example is less than about 150nm in diameter when measured by light scattering techniques.
  • the median size of the nanoparticles in the composition is about 40nm to about 250nm. In yet a further embodiment the median size of the nanoparticles in the composition is about 40nm to about 150nm.
  • a composition comprising microspheres according to any method of the invention as presented herein.
  • at least about 90% of the microspheres by number have a diameter within the range of about 1 ⁇ m to about 100 ⁇ m when measured using Low angle laser light scattering techniques.
  • at least about 90% of the particles by number are within the range of about 1 ⁇ m to about 80 ⁇ m, or about 1 ⁇ m to about 60 ⁇ m or about 1 ⁇ m to about 40 ⁇ m, or about 1 ⁇ m to about 30 ⁇ m or about 1 ⁇ m to about 10 ⁇ m when measured using Low angle laser light scattering techniques.
  • At least about 90% of the microspheres by number are within the range of about 1 ⁇ m to about 60 ⁇ m when measured using Low angle laser light scattering techniques. In yet a further embodiment of the present invention at least about 90% of the microspheres by number are within the range of about 1 ⁇ m to about 30 ⁇ m when measured using Low angle laser light scattering techniques.
  • a composition comprising the microspheres of the present invention wherein the median size of the microspheres in the composition is less than about 100 ⁇ m in diameter, for example is less than about 80 ⁇ m in diameter for example is less than about 60 ⁇ m in diameter, for example is less than about 40 ⁇ m in diameter when measured by Low angle laser light scattering techniques.
  • the median size of the microspheres in the composition is about 1 ⁇ m to about 6 ⁇ m, or 1 ⁇ m to about 30 ⁇ m.
  • the particulate carriers continue to release therapeutic amounts of active biological molecules over a period of at least 3 months or longer, or of up to 6 months or longer or of up to 12 months or longer.
  • the w/w ratio of protein to polymer may be 0.5% to 50% for example is at least about 0.5% or is at least about 1% or is at least about 2% or is at least about 5% or is at least about 7% or is at least about 10% or is at least about 11% or is at least about 14% or is at least about 20% or is at least about 40%, or is at least about 50%.
  • the protein is a peptide the peptide to polymer ratio may be at least about 11
  • the protein is an antibody the antibody to polymer ratio may be at least about 14%
  • the protein is a domain antibody the domain antibody to polymer ratio may be at least about 1 1%.
  • the encapsulation efficiency of the particles is at least about 1% or is at least about 2% or is at least about 10% or is at least about 20% or is at least about 40% or is at least about 50% or is at least about 60% or is at least about 70% or is at least about 80% or is at least about 90% or is alt least about 95% or is least about 97% or is at least about 99%.
  • the encapsulation efficiency may be at least about 60%
  • the protein is an antibody
  • the encapsulation efficiency may be at least about 90%
  • the protein is a domain antibody the encapsulation efficiency may be at least about 60%.
  • organic solvents suitable for use with the methods of the invention include but are not limited to water-immiscible esters such as ethyl acetate, isopropyl acetate, n-propyl acetate, isobutyl acetate, n-butyl acetate, isobutyl isobutyrate, 2- ethylhexyl acetate, ethylene glycol diacetate; water-immiscible ketones such as methyl ethyl ketone, methyl isobutyl ketone, methyl isoamyl ketone, methyl n-amyl ketone, diisobutyl ketone; water-immiscible aldehydes such as acetaldehyde, n- butyraldehyde, crotonaldehyde, 2-ethylhexaldehyde, isobutylaldehyde and propionaldehyde; water-immis
  • the solvent used in the methods of the invention will be selected from methylene chloride, ethylacetate or dimethylsulfoxide, carbon tetrachloride, chloroform, cyclohexane, 1 ,2-dichloroethane, dichloromethane, diethyl ether, dimethyl formamide, heptane, hexane and other hydrocarbons, methyl-tert- butyl ether, pentane, toluene, 2,2,4-trimethylpentane, 1-octanol and its isomers, benzyl alcohol.
  • the particulate carriers, compositions comprising them or methods of making them in all aspects of the present invention as herein described may further comprise the addition of a surfactant such as but not limited to: sodium cholate, poloxamer 188 (pluronic F68TM, or F127), polyvinyl alcohol, polyvinyl pyrrolidone, polysorbate 80, dextrans.
  • a surfactant such as but not limited to: sodium cholate, poloxamer 188 (pluronic F68TM, or F127), polyvinyl alcohol, polyvinyl pyrrolidone, polysorbate 80, dextrans.
  • the surfactant is selected from sodium cholate, poloxamer 188 (pluronic F68TM), polyvinyl alcohol, polyvinyl pyrrolidone, polysorbate 80 and dextrans.
  • particulate carriers comprising biologically active agents, obtainable by any of the methods of the invention herein described.
  • the biologically active agent encapsulated in particulate carriers and or compositions of the present invention retains at least some biological activity on its release from the particulate carrier, for example, a proportion of the molecules in the composition may retain at least some ability to bind to their target when the agent is a binding agent and elicit a biological response on the release of the biologically active agent from the particles.
  • binding can be measured in a suitable biological binding assay, examples of suitable assays include but are not limited to ELISA or BiacoreTM.
