WO2006044857A2 - Vaccines against japanese encephalitis virus and west nile virus - Google Patents

Vaccines against japanese encephalitis virus and west nile virus Download PDF

Info

Publication number
WO2006044857A2
WO2006044857A2 PCT/US2005/037369 US2005037369W WO2006044857A2 WO 2006044857 A2 WO2006044857 A2 WO 2006044857A2 US 2005037369 W US2005037369 W US 2005037369W WO 2006044857 A2 WO2006044857 A2 WO 2006044857A2
Authority
WO
WIPO (PCT)
Prior art keywords
flavivirus
virus
mutation
protein
chimerivax
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2005/037369
Other languages
English (en)
French (fr)
Other versions
WO2006044857A3 (en
Inventor
Farshad Guirakhoo
Jian Liu
John A. Catalan
Thomas P. Monath
Konstantin V. Pugachev
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Sanofi Pasteur Biologics LLC
Original Assignee
Acambis Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to EP05811861.3A priority Critical patent/EP1809325B1/en
Priority to CN200580043790.0A priority patent/CN101084010B/zh
Priority to HK08100487.2A priority patent/HK1106723B/xx
Priority to JP2007537962A priority patent/JP4993301B2/ja
Priority to EA200700904A priority patent/EA015907B1/ru
Priority to CA2584228A priority patent/CA2584228C/en
Priority to US11/577,569 priority patent/US8029802B2/en
Priority to AU2005295438A priority patent/AU2005295438B2/en
Priority to KR1020077011389A priority patent/KR101501162B1/ko
Application filed by Acambis Inc filed Critical Acambis Inc
Publication of WO2006044857A2 publication Critical patent/WO2006044857A2/en
Publication of WO2006044857A3 publication Critical patent/WO2006044857A3/en
Priority to IL182453A priority patent/IL182453A0/en
Priority to NO20071924A priority patent/NO20071924L/no
Anticipated expiration legal-status Critical
Priority to US13/251,424 priority patent/US8691550B2/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/10Processes for the isolation, preparation or purification of DNA or RNA
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/20Antivirals for DNA viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/525Virus
    • A61K2039/5254Virus avirulent or attenuated
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/525Virus
    • A61K2039/5256Virus expressing foreign proteins
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2770/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
    • C12N2770/00011Details
    • C12N2770/24011Flaviviridae
    • C12N2770/24111Flavivirus, e.g. yellow fever virus, dengue, JEV
    • C12N2770/24122New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • This invention relates to vaccines against Japanese encephalitis virus and West Nile virus.
  • the Flavivirus genus of the Flaviviridae family includes approximately 70 viruses, mostly arboviruses, many of which, such as yellow fever (YF), dengue (DEN), Japanese encephalitis (JE), and tick-borne encephalitis (TBE) viruses, are major human pathogens (rev. in Burke and Monath, Fields Virology, 4 th Ed.: 1043- 1126, 2001).
  • YF yellow fever
  • DEN dengue
  • JE Japanese encephalitis
  • TBE tick-borne encephalitis
  • Japanese encephalitis is the leading cause of viral encephalitis in Asia, where 30,000 to 50,000 new cases are reported each year.
  • West Nile virus has continued to spread rapidly across North America. The risks of this virus migrating into South America, as well as an epidemic in underdeveloped countries, are extremely high. Effective methods for preventing infection by these viruses are needed, with vaccination being the most cost effective measure.
  • the Flavivirus particle contains a nucleocapsid composed of viral RNA and capsid protein C.
  • the nucleocapsid is surrounded by an envelope containing the envelope glycoprotein E (50-60 kDa) and a small membrane protein M (7-8 kDa).
  • RNA Translation of the genomic RNA results in a polyprotein precursor that is cleaved by cellular and viral proteases into viral proteins, in the order: C, prM/M, E, NS 1 , NS2 A, NS2B, NS3, NS4A, 2K, NS4B, and NS5, where C through E are the structural components of the virion and NSl through NS 5 are nonstructural proteins required for replication (Lindenbach and Rice, Fields Virology, 4 th Ed.:991-1041, 2001).
  • the prM protein ( ⁇ 25 kDa) is the intracellular precursor for M.
  • Immature virions containing prM are produced by budding into the lumen of the endoplasmic reticulum (ER) and are transported to the cell surface through the exocytosis pathway. Cleavage of prM occurs shortly prior to particle release in post-Golgi vesicles. Mature extracellular virus contains predominantly M protein, although a small fraction of uncleaved prM can also be present.
  • the E protein is the main functional and antigenic surface component of the virion.
  • the molecular structure of the ectodomain of E which forms a homodimer on the surface of mature viral particles at neutral pH, has been resolved by cryoelectron microscopy (Rey et al., Nature 375:291-298, 1995) and fitted into the electron density map of viral particles (Kuhn et al., Cell 108:717-725, 2002).
  • the E protein functions as a class II fusion protein (Modis et al., Nature 427:313-319, 2004).
  • the acidic pH in the resulting endosomes triggers dissociation of the dimers such that the previously hidden hydrophobic fusion loop of each monomer is exposed outwardly.
  • the loops insert into the cell (endosome) membrane and monomers rearrange into elongated trimers. Further refolding of the trimers brings the cell and viral membranes into close proximity and forces them to fuse, releasing the contents of the viral particle into the cytoplasm.
  • Virol. 76:5480-5491, 2002 and functions to protect the E protein dimer from premature conformational rearrangement during passage of new particles towards the cell surface through acidic secretory compartments (Guirakhoo et al., J. Gen. Virol. 72:1323-1329, 1991; Guirakaro et al., Virology 191 :921-931, 1992).
  • ChimeriVaxTM technology has been used to create live, attenuated vaccine candidates against medically important Flaviviruses. It employs the YF 17D vaccine virus as a vector in which the prM-E genes are replaced with the prM-E genes from a heterologous Flavivirus, such as JE, dengue, West Nile, or St. Louis encephalitis viruses (Monath et al., Vaccine 17:1869-1882, 1999; Monath et al., Curr. Drug Targets - Inf.
  • a heterologous Flavivirus such as JE, dengue, West Nile, or St. Louis encephalitis viruses
  • the ChimeriVaxTM- JE vaccine virus containing the prM-E genes from the SA14-14-2 virus (live attenuated JE vaccine used in China), was propagated to high titers in Vero cells cultured in media supplemented with fetal bovine serum (FBS) (Monath et al., Biologicals 33:131-144, 2005). It was successfully tested in preclinical and Phase I and U clinical trials (Monath et al., Vaccine 20:1004-1018, 2002; Monath et al., J. Infect. Dis. 188:1213-1230, 2003).
  • FBS fetal bovine serum
  • the invention provides recombinant Flaviviruses that include one or more membrane (M) protein mutations (e.g., substitutions, deletions, or insertions), such as mutations that attenuate the Flavivirus (e.g., mutations that decrease the viscerotropism/viremia of the Flavivirus), increase genetic stability of the Flavivirus during propagation in cell culture (e.g., manufacturing in serum free cultures), and/or increase vaccine virus yields.
  • M membrane protein mutations
  • substitutions, deletions, or insertions such as mutations that attenuate the Flavivirus (e.g., mutations that decrease the viscerotropism/viremia of the Flavivirus), increase genetic stability of the Flavivirus during propagation in cell culture (e.g., manufacturing in serum free cultures), and/or increase vaccine virus yields.
  • the Flaviviruses of the invention can be chimeric
  • Flaviviruses such as Flaviviruses that include capsid and non-structural proteins of a first Flavivirus (e.g., a yellow fever virus, such as YF 17D) and membrane and/or envelope proteins of a second Flavivirus (e.g., Japanese encephalitis virus, West Nile virus, a dengue virus (dengue-1, dengue-2, dengue-3, or dengue-4 virus), St. Louis encephalitis virus, Murray Valley encephalitis virus, tick-borne encephalitis virus, as well as any other Flavivirus that is a human/animal pathogen from the YF, JE, DEN, and TBE serocomplexes).
  • a first Flavivirus e.g., a yellow fever virus, such as YF 17D
  • a second Flavivirus e.g., Japanese encephalitis virus, West Nile virus, a dengue virus (dengue-1, dengue-2, dengue-3, or dengue-4 virus), St. Louis ence
  • the mutation can be in the transmembrane or ectodomain of membrane protein M.
  • the mutation can be in the region of amino acids 40-75 of the predicted membrane helix of the membrane protein M of the Flavivirus.
  • the mutation can be a substitution of amino acid 60 of the membrane protein of a Flavivirus such as Japanese encephalitis virus (e.g., arginine to cysteine in the Japanese encephalitis virus M protein), or in a corresponding amino acid of another Flavivirus.
  • Determination of which amino acid in a given Flavivirus "corresponds" to that of another Flavivirus can be carried out by standard amino acid sequence alignment, as is well known to those of skill in this art.
  • the mutation can be a substitution of amino acid 66 of the membrane protein of a Flavivirus such as West Nile virus (e.g., a substitution of leucine with proline in the M protein of West Nile virus), or in a corresponding amino acid of another Flavivirus.
  • the mutation is at another membrane anchor amino acid, e.g., one or more amino acids selected from the group flanking the M66 residue, including positions 60, 61, 62, 63, 64, 65, and 66 of Japanese encephalitis virus or West Nile virus (or corresponding amino acids in other Flaviviruses) or other amino acid residues of the transmembrane domain.
  • another membrane anchor amino acid e.g., one or more amino acids selected from the group flanking the M66 residue, including positions 60, 61, 62, 63, 64, 65, and 66 of Japanese encephalitis virus or West Nile virus (or corresponding amino acids in other Flaviviruses) or other amino acid residues of the transmembrane domain.
  • the viruses of the invention include one or more mutations in the M protein ectodomain (residues 1-40) as described herein. This result is quite unexpected, given the lack of any known function of the mature M protein of Flaviviruses.
  • the viruses of the invention can include one or more envelope protein mutations in amino acids selected from the group consisting of amino acids 107, 138, 176, 177, 224, 264, 280, 316, and 440.
  • the mutations can be present in amino acids that correspond to these amino acids.
  • the Flavivirus can include a mutation corresponding to mutation(s) in West Nile M protein amino acid 66 and E protein mutations at amino acids corresponding to West Nile virus amino acids 107, 316, and 440.
  • the Flaviviruses of the invention can also include one or more mutations in the hydrophobic pocket of the hinge region of the envelope protein, as described elsewhere herein. Further mutations that can be included in the viruses of the invention are mutations in the 3'UTR, the capsid protein, or other envelope protein regions, as described further below.
  • the invention also provides vaccine compositions that include the Flaviviruses described above and elsewhere herein and pharmaceutically acceptable carriers or diluents, as well as methods of inducing immune responses to Flaviviruses in patients by administration of such vaccine compositions.
  • the patients treated according to such methods include those that do not have, but are at risk of developing, infection by the Flavivirus, as well as patients that are infected by the Flavivirus.
  • the invention includes the use of the Flaviviruses described herein in the prophylactic and therapeutic methods described herein, as well as in the manufacture of medicaments for these purposes.
  • the invention further provides methods of producing vaccines that include a Flavivirus as described herein, which involve introducing into the membrane protein of the Flavivirus a mutation that results in decreased viscerotropism/viremia, and/or increased genetic stability/yields. Further, the invention provides nucleic acid molecules (RNA or DNA) corresponding to the genomes of the Flaviviruses described herein (or the complements thereof), and methods of using such nucleic acid molecules to make the viruses of the invention.
  • RNA or DNA nucleic acid molecules
  • the Flaviviruses of the invention are advantageous because, in having decreased virulence (shown, e.g., by decreased viscerotropism/viremia), they provide an additional level of safety, as compared to their non-mutated counterparts, when administered to patients.
  • An additional advantage is that some mutations, such as the M-60 mutation in ChimeriVaxTM-JE, preclude accumulation of undesirable mutations during vaccine manufacture that otherwise could compromise safety, and increase manufacturing yields.
  • viruses can include sequences of yellow fever virus strain YF17D (e.g., sequences encoding capsid and non-structural proteins), which (i) has had its safety established for >60 years, during which over 350 million doses have been administered to humans, (ii) induces a long duration of immunity after a single dose, and (iii) induces immunity rapidly, within a few days of inoculation.
  • the vaccine viruses of the invention cause an active infection in the treated patients.
  • Fig. IA is a schematic representation of the 3' untranslated region of yellow fever virus, which shows domains within this region (repeat sequences (RS), conserved sequences CS2, CSl, and the 3 '-extreme stem-loop structure), as well as examples of mutations that can be included in the viruses of the invention (e.g., deletions dA, dB, dC, dD, d7, dl4, CS2 d5, and CS2 dl6).
  • RS reference sequences
  • CS2 d conserved sequences
  • CS2 d5 conserved sequences
  • Fig. IB is a schematic representation of the sequence and published secondary structure prediction of the 3' untranslated region of yellow fever 17D virus, from the middle of the 3 rd RS element to the end of the UTR (Proutski et al., J. Gen. Virol. 78:1543-1549, 1999).
  • Fig. 1C is an illustration of the optimal YF 17D 3'UTR secondary structure prediction produced using the Zuker RNA folding algorithm.
  • Fig. ID is an illustration of the effects of 3'UTR deletions (shown for the dC deletion; Zuker method) on the optimal YF 17D structure (compare with Fig. 1C).
  • Fig. 2 A is a schematic representation of the sequence of the capsid protein of tick-borne encephalitis virus, as well as deletions in this protein reported by Kofler et al., J. Virol. 76:3534-3543, 2002.
  • Fig. 2B is a schematic representation of the sequence of the capsid protein of YF 17D virus. Regions predicted by computer analysis to have ⁇ -helical secondary structure ( ⁇ -helices I-IV), as well as hydrophobic regions (solid bars) and deletions introduced in this protein in certain ChimeriVaxTM-WN viruses (e.g., deletions Cl and C2; boxed) are indicated.
  • Fig. 3 is a graph showing growth of the indicated viruses (WNOl, WN02 P5, Large Plaque, Small Plaque, and YF/17D) in He ⁇ G2 cells.
  • Fig. 4 is a graph showing growth of the indicated viruses (WNOl, WN02 P5, Large Plaque, Small Plaque, and YF/17D) in THLE-3 cells.
  • Fig. 5 is a graph showing the viremia in hamsters induced by the indicated viruses (WN02 P5; mixed plaque), Small Plaque (PMS, PlO), and Large Plaque (PMS, PlO)).
  • Fig. 6 is a schematic representation of the passage of SF ChimeriVaxTM-JE virus samples (g.s., experimental passages to study genetic stability).
  • Fig. 7 is a graph showing growth curves of SF ChimeriVaxTM-JE viruses of the invention (uncloned P2, P3 MS (E-107), P4 PS (E-107), P5 g.s. (M-60), and P5 VB (E-107)) at the indicated times post-infection, which shows higher growth rates in SF culture of virus samples containing the M-60 [arginine (R) - ⁇ cysteine (C) and E- 107 phenylalanine (F)-> leucine (L)] mutants as compared to nonmutant virus (P2).
  • Fig. 8 A is a graph showing infectivities of the M-5 ChimeriVaxTM-JE mutant
  • Fig. 8B is a Survival Plot of ChimeriVaxTM-JE vaccine (1.9 1Og 10 PFU/dose, as determined by back titration of inocula) in comparison to ChimeriVaxTM-JE M5 mutant (1.4 logio PFU/dose, as determined by back titration of inocula) in 3-4 day old suckling mice inoculated by the intracerebral route.
  • Fig. 8C is a Survival Plot of ChimeriVaxTM-JE M5 mutant virus (1.4 logio
  • Fig. 8D shows the results of an Indirect Fusion assay, which provides a comparison of P7 and PlO of ChimeriVaxTM-DENl-4 viruses.
  • the virus output for each experiment was determined by standard plaque assay.
  • A ChimeriVaxTM-DENl PMS P7 (triangles) and PlO (diamonds);
  • B ChimeriVaxTM-DEN2 PMS P7 (triangles) and PlO (diamonds);
  • C ChimeriVaxTM-DEN3 PMS P7 (triangles) and PlO (diamonds);
  • D ChimeriVaxTM-DEN4 PMS P7 (triangles) and PlO (diamonds).
  • Fig. 8E shows the results of an Indirect Fusion assay with the ChimeriVaxTM-
  • DEN3 comparing the PMS (P7) vaccine with the Vaccine lot (PlO) and the P15 virus.
  • the virus output for each experiment was determined by standard plaque assay. ChimeriVaxTM-DEN3 PMS P7 (triangles), PlO (diamonds), and Pl 5 (squares).
  • Fig. 8F shows the structure of a DENl E-protein dimer (amino acids 1 to 394) of ChimeriVaxTM-DENl virus (Guirakhoo et al., J. Virol. 78:9998-10008, 2004).
  • A The position of the positively charged lysine (K) at residue 204 of the P7 (PMS, 204K) virus is shown by CPK (displays spheres sized to van der Waal radii) representation. Three structural domains are shown in black (domain I), light grey (domain ⁇ ), and dark grey (domain IH).
  • B Close up of marked area in panel A.
  • Fig. 9A is a graph showing the penetration efficiency of ChimeriVaxTM-JE viruses M60 mutant (Clone C), E 107 mutant (Clone I), and non-mutant (Clone A) at the indicated times. These results indicate that the M60 mutation facilitates penetration in SF Vero cells apparent at the 5 and 10 minute time points. SF Vero cells were infected with appropriately diluted viruses (Clones A, C, and I in serum free medium) for 5, 10, 20, or 60 minutes, and then were treated for 3 minutes with a solution of 0.1 M glycine, 0.1 M NaCl, pH 3.0, to inactivate extracellular virus.
  • Fig. 9B is a schematic representation of the locations of the E- 107, M-5, and M-60 amino acid residues in the envelope proteins E and M, illustrating the hypothetical effect of the M-5 residue on fusion.
  • the dashed stretch at the tip of domain ⁇ of the E protein containing the E- 107 residue represents the fusion peptide (c-d loop), which inserts into cell membrane (Rey et al., Nature 375:291-298, 1995).
  • the M-5 residue is in the N terminal part of the ectodomain of the M protein.
  • the E protein monomers rearrange into trimeric complexes, which fold to force the cell and virus membranes to fuse (Modis et al., Nature 427(6972) :313-319, 2004).
  • the M protein may be a functional component of the complexes, e.g., facilitating fusion of the viral membrane with the cell membrane via its interaction with the E protein.
  • the M-60 residue is between the two C-terminal transmembrane stretches of M and may participate in the interaction of the cell and viral membranes during fusion.
  • the invention provides vaccines and methods for use in preventing and treating Flavivirus (e.g., Japanese encephalitis (JE) or West Nile (WN) virus) infection.
  • Flavivirus e.g., Japanese encephalitis (JE) or West Nile (WN) virus
  • the methods of the invention generally involve vaccination of subjects with a live, attenuated chimeric Flavivirus that consists of a first Flavivirus (e.g., yellow fever virus) in which one or more structural proteins (e.g., membrane and/or envelope proteins) have been replaced with those of a second Flavivirus (e.g., Japanese encephalitis (JE) and/or West Nile (WN) virus; also see below).
  • the membrane proteins of the chimeras of the invention include one or more mutations, as is described further below.
  • structural proteins such as membrane and/or envelope proteins of other Flaviviruses can be used in place of those of Japanese encephalitis virus or West Nile virus in the chimeric viruses of the present invention.
  • membrane protein mutations of the invention can also be used in intact, non-chimeric Flaviviruses (e.g., any of those listed herein), not including any replacements of structural proteins, and optionally with one or more additional mutations, such as those described herein.
  • a chimeric virus that can be included in the vaccines of the invention is the human yellow fever vaccine strain, YF 17D (e.g., YF17D-204 (YF- V AX ® , Sanofi-Pasteur, Swiftwater, PA, USA; Stamaril ® , Sanofi-Pasteur, Marcy- L'Etoile, France; ARILVAXTM, Chiron, Speke, Liverpool, UK; FLAVIMUN ® , Berna Biotech, Bern, Switzerland); YF17D-204 France (X15067, X15062); YF17D-204, 234 US (Rice et al., Science 229:726-733, 1985)), in which the membrane and envelope proteins have been replaced with the membrane and envelope proteins
  • Flavivirus such as a dengue virus (serotype 1, 2, 3, or 4), St. Louis encephalitis virus, Murray Valley encephalitis virus, yellow fever virus, including YF 17D strains, or any other Flavivirus, can provide the membrane and/or envelope proteins in such a chimeric virus.
  • Flaviviruses that can be attenuated according to the invention, whether as intact, non-chimeric viruses or as the source of membrane and/or envelope proteins in chimeras, include other mosquito-borne Flaviviruses, such as Kunjin, Rocio encephalitis, and Ilheus viruses; tick-borne Flaviviruses, such as Central European encephalitis, Siberian encephalitis, Russian Spring-Summer encephalitis, Kyasanur Forest Disease, Omsk Hemorrhagic fever, Louping ill, Powassan, Negishi, Absettarov, Hansalova, acea, and Hypr viruses; as well as viruses from the Hepacivirus genus (e.g., Hepatitis C virus).
  • viruses from the Hepacivirus genus e.g., Hepatitis C virus.
  • yellow fever virus strains e.g., YF17DD (GenBank Accession No. U 17066), YF17D-213 (GenBank Accession No. U17067; dos Santos et al., Virus Res. 35:35-41, 1995), and yellow fever virus 17DD strains described by Galler et al., Vaccines 16(9/10): 1024-1028, 1998, can also be used as the backbone viruses into which heterologous structural proteins can be inserted according to the invention.
  • the viruses listed above each have some propensity to infect visceral organs.
  • the viscerotropism of these viruses may cause dysfunction of vital visceral organs, such as observed in YF vaccine-associated adverse disease events, albeit very infrequently.
  • the replication of virus in these organs can also cause viremia and thus contribute to invasion of the central nervous system. Decreasing the viscerotropism of these viruses by mutagenesis according to the present invention can thus reduce the abilities of the viruses to cause adverse viscerotropic disease and/or to invade the brain and cause encephalitis.
  • the mutations of the invention result in beneficial effects to the viruses, which can include, for example, increased attenuation, stability, and/or replication.
  • the mutations are present in the membrane protein, e.g., in the transmembrane region or in the ectodomain of the membrane protein.
  • the mutations can be in amino acid 60 or 66 of the membrane protein and/or in other amino acids within the predicted transmembrane domain (e.g., in any one or more of amino acids 40-75), or in the N-terminal ectodomain of the M protein (e.g., M-5).
  • membrane protein amino acid 60 arginine in wild type Japanese Encephalitis virus
  • cysteine can be replaced with another amino acid, such as cysteine.
  • cysteine other amino acids, such as serine, threonine, glycine, methionine, etc., can substitute the wild type amino acid at position 60 of the membrane protein.
  • membrane protein amino acid 66 (leucine in wild type West Nile virus) can be replaced with another amino acid, such as proline.
  • hydrophobic amino acids such as isoleucine, methionine, or valine
  • small amino acids such as alanine or glycine
  • amino acids at positions 61, 62, 63, and/or 64 can be substituted, alone or in combination with each other, a mutation at position 60, a mutation at position 66, and/or another mutation(s).
  • substitutions at these positions in the West Nile virus membrane protein sequence include: valine to alanine at position 61, valine to glutamic acid or methionine at position 62, phenylalanine to serine at position 63, and valine to isoleucine at position 64.
  • These mutations can also be present in corresponding amino acids of other Flaviviruses, as described herein.
  • substitutions at these or surrounding positions in the JE virus membrane protein sequence include any of the remaining 20 amino acids with the expectation that a desired effect on viscerotropism and/or vaccine virus replication/stability in cell culture during manufacturing will be achieved.
  • Other examples in chimeric or non-chimeric Flaviviruses include any amino acid substitutions, alone or in combinations, in the N-terminal ectodomain of the M protein composed of residues 1 - ⁇ 40 of the protein, as well as deletion(s) of various sizes (e.g., 1, 2, 3, 4, 5, etc., amino acids long) introduced into the ectodomain and/or the transmembrane domain of the M protein.
  • viruses of the invention can also include one or more additional mutations.
  • an additional mutation(s) can be in the region of position 107 (e.g., L to F), 316 (e.g., A to V), or 440 (e.g., K to R) (or a combination thereof) of the West Nile virus envelope protein.
  • the mutations can thus be, for example, in one or more of amino acids 102-112, 138 (e.g., E to K), 176 (e.g., Y to V), 177 (e.g., T to A), 244 (e.g., E to G), 264 (e.g., Q to H), 280 (e.g., K to M), 311-321, and/or 435-445 of the West Nile envelope protein.
  • amino acids 102-112, 138 e.g., E to K
  • 176 e.g., Y to V
  • 177 e.g., T to A
  • 244 e.g., E to G
  • 264 e.g., Q to H
  • 280 e.g., K to M
  • the lysine at position 107 can be replaced with phenylalanine
  • the alanine at position 316 can be replaced with valine
  • the lysine at position 440 can be replaced with arginine.
  • additional combinations of amino acids that can be mutated include are as follows: 176, 177, and 280; 176, 177, 244, 264, and 280; and 138, 176, 177, and 280. Further, these mutations can also be present in corresponding amino acids of other Flaviviruses, as described herein.
  • the ChimeriVaxTM-JE vaccine already includes all of the above-noted SA14- 14-2 specific mutations as it contains the SA14-14-2-specific JE envelope. Additional amino acid changes in the E protein can also be selected and introduced based on the knowledge of the structure/function of the E protein for additional attenuation (e.g., as described below). These mutations can also be present in corresponding amino acids of other Flaviviruses, as described herein. In addition to the amino acids noted above, the substitutions can be made with other amino acids, such as amino acids that would result in conservative changes from those noted above.
  • Conservative substitutions typically include substitutions within the following groups: glycine, alanine, valine, isoleucine, and leucine; aspartic acid, glutamic acid, asparagine, and glutamine; serine and threonine; lysine and arginine; and phenylalanine and tyrosine.
  • the viruses of the invention can also include in addition to the mutation(s) (e.g., membrane protein mutations) discussed above, one or more mutations in the hinge region or the hydrophobic pocket of the envelope protein, as such mutations have been shown to result in decreased viscerotropism (Monath et al., J. Virol. 76:1932- 1943, 2002; WO 03/103571 A2; WO 05/082020; Guirakhoo et al., J. Virol. 78(18):9998-10008, 2004).
  • mutation(s) e.g., membrane protein mutations
  • the polypeptide chain of the envelope protein folds into three distinct domains: a central domain (domain I), a dimerization domain (domain II), and an immunoglobulin- like module domain (domain ITl).
  • the hinge region is present between domains I and II and, upon exposure to acidic pH, undergoes a conformational change (hence the designation "hinge") that results in the formation of envelope protein trimers that are involved in the fusion of viral and endosomal membranes, after virus uptake by receptor-mediated endocytosis. Prior to the conformational change, the proteins are present in the form of dimers.