  • the composition retains at least 50% of its affinity for the target, or at least 70% or at least 90% of its affinity (Kd) for the target when measured by a biological binding assay on release from the particles for example in one embodiment as determined by ELISA, Biacore.
  • the composition will be capable of eliciting a therapeutic effect in the subject to which it is administered.
  • the biological activity of the compositions of the invention can be measured by any suitable assay which measures activity of the encapsulated biologically active molecule.
  • a method of delivering a protein across a biological barrier such as the blood brain barrier by encapsulation of the protein in a nanoparticle to a patient.
  • the patient is human.
  • a method of delivering a protein encapsulated in a particulate carrier such as a microsphere to the eye of a mammal, for example a human.
  • composition comprising a biologically active agent encapsulated in a particulate carrier of the present invention as herein described.
  • a pharmaceutical composition comprising a protein encapsulated in the nanoparticles of the present invention as herein described.
  • a pharmaceutical composition comprising a protein encapsulated in microspheres for ocular delivery as herein described for treating and or preventing a disease of the eye.
  • composition of the present invention may be used to treat and or prevent disorders or diseases which involve the particulate carriers crossing the blood brain barrier.
  • composition of the invention as herein described may be used to treat and or prevent disorders or diseases of the Central nervous system, for example it may be used to treat and or prevent Alzheimer's disease, Huntington's disease, bovine spongiform encephalopathy, West Nile virus encephalitis, Neuro-
  • AIDS brain injury, spinal cord injury, metastatic cancer of the brain, or multiple sclerosis, stroke.
  • composition may comprise an anti-MAG antibody for the treatment and or prevention of stroke or neuronal injury.
  • composition may comprise an anti-NOGO antibody for the treatment and or prevention of stroke or neuronal injury or for example for the treatment or prophylaxis of neurodegenerative diseases such as Alzheimer's disease.
  • composition may comprise an anti- ⁇ amyloid antibody for the treatment and or prevention of stroke or neuronal injury or for example for the treatment or prophylaxis of neurodegenerative diseases such as Alzheimer's disease.
  • the particulate carriers may be administered to the patient by parenteral injection or infusion, intravenous, or intraarterial administration.
  • compositions of the invention as herein described may be used to treat and or prevent disorders or diseases of the eye.
  • a composition of the invention as herein described may be used to treat and or prevent disorders such as but not limited to age related macular degeneration (neovascular/ wet), diabetic retinopathy, retinal venous occlusive disease, uveitis, corneal neovascularisation or glaucoma.
  • composition is used to treat and or prevent AMD (age related macular degeneration), for example wet AMD, or dry AMD.
  • AMD age related macular degeneration
  • biologically active agents encapsulated in nanoparticles and or microspheres as described herein for use in medicine.
  • compositions of the invention as described herein in the manufacture of a medicament for the treatment and or prevention of a disease of the central nervous system.
  • use of a composition of the invention as described herein in the manufacture of a medicament for the treatment and or prevention of Alzheimer's disease in yet a further embodiment there is provided the use of a composition of the invention as described herein in the manufacture of a medicament for the treatment and or prevention of stroke or neuronal injury.
  • composition of the invention as described herein in the manufacture of a medicament for the treatment or prevention of ocular diseases such as for example in the manufacture of a medicament for the treatment and or prevention of AMD.
  • the invention provides methods of treating and or preventing a disease of the central nervous system using a composition of the present invention.
  • a method of treating Alzheimer's disease using a composition of the present invention there is provided a method of treating and or preventing stroke or neuronal injury using a composition of the present invention.
  • the invention also provides methods of treating and or preventing ocular disease using a composition of the present invention.
  • a method of treating and or preventing AMD using a composition of the present invention is provided.
  • particle forming substance is used to describe any monomer and or oligomer capable of polymerising, or a polymer which can form an insoluble particle in an aqueous environment for example PBCA, PLGA.
  • the particle forming substance will be soluble in an organic solvent when not polymerised.
  • particulate carrier as used throughout this specification is used to cover both nanoparticles and microspheres.
  • Microspheres are particles composed of various natural and synthetic materials with diameters larger than 1 ⁇ m whereas “nanoparticles” as used herein are submicron sized particles such as for example 1- "lOOOnm.
  • the terms particulate carrier, nanoparticles and microspheres as used herein denotes a carrier structure which is biocompatible and sufficiently resistant to chemical and/or physical destruction by the environment of use such that a sufficient amount of the particles remain substantially intact after entry in to the human or animal body following administration and for sufficient time so as to be able to reach the desired target organ or tissue e.g. the brain or the eye.
  • Bioly active agent as used herein is a term used to indicate that the molecule must be capable of at least some biological activity when reaching their desired target.
  • biologically active agent and the “biologically active molecule” as used throughout the specification are intended as to have the same meaning and able to be used interchangeably.
  • solubilisation is defined as either formation of a solution, in the form of individual molecules in the solvent, or formation of a solid in liquid suspension, in the form of fine solid aggregates of molecules suspended in the liquid. The solubilisation process may also result in a mixture of fully dissolved molecules and suspended solid aggregates.
  • protein as used throughout this specification for encapsulation in particulate carriers includes proteins having a molecular weight of at least 1 1 kDa, or at least 12kDa, or at least 5OkDa, or at least 10OkDa, or at least 15OkDa or at least 20OkDa. Proteins for encapsulation may also be of considerable length such as at least 70 amino acids in length or at least 100 amino acids in length or at least 150 amino acids in length or at least 200 amino acids in length.
  • peptide as used throughout this specification for encapsulation in particulate carriers includes shorter sequences of amino acids having a molecular weight of no more than about 10 kDa, or no more than about 8 kDa, or no more than about 5 kDa, or no more than about 2 kDa or no more than about 1 kDa or is less than 1 Kda.
  • Peptides for encapsulation are no more than 70 amino acids in length or are no more than 50 amino acids in length, or are no more than are no more than 40 amino acids in length, or are no more than 20 amino acids in length or are less than 10 amino acids in length.
  • Periodic refers to local administration to positions surrounding the outside of the eye and includes but is not limited to: "Sub-conjuctival” - underneath the conjuctiva - a clear mucus membrane that covers the eyeball over the sclera; "Sub-tenon” - underneath the Tenon's membrane that envelopes the eye but outside of the sclera; "peribulbar” - the space underneath the globe of the eye where it sits in the eye socket; “retrobulbar” - the space at the very back of the globe of the eye, close to the optic nerve; “supra-choroidal” - underneath the sclera but outside of the choroid into the supra-choroidal space; "trans-scleral” - this term can also be used to mean delivery across, i.e. from outside of the sclera.
  • immunoglobulin single variable domain refers to an antibody variable domain (V H , V HH , V L) that specifically binds an antigen or epitope independently of a different V region or domain.
  • An immunoglobulin single variable domain can be present in a format (e.g., homo- or hetero-multimer) with other, different variable regions or variable domains where the other regions or domains are not required for antigen binding by the single immunoglobulin variable domain (i.e., where the immunoglobulin single variable domain binds antigen independently of the additional variable domains).
  • a “domain antibody” or “dAb” is the same as an "immunoglobulin single variable domain" which is capable of binding to an antigen as the term is used herein.
  • An immunoglobulin single variable domain may be a human antibody variable domain, but also includes single antibody variable domains from other species such as rodent (for example, as disclosed in WO 00/29004, nurse shark and Camelid V HH dAbs.
  • Camelid V HH are immunoglobulin single variable domain polypeptides that are derived from species including camel, llama, alpaca, dromedary, and guanaco, which produce heavy chain antibodies naturally devoid of light chains.
  • Such V HH domains may be humanised according to standard techniques available in the art, and such domains are still considered to be "domain antibodies" according to the invention.
  • V H includes camelid V HH domains.
  • antigen binding molecule refers to antibodies, antibody fragments and other protein constructs which are capable of binding to a target.
  • a “domain” is a folded protein structure which has tertiary structure independent of the rest of the protein. Generally, domains are responsible for discrete functional properties of proteins and in many cases may be added, removed or transferred to other proteins without loss of function of the remainder of the protein and/or of the domain.
  • a “single antibody variable domain” is a folded polypeptide domain comprising sequences characteristic of antibody variable domains. It therefore includes complete antibody variable domains and modified variable domains, for example, in which one or more loops have been replaced by sequences which are not characteristic of antibody variable domains, or antibody variable domains which have been truncated or comprise N- or C-terminal extensions, as well as folded fragments of variable domains which retain at least the binding activity and specificity of the full-length domain.