  • ⁇ amino acids 48-61, 127-131, and 196-283 of yellow fever virus (Rey et al., Nature 375:291-298, 1995). Any of these amino acids, or closely surrounding amino acids (and corresponding amino acids in other Flavivirus envelope proteins), can be mutated according to the invention, and tested for attenuation. Of particular interest are amino acids within the hydrophobic pocket of the hinge region.
  • envelope protein amino acid 204 (K to R), which is in the hydrophobic pocket of the hinge region, in a chimeric Flavivirus including dengue 1 envelope protein sequences inserted into a yellow fever virus vector results in attenuation (Guirakhoo et al., J. Virol. 78:9998-10008, 2004).
  • This substitution leads to an alteration in the structure of the envelope protein, such that intermolecular hydrogen bonding between one envelope monomer and another in the wild type protein is disrupted and replaced with new intramolecular interactions within monomers.
  • the E gene contains functional domains within which amino acid changes may affect function and thereby reduce virulence, as described by Hurrelbrink and McMinn (Adv. Virus Dis. 60:1-42, 2003).
  • the functional regions of the E protein in which mutations may be inserted that, together with the membrane deletions/mutations described in the present application, may result in an appropriately attenuated vaccine include: a) the putative receptor binding region on the external surface of domain HI, b) the molecular hinge region between domains I and ⁇ , which determines the acid- dependent conformational changes of the E protein in the endosome and reduce the efficiency of virus internalization; c) the interface of prM and E proteins, a region of the E protein that interfaces with prM following the rearrangement from dimer to trimer after exposure to low pH in the endosome; d) the tip of the fusion domain of domain ⁇ , which is involved in fusion to the membrane of the endosome during internalization events; and e) the stem-anchor region, which is also
  • Additional attenuating mutations that can be included with one or more membrane protein mutations in the viruses of the invention include mutations in the 3 'untranslated region of the yellow fever virus backbone.
  • the 3'UTR also includes numerous stem-loop structures, such as those in the non-conserved region downstream from the RS elements, as depicted in Fig. IB.
  • 3'UTR mutations that can be included in the viruses of the invention generally are short, attenuating deletions of, for example, less than 30 nucleotides (e.g., 1, 2, 3, etc., and up to 29 (e.g., 2-25, 3-20, 4-15, 5-10, or 6-8 nucleotides in length); U.S. Patent Application Nos. 60/674,546 and 60/674,415).
  • the short 3'UTR deletions are designed to destabilize the secondary structure of one or more of the stem structures in the 3'UTR.
  • mutations in such structures can also include substitutions that similarly result in stem structure destabilization.
  • the stem-loop structures that are subject to the mutations are present in non- conserved regions of the 3'UTR or in conserved regions that can tolerate such mutations (e.g., in CS2).
  • the stem destabilizing mutations can be present in any one or more of the predicted stem structures shown in Fig. IB, which shows four examples of such deletions (dA, dB, dC, and dD).
  • other examples of 3'UTR mutations in yellow fever virus include mutations that comprise, e.g., 1-2, 3-8, 4-7, or 5-6 nucleotides of the following stem sequences, which are shown in Fig.
  • other short deletions in the 3'UTR can also be included with one or more membrane (and possibly other) mutations in the viruses of the invention.
  • the previously described ⁇ 30 mutation (Men et al., J. Virol. 70:3930-3937, 1996; U.S. Patent No. 6,184,024 Bl) or mutations that fall within this sequence can be used.
  • the invention includes any viable deletions that are 1, 2, 3, etc., and up to 29 (e.g., 1-25, 2-20, 3-15, 4-14, 5-13, 6-12, 7-11, 8-10, or
  • viruses of the invention can include deletion d7, in which the following nucleotides from this region in YF17D are deleted: nucleotides 345-351 (AAGACGG; numbering from the 1 st nucleotide of the 3'UTR, after the UGA termination codon of the viral ORF; Fig. IA). Mutations that include deletion of, for example, 1, 2, 3, 4, or 5 additional nucleotides from the 3' or 5' end of this sequence are also included in the invention. In other examples, short deletions in conserved sequences CSl and CS2 are included in the invention.
  • mutations can include deletion of, e.g., 1-29, 2-25, 3-20, 4-15, 5-10, or 6-8 nucleotides of these sequences.
  • nucleotides 360-364 (GGTTA; CS2d5; Fig. IA) and/or nucleotides 360-375 (GGTTAGAGGAGACCCT; CS2dl6; Fig. IA) are deleted from CS2 of the YF17D-specific 3'UTR.
  • Mutations that include deletion of, for example, 1, 2, 3, 4, or 5 additional nucleotides from the 3' or 5' end of this sequence can also be used.
  • 3'UTR nucleotide sequences for many strains of flaviviruses representing all four major serocomplexes are available from GenBank. Sequences of additional strains can be determined by virus sequencing. The secondary structures of these sequences can be easily predicted using standard software (e.g., mfold or RNAfold programs) to reveal potential stem-loop structures that can be subject to mutagenesis.
  • True structures can be influenced by the formation of various pseudoknots (Olsthoorn et al., RNA 7:1370-1377, 2001) and long range RNA interactions (e.g., RNA cyclization and other interactions (Alvarez et al., J. Virol. 79:6631-6643, 2005)), as well as possible RNA interactions with host and viral proteins.
  • pseudoknots Olet al., RNA 7:1370-1377, 2001
  • long range RNA interactions e.g., RNA cyclization and other interactions (Alvarez et al., J. Virol. 79:6631-6643, 2005)
  • RNA interactions e.g., RNA cyclization and other interactions
  • possible RNA interactions with host and viral proteins e.g., RNA interactions with host and viral proteins.
  • manual operations are often used, such as initial folding of partial sequences with subsequent forcing of initially predicted structures into structures of longer RNA sequences, the artificial use of N'
  • Fig. 1C The predicted optimal structure is shown in Fig. 1C, which differs from the Proutsky prediction shown in Fig. IB. It is important that the small deletions dA, dB, dC, dD, d7, and dl4 in Figs. IA and IB generally destabilized the predicted native YF 17D optimal (Fig. 1C) and suboptimal structures.
  • Fig. ID An example of one such altered optimal structure (for the dC mutant) is shown in Fig. ID.
  • the CS2d5 and CS2dl6 deletions Figs.
  • Additional mutations that can be included with membrane protein (and possibly other) mutations in the viruses of the invention are short deletion (e.g., deletions of 1, 2, 3, or 4 amino acids) mutations within the capsid protein.
  • short deletion e.g., deletions of 1, 2, 3, or 4 amino acids
  • Examples of such mutations provided in reference to the YF 17D virus capsid protein, include viable deletions affecting Helix I of the protein (see Fig. 2A).
  • a specific example of such a mutation is mutation C2, which includes a deletion of amino acids PSR from Helix I (Fig. 2A).
  • Other short mutations in this region (as well as corresponding mutations in other Flavivirus sequences) can be tested for viability and attenuation, and can also be used in the invention.
  • chimeric Flaviviruses which were deposited with the American Type Culture Collection (ATCC) in Manassas, Virginia, U.S.A. under the terms of the Budapest Treaty and granted a deposit date of January 6, 1998, that can be used to make viruses of the invention: Chimeric Yellow Fever 17D/Dengue Type 2 Virus (YF/DEN-2; ATCC accession number ATCC VR-2593) and Chimeric Yellow Fever 17D/Japanese Encephalitis SA14-14-2 Virus (YF/JE Al.3; ATCC accession number ATCC VR-2594). Details of making chimeric viruses that can be used in the invention are provided, for example, in U.S. Patent No. 6,696,28 I Bl; international applications PCT/US98/03894 (WO 98/37911) and
  • PCT/USOO/32821 (WO 01/39802); and Chambers et al., J. Virol. 73:3095-3101, 1999, and are also provided below.
  • These methods can be modified for use in the present invention by including a step of introducing one or more mutations as described herein into inserted sequences (e.g., Japanese encephalitis virus or West Nile virus membrane protein or other sequences).
  • inserted sequences e.g., Japanese encephalitis virus or West Nile virus membrane protein or other sequences.
  • Methods that can be used for producing viruses in the invention are also described in PCT/US03/01319 (WO 03/060088 A2; also see below).
  • Mutations can be made in the viruses of the invention using standard methods, such as site-directed mutagenesis.
  • One example of the type of mutation present in the viruses of the invention is substitutions, but other types of mutations, such as deletions and insertions, can be used as well.
  • the mutations can be present singly or in the context of one or more additional mutations, whether within the membrane protein itself or in any combination of, e.g., 3'UTR, capsid, or envelope sequences.
  • the viruses (including chimeras) of the present invention can be made using standard methods in the art.
  • an RNA molecule corresponding to the genome of a virus can be introduced into primary cells, chick embryos, or diploid cell lines, from which (or the supernatants of which) progeny virus can then be purified.
  • Another method that can be used to produce the viruses employs heteroploid cells, such as Vero cells (Yasumura et al., Nihon Rinsho 21 :1201-1215, 1963).
  • a nucleic acid molecule e.g., an RNA molecule
  • virus is harvested from the medium in which the cells have been cultured, and harvested virus is treated with a nuclease (e.g., an endonuclease that degrades both DNA and RNA, such as BenzonaseTM; U.S. Patent No. 5,173,418).
  • a nuclease e.g., an endonuclease that degrades both DNA and RNA, such as BenzonaseTM; U.S. Patent No. 5,173,418.
  • BenzonaseTM 15 units/mL can be used, and the conditioned medium refrigerated at 2-8°C for about 16 or more hours to allow for digestion of nucleic acids.
  • the nuclease-treated virus is then concentrated (e.g., by use of ultrafiltration using a filter having a molecular weight cut-off of, e.g., 500 kDa (e.g., a Pellicon-2 Mini unltrafilter cassette)), diafiltered against MEME without phenol red or FBS, formulated by the addition of lactose, and filtered into a sterile container. Details of this method are provided in WO 03/060088 A2. Further, cells used for propagation of viruses of the invention can be grown in serum free medium, as described below.
  • the viruses of the invention can be administered as primary prophylactic agents in those at risk of infection, or can be used as secondary agents for treating infected patients. Because the viruses are attenuated, they are particularly well-suited for administration to "at risk individuals" such as the elderly, children, or HIV infected persons.
  • the vaccines can also be used in veterinary contexts, e.g., in the vaccination of horses against West Nile virus infection, or in the vaccination of domestic pets (e.g., cats, dogs, and birds), livestock (e.g., sheep, cattle, pigs, birds, and goats), and valuable animals such as rare birds. Further, the vaccines of the invention can include a virus, such as a chimeric virus, including a particular mutation (e.g., the M5, M60, and/or M66 mutation), in a mixture with viruses lacking such mutations.
  • Formulation of the viruses of the invention can be carried out using methods that are standard in the art. Numerous pharmaceutically acceptable solutions for use in vaccine preparation are well known and can readily be adapted for use in the present invention by those of skill in this art (see, e.g., Remington 's Pharmaceutical Sciences (18 th edition), ed. A. Gennaro, 1990, Mack Publishing Co., Easton, PA). In two specific examples, the viruses are formulated in Minimum Essential Medium Earle's Salt (MEME) containing 7.5% lactose and 2.5% human serum albumin or MEME containing 10% sorbitol. However, the viruses can simply be diluted in a physiologically acceptable solution, such as sterile saline or sterile buffered saline.
  • MEME Minimum Essential Medium Earle's Salt
  • the viruses can simply be diluted in a physiologically acceptable solution, such as sterile saline or sterile buffered saline.
  • the viruses can be administered and formulated, for example, in the same manner as the yellow fever 17D vaccine, e.g., as a clarified suspension of infected chicken embryo tissue, or a fluid harvested from cell cultures infected with the chimeric yellow fever virus.
  • the vaccines of the invention can be administered using methods that are well known in the art, and appropriate amounts of the vaccines to be administered can readily be determined by those of skill in the art. What is determined to be an appropriate amount of virus to administer can be determined by consideration of factors such as, e.g., the size and general health of the subject to whom the virus is to be administered.
  • the viruses of the invention can be formulated as sterile aqueous solutions containing between 10 2 and 10 8 , e.g., 10 3 to 10 7 or 10 4 to 10 6 , infectious units (e.g., plaque-forming units or tissue culture infectious doses) in a dose volume of 0.1 to 1.0 ml, to be administered by, for example, intramuscular, subcutaneous, or intradermal routes.
  • infectious units e.g., plaque-forming units or tissue culture infectious doses
  • Flaviviruses may be capable of infecting the human host via mucosal routes, such as the oral route (Gresikova et al., "Tick-borne Encephalitis," In The Arboviruses, Ecology and Epidemiology, Monath (ed.), CRC Press, Boca Raton, Florida, 1988, Volume IV, 177- 203), the viruses can be administered by mucosal (e.g., oral) routes as well.
  • the vaccines of the invention can be administered in a single dose or, optionally, administration can involve the use of a priming dose followed by one or more booster doses that are administered, e.g., 2-6 months later, as determined to be appropriate by those of skill in the art.