  • Light scattering techniques as used herein is a means used to determine the size distribution profile of small particles in solution - one example of light scattering technique is dynamic light scattering which may be used to measure nanoparticles and another example of light scattering is static light scattering or low angle light scattering which may be used to measure microspheres.
  • DLS Dynamic light scattering
  • Dynamic light scattering relies on the fact that when in liquid suspension, the Brownian motion of particles is dependent on particle size and that the Brownian motion of the particles produces fluctuations in the intensity of light scattered from a particle sample.
  • the particle diameter is derived by analysing these fluctuations by means of a correlation function. The Stokes-Einstein equation is then applied to yield the mean hydrodynamic diameter of the particles.
  • a multi-exponential analysis can produce a size distribution, providing insight into the presence of different species inside a sample.
  • DLS is generally accepted for the analysis of nanoparticles.
  • "Static light scattering” or “Low angle laser light scattering” which are used interchangeably throughout the present specification is sometimes referred to as Laser diffraction.
  • Laser diffraction relies on the fact that the diffraction angle is inversely proportional to particle size. The method utilises the full Mie theory which completely solves the equations for the interaction of light with matter.
  • Laser diffraction can be used for the analysis of nanoparticles and microparticles (0.02 to 2000 micrometers in diameter).
  • BLB Blood brain barrier
  • percentage drug loading is defined as the percentage of weight of drug per weight of material used in the particle formulation
  • % drug loading (weight of drug / weight of material used in the particle formulation) x 100%.
  • BCA monomer 200 ⁇ l, Vetbond, 3M
  • 1 ml absolute ethanol 1 ml absolute ethanol
  • the resulting solution was gently mixed until the polymerisation reaction was initiated.
  • the polymerisation reaction resulted in the formation of a white solid dispersion.
  • the mixing of the dispersion was stopped as soon as the reaction mixture became too viscous to agitate.
  • the ethanol in the reaction mixture was then allowed to evaporate in the fume-hood for at least 1 hour. Following evaporation of the ethanol, a cracked white solid cake was obtained. The solid was collected and used in the nanoparticle preparation process.
  • Example 2 Preparation of hollow nanoparticles by the double emulsion method:
  • the PBCA polymer was dissolved in dichloromethane at a concentration of 1% w/v and used to prepare hollow PBCA nanoparticles by emulsification into a double emulsion (water in oil in water, w/o/w) as follows:
  • the total volume of the inner aqueous phase was 1 ml.
  • the solution was kept on ice until it was time to use it.
  • Each solution was drawn into a 1 ml insulin syringe (Terumo 1 ml, BD microlance needle 19G 1.5") prior to use.
  • the organic phase (PBCA polymer in DCM, 6 ml) was poured into a 10ml beaker (resting on ice to keep cool) and the probe of the homogeniser was inserted (Ultra- Turrax, T25, 50ml probe). The solution was covered with parafilm (attached to the beaker and probe) and homogenised at a speed of 24,000 rpm using a rotor stator homogeniser (Ulltra-Turrax T25 basic). Formation of a primary emulsion:
  • the inner aqueous phase was added by injecting inside the solution close to the probe.
  • the resulting emulsion was homogenised for 2 minutes (on ice) and then transferred to a glass syringe (SGE, 25 ml, gas-tight, suitable for organic solvents, P/N 009462 25MDR-LL-GT, Batch # F06-A2190, fitted with a blunt 5 cm 2R2 needle, 0.7 mm ID).
  • SGE glass syringe
  • Inner phase (w/o) primary emulsion from homogenisation step described above.
  • the primary single emulsion (w/o) was used to form a double emulsion (w/o/w) by addition to a secondary aqueous phase (1.25% w/v sodium cholate) with homogenisation.
  • the sodium cholate solution (1.25 % w/v, 30 ml) was transferred to a tall 50 ml beaker (resting on ice to keep emulsion cool) and the probe of a Silverson L4RT homogeniser was inserted (3/4 inch probe, high emulsor screen).
  • the solution was covered with parafilm (attached to the beaker and probe) and homogenised at a speed of 8,000 rpm.
  • the primary emulsion was injected into the solution close to the probe as soon as the 8,000 rpm speed was reached.
  • the resulting emulsion was homogenised for 6 minutes.
  • the double emulsion that was formed was transferred to a short 50 ml beaker and the organic phase allowed to evaporate in the fume hood under constant stirring (IKA magnetic stirrer, setting 4) for 3 hours.
  • the nanoparticles that were formed were washed once by centrifugation at 16,200 rcf and re-suspended in water (10 ml).
  • nanoparticles were confirmed by sizing using quasi-elastic light scattering (QELS), also known as dynamic light scattering (DLS).
  • QELS quasi-elastic light scattering
  • DLS dynamic light scattering
  • the particles were analysed using a Brookhaven Instruments corporation particle size analyser (BIC 90 plus) following the standard procedure provided by the manufacturer.
  • the particle suspension was diluted 20Ox in water and sized using standard sizing parameters (temperature of 25°C, laser beam angle of 90°, laser wavelength of 658 nm).
  • the particles were analysed by performing 10 sizing runs of 1 minute in duration each.