  • adjuvants that are known to those skilled in the art can be used in the administration of the viruses of the invention.
  • Adjuvants that can be used to enhance the immunogenicity of the viruses include, for example, liposomal formulations, synthetic adjuvants, such as (e.g., QS21), muramyl dipeptide, monophosphoryl lipid A, or polyphosphazine.
  • synthetic adjuvants such as (e.g., QS21), muramyl dipeptide, monophosphoryl lipid A, or polyphosphazine.
  • these adjuvants are typically used to enhance immune responses to inactivated vaccines, they can also be used with live vaccines, hi the case of a virus delivered via a mucosal route, for example, orally, mucosal adjuvants such as the heat-labile toxin of E.
  • coli or mutant derivations of LT can be used as adjuvants.
  • genes encoding cytokines that have adjuvant activities can be inserted into the viruses.
  • genes encoding cytokines, such as GM-CSF, EL-2, IL-12, IL-13, or IL-5 can be inserted together with foreign antigen genes to produce a vaccine that results in enhanced immune responses, or to modulate immunity directed more specifically towards cellular, humoral, or mucosal responses.
  • Additional adjuvants that can optionally be used in the invention include toll-like receptor (TLR) modulators.
  • the viruses of the invention can be used in the formulation of tetravalent vaccines.
  • Any or all of the viruses used in such tetravalent formulations can include one or more mutations that decrease viscerotropism, as is described herein.
  • the viruses can be mixed to form tetravalent preparations at any point during formulation, or can be administered in series.
  • equivalent amounts of each virus may be used.
  • the amounts of each of the different viruses present in the administered vaccines can vary (WO 03/101397 A2).
  • the invention also includes nucleic acid molecules (e.g., RNA or DNA (e.g., cDNA) molecules) that correspond to the genomes of the viruses of the invention as described herein, or the complements thereof.
  • nucleic acid molecules can be used, for example, in methods of manufacturing the viruses of the invention.
  • a nucleic acid molecule corresponding to the genome of a virus is introduced into cells in which the virus can be produced and replicate (e.g., primary cells, chick embryos, diploid cell lines, or heteroploid cell lines (e.g., Vero cells)), and from which (or the supernatants of which) progeny virus can then be purified.
  • These methods can further include virus purification steps, as is known in the art.
  • chimeric viruses that can be used in the invention are provided, for example, in U.S. Patent No. 6,696,281 Bl; international applications PCT/US98/03894 (WO 98/37911) and PCT/USOO/32821 (WO 01/39802); and Chambers et al, J. Virol. 73:3095-3101, 1999. Details of the construction of a chimeric Flavivirus including pre-membrane and envelope proteins of Japanese encephalitis virus (or West Nile virus), and capsid and non-structural proteins of yellow fever virus, are provided as follows.
  • YF genomic sequences are propagated in two plasmids (YF5'3W and YFM5.2), which encode the YF sequences from nucleotides 1-2,276 and 8,279-10,861 (YF5'3TV) and from 1,373-8,704 (YFM5.2) (Rice et al., The New Biologist 1:285-296, 1989).
  • Full- length cDNA templates are generated by ligation of appropriate restriction fragments derived from these plasmids.
  • YF sequences within the YF5'3'IV and YFM5.2 plasmids are then replaced by the corresponding JE sequences from the start of the prM protein (nucleotide 478, amino acid 128) through the E/NS1 cleavage site (nucleotide 2,452, amino acid 817).
  • JE SA14-14-2 strain JE live, attenuated vaccine strain; JE SA14-14-2 virus is available from the Centers for Disease Control, Fort Collins, Colorado and the Yale Arbovirus Research Unit, Yale University, New Haven, Connecticut, which are World Health Organization-designated Reference Centers for Arboviruses in the United States).
  • JE SAl 4- 14-2 virus at passage level PDK-5 was obtained and passaged in LLC-MK 2 cells to obtain sufficient amounts of virus for cDNA cloning.
  • the strategy used involved cloning the structural region in two pieces that overlap at an Nhel site (JE nucleotide 1,125), which can then be used for in vitro ligation.
  • a negative sense primer JE nucleotide sequence 2,456-71
  • JE sequences were verified by restriction enzyme digestion and nucleotide sequencing.
  • the JE nucleotide sequence from nucleotides 1 to 1,130 was derived by PCR amplification of negative strand JE cDNA using a negative sense primer corresponding to JE nucleotides 1,116 to 1,130 and a positive sense primer corresponding to JE nucleotides 1 to 18, both containing an EcoRl restriction site. PCR fragments were cloned into pBluescript and JE sequences were verified by nucleotide sequencing. Together, this represents cloning of the JE sequence from nucleotides 1-2,471 (amino acids 1-792).
  • a unique Narl restriction site was introduced into the YFM5.2 plasmid by oligonucleotide-directed mutagenesis of the signalase sequence at the E/NS1 cleavage site (YF nucleotides 2,447-2,452, amino acids 816-817) to create YFM5.2(W ⁇ rI).
  • Transcripts derived from templates incorporating this change were checked for infectivity and yielded a specific infectivity similar to the parental templates (approximately 100 plaque-forming units/250 nanograms of transcript).
  • the JE sequence from nucleotides 1,108 to 2,471 was subcloned from several independent PCR-derived clones of pBluescript/JE into YFM5.2(NarT) using the unique Nsil and Narl restriction sites.
  • YF5'3TV/JE clones containing the YF 5' untranslated region (nucleotides 1-118) adjacent to the JE prM-E region were derived by PCR amplification.
  • a negative sense chimeric primer spanning this region was used with a positive sense primer corresponding to YF5'3TV nucleotides 6,625-6,639 to generate PCR fragments that were then used as negative sense PCR primers in conjunction with a positive sense primer complementary to the pBluescript vector sequence upstream of the EcoRl site, to amplify the JE sequence (encoded in reverse orientation in the pBluescript vector) from nucleotide 477 (N-terminus of the prM protein) through the Nhel site at nucleotide 1,125.
  • YF5'3TV plasmid The resulting PCR fragments were inserted into the YF5'3TV plasmid using the Noil and EcoRl restriction sites.
  • This construct contains the SP6 promoter preceding the YF 5 '-untranslated region, followed by the sequence: YF (C) JE (prM-E), and contains the MeI site (JE nucleotide 1,125) required for in vitro ligation.
  • MeI site JE nucleotide 1,125
  • a BspEl site was engineered downstream of the AatU site normally used to generate full-length templates from YF5'3TV and YFM5.2. (Multiple AatU sites are present in the JE structural sequence, precluding use of this site for in vitro ligation.)
  • the BspEl site was created by silent mutation of YF nucleotide 8,581 (A C; serine, amino acid 2,860), and was introduced into YFM5.2 by exchange of appropriate restriction fragments.
  • the unique site was incorporated into YFM5.2/JE by exchange of the XbaUSphl fragment, and into the YF5'3TV/JE(prM-E) plasmids by three-piece ligation of appropriate restriction fragments from these parent plasmids and from a derivative of YFM5.2 (BspEI) deleting the YF sequence between the EcoRl sites at nucleotides 1 and 6,912.
  • cDNA from a clone of the JE Nakayama strain which has been extensively characterized in expression experiments and for its capacity to induce protective immunity (see, e.g., Mclda et al., Virology 158:348-360, 1987; the JE Nakayama strain is available from the Centers for Disease Control, Fort Collins, Colorado, and the Yale Arbovirus Research Unit, Yale University, New Haven, Connecticut), was also used in the construction of chimeric fiavi viruses.
  • the Nakayama cDNA was inserted into the YF/JE chimeric plasmids using available restriction sites (HindHL to PvuTL and Bpml to Mun ⁇ ) to replace the entire prM-E region in the two plasmid system except for a single amino acid, serine, at position 49, which was left intact in order to utilize the Nhel site for in vitro ligation.
  • Procedures for generating full-length cDNA templates are essentially as described in Rice et al. (The New Biologist 1 :285-96, 1989).
  • the plasmids YF5'3TV7JE (prM-E) and YFM5.2/JE are digested with Nhe ⁇ /BspEl and in vitro ligation is performed using 300 nanograms of purified fragments in the presence of T4 DNA ligase.
  • the ligation products are linearized with ⁇ ol to allow run-off transcription.
  • SP6 transcripts are synthesized using 50 nanograms of purified template, quantitated by incorporation Of 3 H-UTP, and integrity of the RNA is verified by non-denaturing agarose gel electrophoresis. Yields range from 5 to 10 micrograms of RNA per reaction using this procedure, most of which is present as full-length transcripts. Transfection of RNA transcripts in the presence of cationic liposomes is carried out as described by Rice et al. (supra) for YF 17D, to generate the chimeric viruses.
  • chimeric flaviviruses including West Nile virus and yellow fever virus sequences
  • the two-plasmid system described above can also be used.
  • the West Nile (WN) virus prM and E genes used were cloned from WNV flamingo isolate 383-99, sequence GenBank accession number AF196835.
  • Virus prME cDNA was obtained by RT-PCR (XL-PCR Kit, Perkin Elmer). The 5' end of WN prM gene was cloned precisely at the 3 'end of the YF 17D capsid gene by overlap-extension PCR using Pwo polymerase (Roche).
  • the 3' end of the E gene was also cloned precisely at the 5 'end of the YF NSl coding sequence by overlap- extension PCR.
  • Silent mutations were introduced into the sequence of prM and E to create unique restriction sites Bsp EI and Eag I. Digestion of the two plasmids with these enzymes generated DNA fragments that were gel purified and ligated in vitro to produce a full-length chimeric cDNA.
  • the cDNA was linearized with Xho I to facilitate in vitro transcription by SP6 polymerase (Epicentre).
  • the RNA product was introduced into eukaryotic cell lines permissive for viral RNA translation and replication of the virus.
  • Flavivirus chimeras can be engineered with a similar strategy, using natural or engineered restriction sites and, for example, oligonucleotide primers as shown in Table 14.
  • the invention is based, in part, on the experimental results described in the following Examples.
  • Example 1 ChimeriVaxTM-WN Experimental Results Background and Summary A chimeric yellow fever- West Nile (YF-WN) virus, ChimeriVaxTM-WN, was produced by insertion of pre-membrane (prM) and envelope (E) genes of a WN virus (NY99) into the YF17D backbone.
  • the virus was produced in Vero cells under serum free conditions (at Passage 5, P5), evaluated for safety, immunogenicity, and efficacy in preclinical models, and has been tested in a phase I study in humans. Additional attenuation of the vaccine virus (P5) is determined by three SAl 4- 14-2- specific mutations in the E protein (residues 107, 316, and 440).
  • the vaccine virus was less neurovirulent than YF- VAX ® when tested in mouse and monkeys inoculated by the IC route and protected mice, hamsters, and monkeys upon a single inoculation (Arroyo et al., J. Virol. 78:12497-12507, 2004; Tesh et al., Emer. Infect. Dis. 8:1392- 1397, 2002).
  • the vaccine virus contained a mixed population of viruses (exhibiting small, S, and large, L, plaque phenotypes), which differed by a single amino acid residue in the M protein at position 66 (M66). This mutation did not affect neurovirulence of the virus for 8 day old suckling mice (Arroyo et al., J. Virol.
  • the M66 mutation reduces viremia in the host and thus can be used to improve the safety of the current vaccine (ChimeriVaxTM-WN02, P5, mixed population of parent and mutant viruses) or the large plaque variant (non mutant) virus.
  • a nucleotide heterogeneity ( ⁇ 50%) of T and C (CT A/CCA) was observed in the consensus sequence of ChimeriVaxTM-West Nile vaccine virus at P5 produced in Vero cells under serum free conditions.
  • This mutation would result in presence of viruses containing either amino acid Proline (mutant) or Leucine (parent wild type) in the membrane (M) protein at residue 66 (herein designated as M66 mutation).
  • the sequences of ChimeriVaxTM WN02 and the ChimeriVaxTM WN02 M66 variant are provided in the enclosed sequence appendix, which also includes an alignment of the amino acid sequences of these proteins.
  • the M protein of West Nile virus contains 75 amino acids.
  • the structure of the protein was predicted and compared to the structures of M proteins of JE SA14 (AAA67174), Kunjin (AAP78942), MVE (CAA27184), SLE MSI (AAP44973, and SLE CORAN (AAP44972) by submission of the protein sequence to the http://www.predictprotein.org website, hi all predicted structures, the first 40 amino acids of the M protein (SLTVQTHGESTLANKKGAWMDSTKATRYLVKTESW ⁇ LRN) are predicted to be a non-membrane region, whereas the remaining 35 amino acids (40-75)
  • Pre-Master Seed (PMS, PlO) stocks of both L and S viruses were produced in Vero cells from ChimeriVaxTM-WN02 (p5) under "clean laboratory condition" by 3 rounds of direct plaque to plaque purifications and 2 rounds of virus amplification.
  • the sequencing of PlO S and L viruses revealed a single amino acid difference in the M66 residue (S virus contained Proline at M66 residue, whereas L virus contained Leucine at this site).
  • the M66 mutation seemed to be stable under large scale manufacturing conditions.
  • S plaque virus (PlO, PMS) was inoculated into hamsters by subcutaneous inoculation, it induced a very low level of viremia compared to the vaccine virus (P5) or the L plaque virus variant (PlO, PMS).
  • Additional mutations in the M region were found by sequencing individual plaques isolated from large scale manufacturing passages (e.g., M62, M63, and M64) of PMS S plaque from PlO to P12 or monkeys inoculated with ChimeriVaxTM-WN02 vaccine (e.g., M60, M61, and M63). These mutations can also be used in the construction of viruses of the invention.
  • ChimeriVaxTM-WN02 vaccine material (P5) was grown in Serum Free Vero cells; 10 plaques identified as “small” (S) and 10 plaques identified as “large” (L) were picked. Each isolate was then passaged on Serum Free Vero cells, and one plaque was picked from each isolate. The procedure was repeated one final time, for a total of three rounds of plaque purification.
  • the plaque purified isolates (P8) were amplified in T25 cm 2 flasks containing Serum Free Vero cells (and grown in serum free (SF) media), then harvested and stored at -80°C. Isolates were sequenced to find a PMS candidate free of spurious mutations.
  • the small plaque PMS virus was passaged twice in a bioreactor by infecting Vero cells and growing under serum free conditions to produce the P12 virus.
  • the P 12 virus was harvested and plaqued in 6-well plates. The majority of the plaques were of small size. Twenty of the largest plaques available were picked, amplified on O- Vero (one passage), and the prME region was transcribed/amplified via Titan One-Tube RT-PCR kit (Roche).
  • the cDNA fragments containing the M region were sequenced, and the morphology of the isolates was confirmed via immuno-staining using WN specific monoclonal antibodies.
  • plaques contained only M66 (the genetic marker responsible for SP morphology), and 5 isolates contained other mutations in addition to M66.
  • Isolate #4 contained M63 (LP phenotype), and isolate #16 contained a mixed population of wt and M66. These data demonstrated that, despite the fact that some plaques appeared to be of large size, they contained the M66 mutation and upon amplification proved to be of S size. Only one plaque (#4) out of 20 appeared to be of L size, apparently due to a mutation at M63 from L to P. Plaque #16 appeared to produce a mixed population of large and small plaque size viruses containing both wt L and mutant P amino acids at position M66 (Table 3).
  • Human hepatoma cell lines HepG2 and THLE-3 cells were infected with ChimeriVaxTM- WNOl (wild type prME), ChimeriVaxTM-WN02 P5 (containing mutations at El 07, E313, E316, E440, M66 mixed L/P amino acids, mixed S and L plaques), ChimeriVaxTM-WN LP (E 107, E313, E316, and E440, WNL), and ChimeriVaxTM-WN SP (E 107, E313, E316, E440, and M66P, WNS) at an MOI of 0.005.
  • Supernatants were collected daily and titrated on O-Vero cells using the standard neutral red double agarose overlay procedure.
  • CPE cytopathic effects
  • the purpose of this study was to evaluate viremia, biodistribution, and possible toxicity of the ChimeriVaxTM-WN02 vaccine during a 3 day observation period.
  • the inoculated dose was ⁇ 1.25xlO 5 PFU/0.5 mL and 5.5xlO 4 PFU/mL for ChimeriVaxTM-WN02 and YF- V AX ® , respectively.
  • Viremia was assessed on monkey sera collected from Day 1 (before inoculation) through Day 4 (prior to euthanization). The assay was performed either by using agarose double overlay and neutral red staining (to isolate and sequence individual plaques) or by methyl cellulose overlay and crystal violet staining (to measure the level of viremia) as described (Monath et al., J. Virol. 74(4): 1742- 1751, 2000).
  • the magnitude and duration of viremia in ChimeriVaxTM-WN02 inoculated monkeys were higher than those of YF -V AX ® (Table 5).
  • the highest titer of viremia for YF- VAX ® was 200 PFU/mL (animal MF21157, Day 4).
  • the highest titer of viremia for ChimeriVaxTM-WN P5 virus was 1000 PFU/mL (animal MF2119 IF, Day 4).
  • AU animals (4/4) inoculated with ChimeriVaxTM-WN02 virus were viremic for 3 days post inoculation, whereas only 2/4 animals inoculated with YF- VAX ® became viremic (for only 2 days) (Table 5).
  • the animals used in this study were maintained in microseparators under BL2 and handled according to an animal protocol approved by the IACUC throughout the study.
  • Three ChimeriVaxTM-WN02 viruses (SP, PMS, PlO; LP, PMS, PlO, and the mix SP and LP vaccine virus, P5) were used to infect 7 week-old female Golden Syrian hamsters ⁇ Mesocricetus auratus) from Harlan Sprague-Dawley. Each virus was injected into a group of 15 hamsters via the subcutaneous route in the inguinal area. The infection dose was 10 5 pfu, and the inoculum volume was 100 ⁇ l.
  • Virus concentration in the test samples were determined by direct plaquing of a 0.1 mL of 1 : 10 diluted serum sample in duplicate wells of Vero cell culture grown in 12-well-plates (Fig. 5).
  • a higher level (3 logs of pfu on average) of peak viremia was observed in serum samples collected from LP virus infected hamsters, while a very low level ( ⁇ 10 pfu) of viremia was seen in blood samples of SP virus inoculated hamsters.
  • the peak viremia titer was lowered to approximately half of the LP virus induced viremia level.
  • the viremia peak time was delayed for at least 1 day to 4 days post infection.
  • the LP virus replicated to a higher level at a faster rate, in comparison with the SP virus in hamsters.
  • mixing SP virus with LP apparently counteracts some properties of the LP virus. This is shown in the hamster infection experiments, in which the presence of virus in blood was reduced to lower levels and the virus replication kinetics were slowed in mixed virus infected hamsters.
  • the mutation at M66 (L to P) present in SP variant virus significantly reduced its viremia in hamsters.
  • Example 2 ChimeriVaxTM-JE and ChimeriVaxTM-DENl-4 Background and Summary In the study described below, we prepared and characterized a new
  • ChimeriVaxTM-JE seed virus using Vero cells grown in serum-free (SF) media in order to eliminate any concerns about possible contamination of the vaccine with the prion agent of bovine transmissible encephalopathy.
  • SF serum-free
  • uncloned virus accumulated mutations not seen previously in serum- containing culture, which appeared to be adaptations to SF growth conditions increasing the rate of virus replication.
  • These mutations occurred in the E or M proteins (E- 107 F to L or M-60 R to C mutations) and suggested a functional significance of the M protein in the process of virus replication, which became noticeable during virus growth in SF conditions (see amino acid R at position 60 of the M-protein shown in Example 1 (ChimeriVaxTM-WN).
  • Vero cells were originally received from the American Type Culture Collection (ATCC; Manassas, VA; CCL 81; African green monkey kidney cells). These cells were adapted to grow in SF media and were obtained from Baxter (Orth, Austria) at passage 133, and then were used directly by seeding into flasks or seeded starting from a cell bank at passage 136. In all experiments, the passage level of the Vero cells did not exceed passage 149. Cells and viruses were grown at 36°C under 7.5% CO 2 . Cells were propagated under SF conditions.
  • the virus was initiated (passage Pl) by electroporation of SF Vero cells with the same in vitro RNA transcripts (stored at -80°C) that were used previously for production of a non-SF ChimeriVaxTM- JE vaccine candidate tested in preclinical and clinical trials (Monath et al., Vaccine 20:1004-1018, 2002) and prepared as described previously (Chambers et al., J. Virol. 73:3095-3101, 1999).
  • Amplification passages were generally done at an MOI of 0.001 pfu/cell and viral harvests were collected on days 3-4 postinfection (when CPE was ⁇ 10%), clarified by slow speed centrifugation, supplemented with 10% sorbitol, and stored at -80°C.
  • Cloned variants were produced in Baxter Vero cells by three consecutive plaque purifications using a standard agar- neutral red overlay method in the presence of gamma-irradiated FBS (HyClone; FBS was used because the cells failed to form plaques under agar prepared with SF media) followed by amplification in SF conditions.
  • Plaque assays to determine virus titers in indicated samples were performed using a single methyl cellulose overlay method with visualization of plaques by crystal violet on day 5 post-infection.
  • ChimeriVaxTM-DENl-4 vaccine viruses were prepared by electroporation of Vero cells with RNA transcripts prepared from viral cDNA. Progeny viruses were subjected to three rounds of plaque purification to produce the Pre-Master Seed (PMS) viruses at passage 7 (P7). Three further passages were carried out using U.S. current Good Manufacturing Practices (cGMP) to produce the Vaccine lot (PlO viruses). Some mutations appeared in the E genes of the chimeras after multiple passages in Vero cells (Guirakhoo et al., J. Virol. 78:4761-4775, 2004).
  • PMS Pre-Master Seed
  • P7 Three further passages were carried out using U.S. current Good Manufacturing Practices (cGMP) to produce the Vaccine lot (PlO viruses).
  • Consensus sequencing of indicated virus samples was performed as previously described (Pugachev et al., Vaccine 20:996-999, 2003). Briefly, virion RNA extracted with the TRIZOL LS reagent (Life Technologies-Gibco BRL) was amplified in five overlapping cDNA amplicons of- 2-3 kb in length with Titan One- Tube RT-PCR kit (Roche). Amplicons were sequenced using a collection of JE- and YF-specific oligonucleotide primers of both positive and negative orientation and CEQ Dye Terminator Cycle Sequencing kit (Beckman). Sequencing reaction products were resolved with a CEQ2000XL automated sequencer (Beckman Coulter). The data were aligned and analyzed with Sequencher 4.1.4 (GeneCodes) software.
  • mice The maintenance and care of mice was in compliance with the National Institutes of Health guidelines for the humane use of laboratory animals.
  • Pregnant outbred ICR female mice were purchased from Taconic Farms (Germantown, NY). Newborn mice were fostered and mixed into new groups 6 days prior to inoculation. Groups of 8 day-old suckling mice were inoculated with 0.02 ml of the indicated virus samples by the intracerebral (IC) route.
  • IC intracerebral
  • Serial 1:10 dilutions of viruses used for inoculations were done in MEM- 10% FBS. Undiluted inocula were back-titrated and the exact doses of each dilution were calculated. Mortalities were recorded over a period of 21 days.
  • the YF 17D control virus was YF- VAX ® (Aventis Pasteur, Swiftwater, PA) reconstituted from a commercial vaccine vial.
  • Flaviviruses One of the consequences of exposure of Flaviviruses to low pH (in the absence of cell membranes) is induction of irreversible conformational changes in the E protein and virus inactivation (loss of potency). In the presence of cell membranes, these conformational changes are necessary for fusion of viral membrane with those of cellular membranes, resulting in release of viral genome into the host cells.
  • the pH threshold for fusion of mosquito-borne viruses such as WN, DEN, YF, and JE can be measured by fusion from within (FFWI) using the mosquito cell line C6/36 (Guirakhoo et al, Virology 169(l):90-99, 1989).
  • Fusion was performed at pH 7.0, 6.8, 6.6, 6.4, 6.2, 6.0, 5.8, 5.6, 5.4, and 5.0, using IX MEM supplemented with 2 mM L-Glutamine, 2.7% sodium bicarbonate, 10% HI FBS, and 1% antibiotic/antimycotic solution [(100 U/ml of penicillin, 0.1 mg/ml of streptomycin, 0.25 ⁇ g/ml Amphotericin (Sigma)] adjusted to the proper pH with MES (Sigma). An aliquot of each virus at IxIO 4 plaque forming unit (PFU)/ml was diluted (10 '1 dilution) in each pH medium.
  • IX MEM IX MEM supplemented with 2 mM L-Glutamine, 2.7% sodium bicarbonate, 10% HI FBS, and 1% antibiotic/antimycotic solution [(100 U/ml of penicillin, 0.1 mg/ml of streptomycin, 0.25 ⁇ g/ml Amphotericin (S
  • Vero cells were infected with serial dilutions of viruses (10 "1 to 1O "6 ) into duplicate wells. After infection, the Vero monolayers were overlaid with IX MEM (Sigma) supplemented with 2 mM L-Glutamine, 2.7% sodium bicarbonate, 5% HI FBS, 1% antibiotic/antimycotic solution [100 U/ml of penicillin, 0.1 mg/ml of streptomycin, 0.25 ⁇ g/ml Amphotericin (Sigma)], and 44% of 0.6% agarose (Sigma).
  • SF Vero cells were infected with Clone A, C, and I viruses, appropriately diluted in SF medium, for 5, 10, 20, or 60 minutes, and then treated for 3 minutes with 0.1 M glycine, 0.1 M NaCl, pH 3.0, to inactivate extracellular virus.
  • Wells were washed twice with PBS, and then monolayers were overlaid with methyl-cellulose, followed by staining plaques on day 5 with crystal violet. Efficiency of penetration was calculated as the percentage of observed plaque numbers after glycine treatment, as compared to control infected wells that were treated with PBS instead of glycine.
  • Viremia was measured daily by plaque assay in Vero cell monolayers. The same assay and laboratory determined viremia levels in both trials. Safety assessments included the recording of adverse events, body temperature, physical examination, and laboratory tests (including measurement of viremia levels). Viremia was seen in the majority of subjects receiving ChimeriVaxTM-JE.
  • a second study (protocol H-040-007) was performed in healthy adult male and female subjects in which 31 or 32 subjects per group received graded subcutaneous doses (3, 4, or 5 logi 0 PFU) of ChimeriVaxTM-JE containing the M60 cysteine mutation.
  • the dose range was similar to that in the previous study in subjects who had received 2.8, 3.8, and 4.8 logi 0 PFU.
  • FIG. 6 A diagram of virus samples produced in this study is shown in Fig. 6.
  • the initial uncloned passage 2 (P2) sample (Pre-Master Seed candidate; PMS) was obtained in SF culture by transfecting cells with in vitro RNA transcripts that had been used to produce the vaccine in FBS-containing media for previous studies (Monath et al., Vaccine 20:1004-1018, 2002) followed by an additional amplification passage.
  • the full genome of this virus was sequenced and shown not to contain any detectable mutations (Table 7) (note that the consensus sequencing approach does not detect minor subpopulations; detection limit of mutations is ⁇ 10%).
  • cloned PMS candidates were then generated by plaque purification, to stabilize the SF vaccine and prevent accumulation of undesirable mutations, such as E- 107.
  • Plaque purification removes random mutations in uncloned virus introduced by in vitro transcription characterized by low fidelity of RNA synthesis compared to viral RNA synthesis by YF 17D-specific RNA polymerase (Pugachev et al., J. Virol. 78:1032-1038, 2004).