  • the instrument presented the raw data in the standard form of a correlogram. This depicts the autocorrelation function C ( ⁇ ) of scattered light intensity from the particles at different time intervals and how the autocorrelation decays with the decay time ⁇ .
  • the decay in the autocorrelation of scattered light is dependent on particle diameter and is more rapid for smaller particles.
  • the instrument derives information on particle size by applying the Stokes-Einstein equation. This yields the mean hydrodynamic diameter of the particles in the sample and further derived data on the particle population.
  • Dynamic light scattering is very sensitive to the presence of large particles, which even when they represent less than 1% of the sample can significantly influence the measurements.
  • the mean hydrodynamic diameter that the instrument gives which is heavily influenced by the large particles in the sample could vary substantially.
  • differences in size of tens of nanometers between batches can be observed and for this reason it is important to look at the complete data set that the instrument provides, with the correlogram being the most important.
  • the shape of the correlogram itself provides a very clear indication of whether the particles are small, as well as whether the sample is polydisperse.
  • the baseline index also gives an accurate representation of the quality of the data. All of the data in this document exhibited a baseline index that did not fall below 5, with 10 being the maximum for the highest possible quality of a reading.
  • Figure 1 a shows the correlogram (raw data) obtained following sizing of the particle suspension by QELS.
  • the correlogram clearly showed that a nanoparticle suspension had been generated by the particle preparation process, as absence of particles would not generate any light scattering.
  • the shape of the correlogram suggested that the suspension was of good pharmaceutical quality, as the particles were small and no large aggregates were present.
  • Sizing of the nanoparticle suspension by QELS showed that nanoparticles of a mean hydrodynamic diameter of 262.6 nm had formed (figure 1a).
  • the particle population was also found to be relatively monodisperse, with the polydispersity index, which is a measure of how broad the range of particle sizes in the sample is, at 0.262 (figure 1a). This is below the maximum acceptable value of 0.300 for a particle formulation.
  • the correlogram confirmed that the double emulsion process had successfully generated a good quality suspension of PBCA nanoparticles.
  • Figure 1 Sizing data obtained by QELS that indicate the presence of nanoparticles in suspension.
  • Fig. 1 (a) Correlogram obtained following analysis of a nanoparticle suspension by dynamic light scattering. According to the data obtained, the mean hydrodynamic diameter of the particles was 262.6 nm and the polydispersity index 0.262.
  • Fig 1 (b) Multimodal size distribution (derived data) of the nanoparticles plotted to depict the distribution of the particle population (number) over a range of sizes. The majority (87.5 %) of the particle population appeared to have a diameter of 138.19 nm or lower.
  • Fig. 1 Multimodal size distribution (derived data) of the nanoparticles plotted to depict the distribution of the particle population (number) over a range of sizes.
  • the data suggests that 87.5% possessed a diameter of 138.19nm or lower and that 100% of the particle sample possessed a diameter of 506.81 nm or lower. Therefore, the suspension was free of large aggregates and was therefore considered to be suitable for intravenous administration.
  • Fig 1 (d) Multimodal size distribution (derived data) of the nanoparticles plotted to depict the distribution of the particle population (number) over a range of sizes. The data suggest that 14.9% of the particle sample possesses a diameter of 99.86 nm or lower.
  • Table 1 summarises the sizing data obtained from a series of four different formulation runs: Table 1
  • the hollow PBCA nanoparticle preparation process was found to generate nanoparticle suspensions that were of the desired diameter and polydispersity.
  • Example 4 Analysis of nanoparticles - confirmation of nanoparticle formation and hollow morphology by electron microscopy
  • Nanoparticle suspensions were examined by transmission electron microscopy (TEM). Freeze-dried nanoparticles were analysed by scanning electron microscopy (SEM). Analysis by both microscopy techniques confirmed the formation of nanoparticles. SEM showed that stable nanoparticles were formed. TEM confirmed that the nanoparticles were hollow, possessing an aqueous core surrounded by a PBCA polymer wall.
  • FIG. 1 shows nanoparticles analysed by SEM
  • Figure 3 shows an image of hollow nanoparticles by TEM, with a superimposed image of solid PBCA nanoparticles for comparison.
  • Example - 5 Encapsulation of monoclonal antibody (human anti-CD23) within the hollow PBCA nanoparticles
  • Monoclonal antibody (human anti-CD 23 mAb as disclosed in WO99/58679) was entrapped within the aqueous core of the nanoparticles by inclusion into the inner aqueous phase of the homogenisation process.
  • a solution of the antibody was used to prepare the primary emulsion (w/o), which was then homogenised with the secondary aqueous phase to form the double emulsion (w/o/w) as follows:
  • the total volume of the inner aqueous phase was 1 ml.
  • the solution was kept on ice until it was time to use it.
  • Each solution was drawn into a 1 ml insulin syringe (Terumo 1 ml, BD microlance needle 19G 1.5") prior to use.