  • ChimeriVaxTM vaccines are significantly more attenuated. Since adult mice generally are not sensitive to detect subtle differences in neurovirulence, e.g., those due to a single amino acid change, a more sensitive suckling mouse model using survival analysis can be used for that purpose (Guirakhoo et al., Virology 257:363-372, 1999; Guirakaro et al., Virology 298:146-159, 2002; Monath et al., J. Virol. 76:1932-1943, 2002).
  • mice Eight day-old suckling mice were inoculated IC with serial dilutions of the clone A P7 virus, clone C PlO virus (M-60 mutation), uncloned P5 vaccine bulk (E- 107 mutation), as well as a previously produced FBS-containing control ChimeriVaxTM- JE virus (P5 Quality Control Reference Standard virus; no mutations), YF 17D positive control (YF-VAX ), or mock inoculated with diluent. Mortalities over a period of 21 days, median IC 50% lethal dose values (LD 50 ), and average survival times (AST) of mice that died are shown in Table 8. As expected, YF- V AX ® was highly neuro virulent.
  • Lymphoid hyperplasia consisting of increased size and number of lymphoid nodules in the spleen, was noted for 9 of 11, 4 of 11, and 8 of 11 monkeys from Groups 1-3, respectively. Although this finding is a common background finding in cynomolgus monkeys, the group incidences were greater than normal in these monkeys and were considered secondary to the expected immune response induced by the vaccines. It is noteworthy that similar changes occurred in both the ChimeriVaxTM-JE treatment groups and the YF- V AX ® reference control group.
  • the ChimeriVaxTM-JE MVB and PVB preparations exhibited minimal neurovirulence in this test.
  • the most comprehensive measure of neurovirulence in the monkey neurovirulence test for Flavivirus vaccines is the combined group mean lesion score, representing the average of the mean target area and mean discriminator area scores.
  • the target areas in cynomolgus monkeys are the substantia nigra and the cervical and lumbar enlargements of the spinal cord and represent regions of the central nervous system (CNS) that are injured by all Flaviviruses.
  • the discriminator areas are the globus pallidus, putamen, anterior and medial thalamic nuclei, and lateral thalamic nucleus, and represent regions of the CNS that are injured selectively by strains of YF 17D (and presumably other Flaviviruses) having different virulence properties, and that discriminate between a reference strain and a strain having increased neurovirulence.
  • the combined mean lesion scores for monkeys treated with the ChimeriVaxTM-JE MVB and PVB preparations were significantly lower than for the YF-V AX ® reference control group (p ⁇ 0.05).
  • the results of the monkey neurovirulence test show that the new (M60, Clone C) plaque-purified MVB and PVB have a satisfactory safety profile.
  • the test articles displayed no clinical toxicity, and had significantly lower discriminator and combined lesion scores on neuropathological examination than the reference control (YF- V AX ® ).
  • the test articles did not differ from the reference control (YF- V AX ® ) in viscerotropism, as measured by quantitative viremia.
  • ChimeriVaxTM-JE virus was detected in the sera of 5 (100%) of 5 seronegative monkeys inoculated with original uncloned P5 ChimeriVaxTM -JE vaccine.
  • the duration of viremia was 2-5 days with titers ranging from 20 to 790 PFU/mL.
  • the mean peak viremia ( ⁇ SD) was 244 ( ⁇ 310) PFU/mL, and the mean number of viremic days was 3.4 ( ⁇ 1.34) (Table 10).
  • ChimeriVaxTM-JE virus was detected in the sera of 4 (100%) of 4 seronegative monkeys inoculated with the new P 13 JE vaccine purified bulk.
  • the duration of viremia was 2-5 days with titers ranging from 50 to 290 PFU/mL.
  • the mean peak viremia ( ⁇ SD) was 160 ( ⁇ 123) PFU/mL, and the mean number of viremic days was 3.75 ( ⁇ 1.26) (Table 10). Neither mean peak viremia nor number of viremic days differed significantly between the two treatment groups (p-values 0.6290 and 0.7016, respectively; ANOVA).
  • the new M-60 vaccine was compared to the original uncloned ChimeriVaxTM-JE vaccine (no mutations except for E491) with respect to safety (viremia) and immunogenicity.
  • the new vaccine was slightly less viscerotropic (a desirable feature) but still highly immunogenic. The differences in the magnitude of viremia and immunogenicity were not statistically significant.
  • ChimeriVaxTM-JE vaccine was produced by insertion of prM and E genes from SA14-14-2 strain of JE virus into backbone of YF 17D virus.
  • the envelope of SA14-14-2 virus (present in ChimeriVaxTM-JE) differed from its parent SA14 virus by 10 amino acids: E107 L to F, E138 E to K, E176 I to V, E177 T to A, E227 P to S, E244 E to G, E264 Q to H, E279 K to M, E315 A to V, and E439 K to R (Guirakhoo et al., Virology 257:363-372, 1999).
  • the following viruses were tested: (1) ChimeriVaxTM-JE non-mutant (clone A, P7 containing all 10 SAl 4- 14-2 mutations in the E protein); (2) ChimeriVaxTM-JE E 107 F to L revertant (clone I P6, containing 9 E protein mutations); (3) ChimeriVaxTM-JE M60 R to C mutant (clone C, PlO containing all 10 E protein mutations), and (4) M-5 Q to P mutant (clone E, P6 containing all 10 E protein mutations) (Table 12).
  • Non-mutant clone A P7 virus, M-60 mutant clone C PlO virus, M-5 mutant clone E, and uncloned P5 virus containing the E- 107 mutation were treated with a range of decreasing pHs followed by titration of residual viral infectivity. Infectivity of three viruses (clone A control virus, Clone C M60 mutant, and Clone I E- 107 mutant) started to drop uniformly after pH 6.0 and was lost at pH 5.8 (pH threshold 5.9), except for M5 mutant Clone E virus. The M-5 mutant had a significantly higher pH threshold (pH 6.3) compared to all other viruses (pH 5.9) (Fig. 8A).
  • the N-terminus of M protein may function in the process of fusion triggered by a low pH in endosomes following virus adsorption and internalization, which is a function attributed previously solely to the envelope E protein.
  • the pH threshold of 5.9 for fusion of ChimeriVaxTM-JE viruses is lower than those described for other wild-type (wt) Flaviviruses (Guirakhoo et al., J. Gen. Virol. 72:1323-1329, 1991) and may be involved in attenuation of the virus.
  • the M-5 mutation is capable of increasing this threshold from 5.9 to 6.3, which is closer to those of wt Flaviviruses (Guirakhoo et al., Virology: 169(l):90-99, 1989; Guirakaro et al, J. Gen. Virol. 72:1323-1329, 1991).
  • An increase in pH threshold for fusion should theoretically decrease the attenuated phenotype of the virus, because the viruses can fuse at higher pHs with less protonization required for transition to a fusion active state.
  • the Indirect Fusion Assay was performed using two groups of each ChimeriVaxTM-DEN vaccines viruses: ChimeriVaxTM-DENl-4 P7 containing no E protein mutations and ChimeriVaxTM-DENl-4 PlO which contained single mutations in the E protein, except for ChimeriVaxTM-DEN4 PlO.
  • Viruses were incubated with media of different pH for 10 minutes at room temperature. The titers were determined, after returning the pH to the neutral pH, using a standard plaque assay. As shown in Table 13, the threshold for virus inactivation (fusion) was similar between P7 and PlO of ChimeriVaxTM-DEN2 and DEN4 viruses (pH 6.4).
  • E-202 residue in this virus is homologous to E-204 in DENl).
  • the indirect fusion assay was performed using P7 (no mutation, E202K), PlO (50% mutation, E202K/R), and P15 (complete mutation, E202R) viruses.
  • the pH threshold for inactivation (fusion) of ChimeriVaxTM-DEN3 PlO was at pH 6.2, which was between those for ChimeriVaxTM-DEN3 P7 (pH 6.4) and ChimeriVaxTM-DEN3 Pl 5 (pH 6.0) viruses. Since the E202 K to R mutation was the only amino acid substitution detected in E-protein of these chimeras, it is most likely that this mutation is responsible for a 0.4 pH shift in pH threshold for fusion of the Pl 5 virus.
  • the E204 K to R mutation which occurred during cell culture manufacture of the vaccine, lowered the pH threshold for fusion by 0.4 units of pH.
  • the E204 K to R mutation appears to generate new intramolecular H bonds and a new salt bridge, which might have a significant impact on the dissociation of the E dimers.
  • the structure of the ChimeriVaxTM-DENl (PMS, P7) E protein was modelled based on the atomic coordinates of 394 residues of the DEN2 E-protein ectodomain (Sl strain) determined in the presence of the detergent w-octyl- ⁇ -D- glucoside (Modis et al., Proc. Natl. Acad. Sci. U.S.A.
  • the K residue at position 204 was changed to R to mimic the mutant virus, and the modelling was repeated to represent the E-protein structure of the ChimeriVaxTM- DENl (VL, PlO) virus (Guirakhoo et al., J. Virol. 78:9998-10008, 2004).
  • the K residue at position 204 (204K) is located within a short loop, in a hydrophobic pocket lined by residues, which have been shown to influence neurovirulence or the pH threshold for fusion (Lee et al., Virology 232:281-290, 1997; Lindenbach et al., 2001 Flaviviridae: the viruses and their replication. Fields Virology, eds.
  • Fig. 8F the homology model of the E- homodimer structure of the vaccine virus (204R) is compared to that of the PMS (204K) virus.
  • the side chains of 204K and 261H of one of E monomer appeared to make H bonds with the backbone atoms of 252V and 253L residues, respectively, on the opposite monomer.
  • the R in the E protein of the vaccine virus (VL PlO) is predicted to reorient itself so that these hydrogen (H) bonds are lost.
  • the E202 K to R substitution in the E-protein of the ChimeriVaxTM-DEN3 PlO vaccine is homologous to the E204 mutation in the ChimeriVaxTM-DENl PlO vaccine.
  • ChimeriVaxTM-DENl PlO heterologous at residue 202 containing both K and R residue
  • the pH threshold for fusion was further lowered (0.4 pH unit, similar to ChimeriVaxTM-DENl PlO) when the mutation was fixed at P15 of ChimeriVaxTM-DEN3.
  • DEN4 would lower their viscerotropism in their hosts. It was previously reported that WT-JE had a pH threshold for fusion of 6.4 (Guirakhoo et al., J. Gen. Virol. 72:1323-1329, 1991). In this study, all variants of ChimeriVaxTM-JE had a pH threshold of 5.9. The low pH threshold observed in these experiments is likely due to the presence of one or more of the 10 attenuating mutations in the envelope protein of ChimeriVaxTM-JE. This mutation might strengthen the association of the E-protein dimer so that a lower pH is required for dissociation and transition to trimer structure and subsequent fusion.
  • SF Vero cells were infected with appropriately diluted viruses (to yield ⁇ 50 plaques/well at each time point) for 5, 10, 20, or 60 minutes. Un-internalized virus is inactivated by addition of acidic glycine silution, while control parallel wells are treated with PBS (neutral pH). Cells are washed with PBS and overlaid with methyl-cellulose overlay, followed by visualization and counting of plaques on day 5.
  • the efficiency of penetration is presented as a percentage of the average number of plaques in glycine- treated wells relative to the number of plaques in control, PBS treated wells.
  • a preliminary penetration test result is shown in Fig. 9A. It is important that the percentages of penetrated Clone C and Clone I viruses were higher than the non- mutant Clone A virus at 5 and 10 minute time points, at which effects of mutations on penetration are more likely to be detected. The result is not statistically significant as evidenced by standard deviation bars and needs to be confirmed in additional repeat tests. Nevertheless, this experiment suggested that both the M-60 and E- 107 mutations could improve the efficiency of membrane fusion of ChimeriVaxTM- JE virus to cells grown in SF conditions.
  • Fig. 9B A possible mechanism of the effect of the M- 60 and E-107 residues on process of membrane fusion is illustrated in Fig. 9B.
  • the M-60 residue is located in the viral membrane, while the E-107 residue inserts into the cell membrane, and the two membranes are forced to fuse following low pH- dependent rearrangement of the E protein (which based on our data could be facilitated by the M protein ectodomain).
  • a more appropriate amino acid at either of these two residues may facilitate fusion of the membranes. Because our data establish for the first time that both the ectodomain of the M protein and its transmembrane domain are of functional significance, the entire M protein can now be considered an attractive target for mutagenesis to attenuate Flaviviruses for the purpose of developing new live attenuated vaccines.
  • amino acid changes for example, random or specific (following further analysis of protein structure) amino acid changes, or deletions of increasing length, e.g., of 1, 2, 3, 4, 5, etc., amino acids, can be incorporated throughout the protein with the expectation that biological phenotype of the virus will be altered, resulting in significant attenuation.
  • Viremia is a measure of viscerotropism (virulence) of the vaccine virus.
  • a vaccine with reduced viremia is considered safer, since cell damage and dysfunction of organs sustaining virus replication and contributing to viremia is reduced, as is the likelihood that the virus will cross the blood brain barrier and invade the central nervous system.
  • the M60 mutant was as highly immunogenic in humans as the non- mutant.
  • Table HA Viremia profiles in subjects enrolled in Study H-040-003 in which ChimeriVaxTM-JE with the M60 arginine amino acid was administered. The dose range in bold is similar to that given in another study (H-040-007) in which the 15 mutant M-60 cysteine vaccine was administered.
  • the column illustrates the oligonucleotide used to generate chimeric YF/Flavivirus primers corresponding to the C/prM or E/NS1 junction (See text)
  • X carboxyl terminal coding sequence of the YF capsid
  • the underlined region corresponds to the targeted heterologous sequence immediately upstream of the Narl site (antisense - ccgcgg) This site allows insertion of PCR products into the Yfm5 2 (Na ⁇ ) plasmid required for generating full-length cDNA templates
  • Other nucleotides are specific to the heterologous virus Oligonucleotide primers are listed 5' to 3'

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • General Health & Medical Sciences (AREA)
  • Virology (AREA)
  • Medicinal Chemistry (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biophysics (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Biochemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Immunology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Physics & Mathematics (AREA)
  • Oncology (AREA)
  • Communicable Diseases (AREA)
  • Plant Pathology (AREA)
  • Microbiology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Crystallography & Structural Chemistry (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
PCT/US2005/037369 2004-10-20 2005-10-19 Vaccines against japanese encephalitis virus and west nile virus Ceased WO2006044857A2 (en)

Priority Applications (12)

Application Number Priority Date Filing Date Title
KR1020077011389A KR101501162B1 (ko) 2004-10-20 2005-10-19 일본 뇌염 바이러스 및 웨스트 나일 바이러스에 대한 백신
HK08100487.2A HK1106723B (en) 2004-10-20 2005-10-19 Vaccines against japanese encephalitis virus and west nile virus
JP2007537962A JP4993301B2 (ja) 2004-10-20 2005-10-19 日本脳炎ウイルスおよび西ナイルウイルスに対するワクチン
EA200700904A EA015907B1 (ru) 2004-10-20 2005-10-19 Рекомбинантный флавивирус и его применение
CA2584228A CA2584228C (en) 2004-10-20 2005-10-19 Vaccines against japanese encephalitis virus and west nile virus
US11/577,569 US8029802B2 (en) 2004-10-20 2005-10-19 Vaccines against Japanese encephalitis virus and West Nile virus
AU2005295438A AU2005295438B2 (en) 2004-10-20 2005-10-19 Vaccines against Japanese encephalitis virus and West Nile virus
EP05811861.3A EP1809325B1 (en) 2004-10-20 2005-10-19 Vaccines against japanese encephalitis virus
CN200580043790.0A CN101084010B (zh) 2004-10-20 2005-10-19 抗日本脑炎病毒及西尼罗病毒的疫苗
IL182453A IL182453A0 (en) 2004-10-20 2007-04-11 Vaccines against japanese encephalitis virus and west nile virus
NO20071924A NO20071924L (no) 2004-10-20 2007-04-16 Vaksiner mot japansk ecefalittvirus og West Nile virus
US13/251,424 US8691550B2 (en) 2004-10-20 2011-10-03 Vaccines against japanese encephalitis virus and west nile virus

Applications Claiming Priority (10)

Application Number Priority Date Filing Date Title
US62046604P 2004-10-20 2004-10-20
US60/620,466 2004-10-20
US62094804P 2004-10-21 2004-10-21
US60/620,948 2004-10-21
US67441505P 2005-04-24 2005-04-24
US60/674,415 2005-04-24
US67454605P 2005-04-25 2005-04-25
US60/674,546 2005-04-25
US71892305P 2005-09-19 2005-09-19
US60/718,923 2005-09-19

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US11/577,569 A-371-Of-International US8029802B2 (en) 2004-10-20 2005-10-19 Vaccines against Japanese encephalitis virus and West Nile virus
US13/251,424 Continuation US8691550B2 (en) 2004-10-20 2011-10-03 Vaccines against japanese encephalitis virus and west nile virus

Publications (2)

Publication Number Publication Date
WO2006044857A2 true WO2006044857A2 (en) 2006-04-27
WO2006044857A3 WO2006044857A3 (en) 2006-08-10

Family

ID=36203650

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2005/037369 Ceased WO2006044857A2 (en) 2004-10-20 2005-10-19 Vaccines against japanese encephalitis virus and west nile virus

Country Status (13)

Country Link
US (2) US8029802B2 (https=)
EP (1) EP1809325B1 (https=)
JP (1) JP4993301B2 (https=)
KR (1) KR101501162B1 (https=)
AU (1) AU2005295438B2 (https=)
CA (1) CA2584228C (https=)
EA (1) EA015907B1 (https=)
IL (1) IL182453A0 (https=)
MY (1) MY148075A (https=)
NO (1) NO20071924L (https=)
NZ (1) NZ584079A (https=)
SG (1) SG156666A1 (https=)
WO (1) WO2006044857A2 (https=)

Cited By (21)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7459160B2 (en) 2002-01-15 2008-12-02 Acambis Inc. Chimeric flaviviruses
US7507415B2 (en) 2002-11-15 2009-03-24 Acambis Inc. West nile virus vaccine
US7569383B2 (en) 2001-06-01 2009-08-04 Acambis Inc. Chimeric flavivirus vectors
US20100255028A1 (en) * 2007-01-31 2010-10-07 Sanofi Pasteur Biologics Co. Flavivirus Vaccine Vector Against Influenza Virus
CN101926989A (zh) * 2010-06-29 2010-12-29 西北农林科技大学 表达jev免疫原基因的重组减毒鼠伤寒沙门氏菌载体疫苗及其制备方法
US8029802B2 (en) 2004-10-20 2011-10-04 Sanofi Pasteur Biologics Co. Vaccines against Japanese encephalitis virus and West Nile virus
CN102292345A (zh) * 2008-11-17 2011-12-21 Vgx药品有限责任公司 引起对抗黄病毒的免疫应答的抗原及其应用方法
US8124398B2 (en) 2005-04-24 2012-02-28 Sanofi Pasteur Biologics Co. Recombinant flavivirus vaccines
EP2535058A2 (en) 2006-11-07 2012-12-19 Sanofi Pasteur Biologics, LLC Stabilization of vaccines by lyophilization
JP2013234188A (ja) * 2006-09-29 2013-11-21 Takeda Vaccines (Montana) Inc ノロウイルスワクチン製剤
US8841120B2 (en) 2008-08-08 2014-09-23 Takeda Vaccines, Inc. Virus-like particles comprising composite capsid amino acid sequences for enhanced cross reactivity
AU2013204985B2 (en) * 2005-04-24 2016-01-28 Sanofi Pasteur Biologics, Llc Recombinant flavivirus vaccines
WO2016079560A1 (en) * 2014-11-21 2016-05-26 Institut Pasteur A live and attenuated japanese encephalitis virus comprising a mutated m protein
WO2016106107A2 (en) 2014-12-22 2016-06-30 Merck Sharp & Dohme Corp. Dengue virus vaccine compositions and methods of use thereof
US9801934B2 (en) 2011-07-11 2017-10-31 Takeda Vaccines, Inc. Parenteral norovirus vaccine formulations
US9821049B2 (en) 2007-09-18 2017-11-21 Takeda Vaccines, Inc. Method of conferring a protective immune response to Norovirus
US9861692B2 (en) 2013-06-21 2018-01-09 Merck Sharp & Dohme Corp. Dengue virus vaccine compositions and methods of use thereof
CN108601825A (zh) * 2015-07-16 2018-09-28 巴拉特生物技术国际有限公司 疫苗组合物
US10130696B2 (en) 2007-09-18 2018-11-20 Takeda Vaccines, Inc. Method of conferring a protective immune response to norovirus
WO2020194063A1 (en) * 2019-03-28 2020-10-01 Institut Pasteur A live and attenuated flavivirus comprising a mutated m protein
WO2024254552A1 (en) * 2023-06-08 2024-12-12 Modernatx, Inc. Stabilized flavivirus vaccines

Families Citing this family (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2009241354B2 (en) * 2008-04-30 2014-06-12 The Government Of The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services, Centers For Disease Control And Prevention Chimeric West Nile/Dengue viruses
US8968996B2 (en) 2009-06-01 2015-03-03 Takeda Vaccines, Inc. Compositions and methods for rapid immunization against dengue virus
AU2010256845B2 (en) * 2009-06-01 2016-09-22 Takeda Vaccines, Inc. Compositions and methods for administration of vaccines against dengue virus
CA3150411C (en) 2009-07-31 2023-09-12 Pnuvax Inc. High yield yellow fever virus strain with increased propagation in cells
EP2550292B1 (en) * 2010-03-24 2017-11-22 Research Development Foundation Flavivirus host range mutations and uses thereof
WO2012003320A2 (en) * 2010-07-01 2012-01-05 Research Development Foundation Flavivirus host-range mutations and uses thereof
US9267114B2 (en) * 2012-11-07 2016-02-23 Southern Research Institute Flavivirus envelope protein mutations affecting virion disassembly
US9878031B2 (en) 2012-12-14 2018-01-30 Takeda Vaccines, Inc. Compositions, methods of administration and uses for trivalent dengue virus formulations
ES2745431T3 (es) * 2013-06-26 2020-03-02 Univ North Carolina Chapel Hill Composiciones para vacunas contra el virus del dengue y su uso

Citations (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5173418A (en) 1985-05-10 1992-12-22 Benzon Pharma, A/S Production in Escherichia coli of extracellular Serratia spp. hydrolases
WO1998037911A1 (en) 1997-02-28 1998-09-03 Oravax, Inc. Chimeric flavivirus vaccines
WO2001039802A1 (en) 1999-12-01 2001-06-07 Oravax, Inc. Chimeric flavivirus vaccines
WO2003060088A2 (en) 2002-01-15 2003-07-24 Acambis, Inc. Viral vaccine production method
WO2003103571A2 (en) 2002-01-15 2003-12-18 Acambis, Inc. Flavivirus vaccines
US6696281B1 (en) 1997-02-28 2004-02-24 Acambis, Inc. Chimeric flavivirus vaccines
WO2005082020A2 (en) 2004-02-27 2005-09-09 Acambis Inc. Flavivirus vaccines

Family Cites Families (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6184024B1 (en) 1988-07-14 2001-02-06 The United States Of America As Represented By The Department Of Health And Human Services Chimeric and/or growth-restricted flaviviruses
US6676936B1 (en) 1988-07-14 2004-01-13 The United States Of America As Represented By The Department Of Health And Human Services. Chimeric and/or growth-restricted flaviviruses
US6589533B1 (en) 1997-09-18 2003-07-08 Research Development Foundation Genetically-engineered alphaviruses, flaviviruses, and bunyaviruses with modified envelope transmembrane glycoproteins and altered host-range phenotype
AU9794198A (en) 1997-10-08 1999-04-27 Government Of The United States Of America, As Represented By The Secretary Of The Department Of Health And Human Services, The Chimeric vaccine against tick-borne encephalitis virus
US7227011B2 (en) * 1998-06-04 2007-06-05 United States Of America As Represented By The Secretary Of The Department Of Health And Human Services, Centers For Disease Control And Prevention Nucleic acid vaccines for prevention of flavivirus infection
WO2002081753A1 (en) 2001-04-04 2002-10-17 Advanced Research & Technology Institute Method for identifying and characterizing individual dna molecules
WO2004045529A2 (en) 2002-11-15 2004-06-03 Acambis, Inc. West nile virus vaccine
US7189403B2 (en) * 2003-06-30 2007-03-13 Institut Pasteur Attenuated flavivirus strains containing a mutated M-ectodomain and their applications
SG156666A1 (en) 2004-10-20 2009-11-26 Acambis Inc Vaccines against japanese encephalitis virus and west nile virus
CA2605924A1 (en) 2005-04-24 2006-11-02 Acambis Inc. Recombinant flavivirus vaccines

Patent Citations (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5173418A (en) 1985-05-10 1992-12-22 Benzon Pharma, A/S Production in Escherichia coli of extracellular Serratia spp. hydrolases
WO1998037911A1 (en) 1997-02-28 1998-09-03 Oravax, Inc. Chimeric flavivirus vaccines
US6696281B1 (en) 1997-02-28 2004-02-24 Acambis, Inc. Chimeric flavivirus vaccines
WO2001039802A1 (en) 1999-12-01 2001-06-07 Oravax, Inc. Chimeric flavivirus vaccines
WO2003060088A2 (en) 2002-01-15 2003-07-24 Acambis, Inc. Viral vaccine production method
WO2003103571A2 (en) 2002-01-15 2003-12-18 Acambis, Inc. Flavivirus vaccines
WO2005082020A2 (en) 2004-02-27 2005-09-09 Acambis Inc. Flavivirus vaccines

Non-Patent Citations (33)