  • the organic phase (PBCA polymer in DCM, 6 ml) was poured into a 10ml beaker (resting on ice to keep cool) and the probe of the homogeniser was inserted (Ultra- Turrax, T25, 50ml probe). The solution was covered with parafilm (attached to the beaker and probe) and homogenised at a speed of 24,000 rpm.
  • the inner aqueous phase was added by injecting inside the solution close to the probe.
  • the resulting emulsion was homogenised for 2 minutes (on ice) and then transferred to a glass syringe (SGE, 25 ml, gas-tight, suitable for organic solvents, P/N 009462 25MDR-LL-GT, Batch # F06- A2190, fitted with blunt 5 cm 2R2 needle, 0.7 mm ID).
  • SGE glass syringe
  • Inner phase (w/o) primary emulsion from homogenisation step described above.
  • Outer phase (w) sodium cholate (1.25% w/v) in water.
  • the primary, single emulsion (w/o) was used to form a double emulsion (w/o/w) by addition to a secondary aqueous phase (1.25% w/v sodium cholate) with homogenisation.
  • the sodium cholate solution (1.25 % w/v, 30 ml) was transferred to a tall 50 ml beaker (resting on ice to keep emulsion cool) and the probe of a Silverson L4RT homogeniser was inserted (3/4 inch probe, high emulsor screen).
  • the solution was covered with parafilm (attached to the beaker and probe) and homogenised at a speed of 8,000 rpm.
  • the primary emulsion was injected into the solution close to the probe as soon as the 8,000 rpm speed was reached.
  • the resulting emulsion was homogenised for 6 minutes.
  • the double emulsion that was formed was transferred to a short 50 ml beaker and the organic phase allowed to evaporate in the fume hood under constant stirring (IKA magnetic stirrer, setting 4) for 3 hours.
  • the resulting nanoparticles were pelleted by centrifugation to separate free from encapsulated antibody. Both pellet (entrapped antibody) and supernatant (free antibody) were analysed by total protein assay in order to determine the encapsulation efficiency.
  • the encapsulation efficiency was found to be 52%, when a total amount of 600 ⁇ g antibody was used.
  • the efficiency of encapsulation was found to be sufficiently high to permit the delivery of potentially therapeutic amounts of antibody without exceeding the maximum tolerated dose of PBCA polymer (50 mg/kg in the mouse).
  • PBCA polymer 50 mg/kg in the mouse.
  • Figure 4 show the results obtained from the encapsulation efficiency measurements.
  • Example 7 Encapsulation of domain antibody (anti-hen egg lysozyme dAb) within the hollow PBCA nanoparticles
  • the BCA assay was performed using a BCA kit obtained from Sigma (QPBCA) and carried out according to the instructions. Free dAb was diluted 2 fold and 10 fold for analysis. The encapsulated dAb was diluted 100 fold.
  • Domain antibody (anti-hen egg lysozyme dAb) was entrapped within the aqueous core of the nanoparticles by inclusion into the inner aqueous phase of the homogenisation process.
  • the inner aqueous phase was prepared by mixing 0.5 ml of a 20 mg/ml solution of dAb (10 mg protein) and 0.5 ml of a stabiliser solution (sodium cholate, 10% w/v).
  • the nanoparticles were then prepared by the double emulsion process as described in example 4.
  • the resulting nanoparticles were pelleted by centrifugation to separate free from encapsulated antibody.
  • Example 8 Encapsulation of monoclonal antibody (anti-IL-13 mAb) within the hollow PBCA nanoparticles.
  • Monoclonal antibody (anti-IL-13 mAb) was entrapped within the aqueous core of the nanoparticles by inclusion into the inner aqueous phase of the homogenisation process.
  • the inner aqueous phase was prepared by mixing 0.5 ml of a 20 mg/ml solution of mAb (10 mg protein) and 0.5 ml of a stabiliser solution (sodium cholate, 10% w/v).
  • the nanoparticles were then prepared by the double emulsion process as described in Example 5. The resulting nanoparticles were pelleted by centrifugation to separate free from encapsulated antibody.
  • MGWSCI I LFLVATATGVHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTSYWMHW VRQAPGQGLEWIGNINPSNGGTNYNEKFKSKATMTRDTSTSTAYMELSSLRSEDTA VYYCELMQGYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSWTVPSSSLGTQTYICNVNHKPS NTKVDKKVEPKSCDKTHTCPPCPAPELAGAPSVFLFPPKPKDTLMISRTPEVTCVW DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEY KCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDI AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ
  • SEQ ID NO. 2 2A10 light chain humanised construct L16
  • SEQ ID NO. 4 2A10 light chain humanised construct L16
  • SEQ ID NO. 5 Mature H2 heavy chain amino acid sequence
  • SEQ ID NO. 6 Mature Light chain amino acid sequence DIVMTQSPLSLPVTPGEPASISCRVSQSLLHSNGYTYLHWYLQKPGQSPQLLIYKVS NRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCSQTRHVPYTFGGGTKVEIKR TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVT EQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
  • SEQ ID NO. 7 Mature H1 1 heavy chain amino acid sequence
  • SEQ ID NO. 8 Mature L9 light chain amino acid sequence
  • DIVMTQSPLSNPVTPG EPASISCRSSKSLLHRNGITYLYWYLQKPGQSPQLLIYQMS NLASGVPDRFSSSGSGTDFTLKISRVEAEDVGVYYCAQNLELWTFGQGTKVEIKRT VAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTE QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
  • SEQ ID NO. 10 DOM15-26-593 VEGF dAb sequence:
  • SEQ ID NO. 12 BvH1 variable region QVQLVQSGSELKKPGASVKVSCKASGYTFTNYGMNWVRQAPGQGLEWMGWINTY TGEPTYADDFTGRFVFSLDTSVSTAYLQISSLKAEDTAVYYCARNPINYYGINYEGYV MDYWGQGTLVTVSS.
  • SEQ ID NO. 13 H2 Full length DNA sequence