* Cited by examiner, † Cited by third party
Title
"Remington 's Pharmaceutical Sciences", 1990, MACK PUBLISHING CO.
ARROYO ET AL., J. VIROL., vol. 78, 2004, pages 12497 - 12507
BURKE; MONATH: "Fields Virology", 2001, pages: 1043 - 1126
CHAMBERS ET AL., J. VIROL., vol. 73, 1999, pages 3095 - 3101
DOS SANTOS ET AL., VIRUS RES., vol. 35, 1995, pages 35 - 41
GALLER ET AL., VACCINES, vol. 16, no. 9/10, 1998, pages 1024 - 1028
GUIRAKHOO ET AL., J. GEN. VIROL., vol. 72, 1991, pages 1323 - 1329
GUIRAKHOO ET AL., J. VIROL., vol. 75, 2001, pages 7290 - 7304
GUIRAKHOO ET AL., J. VIROL., vol. 78, 2004, pages 4761 - 4775
GUIRAKHOO ET AL., J. VIROL., vol. 78, 2004, pages 9998 - 10008
GUIRAKHOO ET AL., J. VIROL., vol. 78, no. 18, 2004, pages 9998 - 10008
GUIRAKHOO ET AL., VIROLOGY, vol. 191, 1992, pages 921 - 931
GUIRAKHOO ET AL., VIROLOGY, vol. 257, 1999, pages 363 - 372
GUIRAKHOO ET AL., VIROLOGY, vol. 298, 2002, pages 146 - 159
KOFLER ET AL., J. VIROL., vol. 76, 2002, pages 3534 - 3543
LINDENBACH; RICE: "Fields Virology", 2001, pages: 991 - 1041
MCLDA ET AL., VIROLOGY, vol. 158, 1987, pages 348 - 360
MODIS ET AL., NATURE, vol. 427, no. 6972, 2004, pages 313 - 319
MONATH ET AL., BIOLOGICALS, vol. 33, 2005, pages 131 - 144
MONATH ET AL., CURR. DRUG TARGETS - INF. DISORDERS, vol. 1, 2001, pages 37 - 50
MONATH ET AL., J. INFECT. DIS., vol. 188, 2003, pages 1213 - 1230
MONATH ET AL., J. VIROL., vol. 76, 2002, pages 1932 - 1943
MONATH ET AL., VACCINE, vol. 17, 1999, pages 1869 - 1882
MONATH ET AL., VACCINE, vol. 20, 2002, pages 1004 - 1018
MUTEBI ET AL., J. VIROL., vol. 78, 2004, pages 9652 - 9665
PLETNEV ET AL., VIROLOGY, vol. 174, 1990, pages 250 - 263
PUGACHEV ET AL., INT. J. PARASITOL., vol. 33, 2003, pages 567 - 582
REY ET AL., NATURE, vol. 375, 1995, pages 291 - 298
RICE ET AL., SCIENCE, vol. 229, 1985, pages 726 - 733
RICE ET AL., THE NEW BIOLOGIST, vol. 1, 1989, pages 285 - 96
See also references of EP1809325A4
TESH ET AL., EMER. INFECT. DIS., vol. 8, 2002, pages 1392 - 1397
YASUMURA ET AL., NIHON RINSHO, vol. 21, 1963, pages 1201 - 1215

Cited By (46)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7569383B2 (en) 2001-06-01 2009-08-04 Acambis Inc. Chimeric flavivirus vectors
US8852914B2 (en) 2002-01-15 2014-10-07 Sanofi Pasteur Biologics, Llc Flavivirus vaccines
US7459160B2 (en) 2002-01-15 2008-12-02 Acambis Inc. Chimeric flaviviruses
US10172929B2 (en) 2002-01-15 2019-01-08 Sanofi Pasteur Biologics, Llc Flavivirus vaccines
US8088391B2 (en) 2002-11-15 2012-01-03 Sanofi Pasteur Biologics Co. West nile virus vaccine
US7507415B2 (en) 2002-11-15 2009-03-24 Acambis Inc. West nile virus vaccine
US8029802B2 (en) 2004-10-20 2011-10-04 Sanofi Pasteur Biologics Co. Vaccines against Japanese encephalitis virus and West Nile virus
US8691550B2 (en) 2004-10-20 2014-04-08 Sanofi Pasteur Biologics, Llc Vaccines against japanese encephalitis virus and west nile virus
US8124398B2 (en) 2005-04-24 2012-02-28 Sanofi Pasteur Biologics Co. Recombinant flavivirus vaccines
US8871222B2 (en) 2005-04-24 2014-10-28 Sanofi Pasteur Biologics, Llc Recombinant Flavivirus vaccines
AU2013204985B2 (en) * 2005-04-24 2016-01-28 Sanofi Pasteur Biologics, Llc Recombinant flavivirus vaccines
JP2013234188A (ja) * 2006-09-29 2013-11-21 Takeda Vaccines (Montana) Inc ノロウイルスワクチン製剤
US9272028B2 (en) 2006-09-29 2016-03-01 Takeda Vaccines, Inc. Norovirus vaccine formulations
US10010599B2 (en) 2006-09-29 2018-07-03 Takeda Vaccines, Inc. Norovirus vaccine formulations
US9861691B2 (en) 2006-09-29 2018-01-09 Takeda Vaccines, Inc. Norovirus vaccine formulations
US10512682B2 (en) 2006-09-29 2019-12-24 Takeda Vaccines, Inc. Norovirus vaccine formulations
US9308249B2 (en) 2006-09-29 2016-04-12 Takeda Vaccines, Inc. Norovirus vaccine formulations
EP2535058A2 (en) 2006-11-07 2012-12-19 Sanofi Pasteur Biologics, LLC Stabilization of vaccines by lyophilization
EP2851087A1 (en) 2006-11-07 2015-03-25 Sanofi Pasteur Biologics, LLC Stabilization of vaccines by lyophilization
US9132184B2 (en) 2006-11-07 2015-09-15 Sanofi Pasteur Biologics, Llc Stabilization of vaccines by lyophilization
US8591916B2 (en) * 2007-01-31 2013-11-26 Sanofi Pasteur Biologics, Llc Flavivirus vaccine vector against influenza virus
US20100255028A1 (en) * 2007-01-31 2010-10-07 Sanofi Pasteur Biologics Co. Flavivirus Vaccine Vector Against Influenza Virus
US11826415B2 (en) 2007-09-18 2023-11-28 Takeda Vaccines, Inc. Method of conferring a protective immune response to Norovirus
US11040097B2 (en) 2007-09-18 2021-06-22 Takeda Vaccines, Inc. Method of conferring a protective immune response to norovirus
US9821049B2 (en) 2007-09-18 2017-11-21 Takeda Vaccines, Inc. Method of conferring a protective immune response to Norovirus
US10130696B2 (en) 2007-09-18 2018-11-20 Takeda Vaccines, Inc. Method of conferring a protective immune response to norovirus
US10688174B2 (en) 2007-09-18 2020-06-23 Takeda Vaccines, Inc. Method of conferring a protective immune response to norovirus
US8841120B2 (en) 2008-08-08 2014-09-23 Takeda Vaccines, Inc. Virus-like particles comprising composite capsid amino acid sequences for enhanced cross reactivity
US9518096B2 (en) 2008-08-08 2016-12-13 Takeda Vaccines, Inc. Virus-like particles comprising composite capsid amino acid sequences for enhanced cross reactivity
CN102292345B (zh) * 2008-11-17 2015-12-02 Vgx药品有限责任公司 引起对抗黄病毒的免疫应答的抗原及其应用方法
CN102292345A (zh) * 2008-11-17 2011-12-21 Vgx药品有限责任公司 引起对抗黄病毒的免疫应答的抗原及其应用方法
CN101926989A (zh) * 2010-06-29 2010-12-29 西北农林科技大学 表达jev免疫原基因的重组减毒鼠伤寒沙门氏菌载体疫苗及其制备方法
US9867876B2 (en) 2011-07-11 2018-01-16 Takeda Vaccines, Inc. Parenteral norovirus vaccine formulations
US11701420B2 (en) 2011-07-11 2023-07-18 Takeda Vaccines, Inc. Parenteral norovirus vaccine formulations
US9801934B2 (en) 2011-07-11 2017-10-31 Takeda Vaccines, Inc. Parenteral norovirus vaccine formulations
US10675341B2 (en) 2011-07-11 2020-06-09 Takeda Vaccines, Inc. Parenteral norovirus vaccine formulations
US9861692B2 (en) 2013-06-21 2018-01-09 Merck Sharp & Dohme Corp. Dengue virus vaccine compositions and methods of use thereof
WO2016079560A1 (en) * 2014-11-21 2016-05-26 Institut Pasteur A live and attenuated japanese encephalitis virus comprising a mutated m protein
US10449243B2 (en) 2014-12-22 2019-10-22 Merck Sharp & Dohme Corp. Dengue virus vaccine compositions and methods of use thereof
WO2016106107A2 (en) 2014-12-22 2016-06-30 Merck Sharp & Dohme Corp. Dengue virus vaccine compositions and methods of use thereof
EP3322441A4 (en) * 2015-07-16 2018-12-19 Bharat Biotech International Limited Vaccine compositions
CN108601825B (zh) * 2015-07-16 2023-06-20 巴拉特生物技术国际有限公司 疫苗组合物
CN108601825A (zh) * 2015-07-16 2018-09-28 巴拉特生物技术国际有限公司 疫苗组合物
AU2022204267B2 (en) * 2015-07-16 2025-06-26 Bharat Biotech International Limited Vaccine compositions
WO2020194063A1 (en) * 2019-03-28 2020-10-01 Institut Pasteur A live and attenuated flavivirus comprising a mutated m protein
WO2024254552A1 (en) * 2023-06-08 2024-12-12 Modernatx, Inc. Stabilized flavivirus vaccines

Also Published As

Publication number Publication date
WO2006044857A3 (en) 2006-08-10
JP2008520187A (ja) 2008-06-19
KR101501162B1 (ko) 2015-03-16
EP1809325A4 (en) 2009-07-22
CA2584228C (en) 2015-05-05
JP4993301B2 (ja) 2012-08-08
EP1809325A2 (en) 2007-07-25
AU2005295438B2 (en) 2012-07-05
KR20070072597A (ko) 2007-07-04
EP1809325B1 (en) 2013-11-20
US8029802B2 (en) 2011-10-04
US8691550B2 (en) 2014-04-08
US20120201852A1 (en) 2012-08-09
NO20071924L (no) 2007-07-17
MY148075A (en) 2013-02-28
IL182453A0 (en) 2007-07-24
EA015907B1 (ru) 2011-12-30
EA200700904A1 (ru) 2007-12-28
SG156666A1 (en) 2009-11-26
NZ584079A (en) 2011-10-28
US20070269458A1 (en) 2007-11-22
CA2584228A1 (en) 2006-04-27
HK1106723A1 (en) 2008-03-20
AU2005295438A1 (en) 2006-04-27

Similar Documents

Publication Publication Date Title
US8691550B2 (en) Vaccines against japanese encephalitis virus and west nile virus
US8871222B2 (en) Recombinant Flavivirus vaccines
US20100158938A1 (en) Tetravalent Dengue Vaccines
RU2209082C2 (ru) Химерные флавивирусные вакцины
JP5538729B2 (ja) 偽感染性フラビウイルスおよびそれらの使用
WO2018129160A1 (en) Live attenuated flavivirus vaccines and methods of using and making same
CN101084010B (zh) 抗日本脑炎病毒及西尼罗病毒的疫苗
CA2400182C (en) Full-length infectious cdna clones of tick borne flavivirus
AU2013204985B2 (en) Recombinant flavivirus vaccines
HK1106723B (en) Vaccines against japanese encephalitis virus and west nile virus
HK1120431A (en) Recombinant flavivirus vaccines

Legal Events

Date Code Title Description
AK Designated states

Kind code of ref document: A2

Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BW BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE EG ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KM KP KR KZ LC LK LR LS LT LU LV LY MA MD MG MK MN MW MX MZ NA NG NI NO NZ OM PG PH PL PT RO RU SC SD SE SG SK SL SM SY TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW

AL Designated countries for regional patents

Kind code of ref document: A2

Designated state(s): GM KE LS MW MZ NA SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IS IT LT LU LV MC NL PL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG

121 Ep: the epo has been informed by wipo that ep was designated in this application
DPE1 Request for preliminary examination filed after expiration of 19th month from priority date (pct application filed from 20040101)
WWE Wipo information: entry into national phase

Ref document number: 2007537962

Country of ref document: JP

WWE Wipo information: entry into national phase

Ref document number: 2584228

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 182453

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 12007500819

Country of ref document: PH

WWE Wipo information: entry into national phase

Ref document number: 554542

Country of ref document: NZ

WWE Wipo information: entry into national phase

Ref document number: 2005295438

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 11577569

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2005811861

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2005295438

Country of ref document: AU

Date of ref document: 20051019

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 1200700967

Country of ref document: VN

WWE Wipo information: entry into national phase

Ref document number: 1020077011389

Country of ref document: KR

WWE Wipo information: entry into national phase

Ref document number: 2180/CHENP/2007

Country of ref document: IN

WWE Wipo information: entry into national phase

Ref document number: 200700904

Country of ref document: EA

WWE Wipo information: entry into national phase

Ref document number: 200580043790.0

Country of ref document: CN

WWP Wipo information: published in national office

Ref document number: 2005811861

Country of ref document: EP

WWP Wipo information: published in national office

Ref document number: 11577569

Country of ref document: US