Landscapes

  • Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Health & Medical Sciences (AREA)
  • Epidemiology (AREA)
  • Biomedical Technology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Physics & Mathematics (AREA)
  • Optics & Photonics (AREA)
  • Nanotechnology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Ophthalmology & Optometry (AREA)
  • Neurology (AREA)
  • Virology (AREA)
  • Neurosurgery (AREA)
  • Oncology (AREA)
  • Cardiology (AREA)
  • Psychiatry (AREA)
  • Vascular Medicine (AREA)
  • Urology & Nephrology (AREA)
  • Hospice & Palliative Care (AREA)
  • Molecular Biology (AREA)
  • Communicable Diseases (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Hematology (AREA)
  • Medicinal Preparation (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)
  • Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
PCT/EP2009/055437 2008-05-06 2009-05-05 Encapsulation of biologically active agents Ceased WO2009135854A2 (en)

Priority Applications (11)

Application Number Priority Date Filing Date Title
US12/991,521 US20110059167A1 (en) 2008-05-06 2009-05-05 Encapsulation of biologically active agents
AU2009245785A AU2009245785A1 (en) 2008-05-06 2009-05-05 Encapsulation of biologically active agents
CN2009801270058A CN102083423A (zh) 2008-05-06 2009-05-05 生物活性剂的囊封方法
BRPI0912536A BRPI0912536A2 (pt) 2008-05-06 2009-05-05 método para produzir um carregador particulado, carreador particulado, composição farmacêutica, e, e uso da mesma.
PCT/EP2009/055437 WO2009135854A2 (en) 2008-05-06 2009-05-05 Encapsulation of biologically active agents
EP09742072A EP2271324A2 (en) 2008-05-06 2009-05-05 Encapsulation of biologically active agents
EA201001567A EA201001567A1 (ru) 2008-05-06 2009-05-05 Инкапсуляция биологически активных агентов
JP2011507898A JP2011519893A (ja) 2008-05-06 2009-05-05 生物活性薬の封入
MX2010012141A MX2010012141A (es) 2008-05-06 2009-05-05 Encapsulacion de agentes biologicamente activos.
IL208666A IL208666A0 (en) 2008-05-06 2010-10-12 Encapsulation of biologically active agents
ZA2010/07437A ZA201007437B (en) 2008-05-06 2010-10-18 Encapsulation of biologically active agents

Applications Claiming Priority (5)

Application Number Priority Date Filing Date Title
US5077508P 2008-05-06 2008-05-06
US61/050,775 2008-05-06
US7417108P 2008-06-20 2008-06-20
US61/074,171 2008-06-20
PCT/EP2009/055437 WO2009135854A2 (en) 2008-05-06 2009-05-05 Encapsulation of biologically active agents

Publications (2)

Publication Number Publication Date
WO2009135854A2 true WO2009135854A2 (en) 2009-11-12
WO2009135854A3 WO2009135854A3 (en) 2010-11-04

Family

ID=43125568

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2009/055437 Ceased WO2009135854A2 (en) 2008-05-06 2009-05-05 Encapsulation of biologically active agents

Country Status (11)

Country Link
US (1) US20110059167A1 (https=)
EP (1) EP2271324A2 (https=)
JP (1) JP2011519893A (https=)
CN (1) CN102083423A (https=)
AU (1) AU2009245785A1 (https=)
BR (1) BRPI0912536A2 (https=)
EA (1) EA201001567A1 (https=)
IL (1) IL208666A0 (https=)
MX (1) MX2010012141A (https=)
WO (1) WO2009135854A2 (https=)
ZA (1) ZA201007437B (https=)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017085212A3 (en) * 2015-11-20 2017-06-29 AbbVie Deutschland GmbH & Co. KG Surface-modified nanospheres encapsulating antigen-binding molecules

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20110064819A1 (en) * 2008-05-06 2011-03-17 Andrew Beaton Encapsulation of biologically active agents
US9802984B2 (en) 2013-06-07 2017-10-31 The Johns Hopkins University Biomimetic peptide and biodegradable delivery platform for the treatment of angiogenesis- and lymphangiogenesis-dependent diseases
US11491114B2 (en) * 2016-10-12 2022-11-08 Curioralrx, Llc Formulations for enteric delivery of therapeutic agents

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU3462193A (en) * 1993-02-15 1994-08-29 Shield Research Limited Polyalkylcyanoacrylate nanocapsules
ES2152990T3 (es) * 1993-09-09 2001-02-16 Schering Ag Principios activos y microparticulas que contienen gases.
AU7134898A (en) * 1997-04-17 1998-11-11 Amgen, Inc. Biodegradable microparticles for the sustained delivery of therapeutic drugs
US20030152636A1 (en) * 2000-02-23 2003-08-14 Nanopharm Ag Method of treating cancer
US7332159B2 (en) * 2004-09-30 2008-02-19 Board Of Regents Of The University Of Nebraska Method and composition for inhibiting reperfusion injury in the brain
US7597907B2 (en) * 2004-11-05 2009-10-06 Trustees Of The University Of Pennsylvania Antioxidant polymer nanocarriers for use in preventing oxidative injury

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017085212A3 (en) * 2015-11-20 2017-06-29 AbbVie Deutschland GmbH & Co. KG Surface-modified nanospheres encapsulating antigen-binding molecules

Also Published As

Publication number Publication date
EP2271324A2 (en) 2011-01-12
MX2010012141A (es) 2010-12-17
WO2009135854A3 (en) 2010-11-04
US20110059167A1 (en) 2011-03-10
BRPI0912536A2 (pt) 2018-10-16
IL208666A0 (en) 2010-12-30
JP2011519893A (ja) 2011-07-14
AU2009245785A1 (en) 2009-11-12
EA201001567A1 (ru) 2011-08-30
CN102083423A (zh) 2011-06-01
ZA201007437B (en) 2012-03-28

Similar Documents

Publication Publication Date Title
EP2441447A1 (en) Encapsulation of biologically active agents
US20110059142A1 (en) Encapsulation of biologically active agents
Li et al. Nanoparticulate drug delivery to the retina
Zaman et al. Nanoparticle formulations that allow for sustained delivery and brain targeting of the neuropeptide oxytocin
Liu et al. Anti-angiogenic activity of bevacizumab-bearing dexamethasone-loaded PLGA nanoparticles for potential intravitreal applications
JP5484339B2 (ja) 合成物の持続的な放出のためのデンドリマー
Li et al. Controlled release of bevacizumab through nanospheres for extended treatment of age-related macular degeneration
Ye et al. Pharmacokinetics and distributions of bevacizumab by intravitreal injection of bevacizumab-PLGA microspheres in rabbits
Prow Toxicity of nanomaterials to the eye
Kim et al. Intraocular distribution and kinetics of intravitreally injected antibodies and nanoparticles in rabbit eyes
US20110059167A1 (en) Encapsulation of biologically active agents
Kim et al. Anisotropic poly (lactic-co-glycolic acid) microparticles enable sustained release of a peptide for long-term inhibition of ocular neovascularization
Hamdi et al. Drug-loaded nanocarriers for back-of-the-eye diseases-formulation limitations
US20110064819A1 (en) Encapsulation of biologically active agents
Eldem et al. Ocular drug, gene and cellular delivery systems and advanced therapy medicinal products
CN105338961A (zh) 制备包含治疗性蛋白质的颗粒的方法
Pandhare et al. Biodegradable polymeric implants for retina and posterior segment disease
Zhang Kinetics of polymeric nanoparticulate carriers and cargo under physiological and pathological conditions in the retina
Natarajan et al. Drug, delivery and devices for diabetic retinopathy (3Ds in DR)
하승민 Intraocular distribution and kinetics of intravitreally injected non-biodegradable nanoparticles in rabbits

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 200980127005.8

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 09742072

Country of ref document: EP

Kind code of ref document: A2

WWE Wipo information: entry into national phase

Ref document number: 3870/KOLNP/2010

Country of ref document: IN

WWE Wipo information: entry into national phase

Ref document number: 2009245785

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 201001567

Country of ref document: EA

WWE Wipo information: entry into national phase

Ref document number: 2009742072

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2011507898

Country of ref document: JP

Ref document number: MX/A/2010/012141

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: 12991521

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2009245785

Country of ref document: AU

Date of ref document: 20090505

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20107027240

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: PI0912536

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20101104